F446293

General Info

Members Datasets Scaffolds Average Seq Length
449 256 441 192

Family's Representative Sequence

Representative Sequence 3300001991|JGI24743J22301_10053779|JGI24743J22301_100537791
Length 214
Sequence MLDSGMTIEERRERDRAARRQLIVTTSRRIAEAEGWDAVTTRRLSAEIEYSQPVLYKHFSNMEAIAHSVAVEGFRELAESLSNARRGAAEPEHALRRIAHAYIDFAIANPAVYDAMFTRTTTLHFAASDTPPELSAGFAELRAVVAAVADTXDADTATETLWAALHGLATLGRSGRLRSGHDSERVNLLAAQFAATGCAAIASPPRTLIAPPDV

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
4 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
5 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
6 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
7 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
8 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
11 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
157 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
158 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
164 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
165 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
166 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
167 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
168 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
169 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
170 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
171 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
172 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
173 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
174 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
175 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
176 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
177 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
180 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
181 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
182 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
188 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
189 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
190 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
191 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
194 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
197 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
198 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
199 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
200 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
208 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
209 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
210 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
229 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
232 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
233 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
234 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
235 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
236 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
237 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
238 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
239 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
240 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
241 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
246 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
247 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
248 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
249 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
250 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
251 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
252 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
253 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
254 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
255 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
256 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.22
Metatranscriptomes 0
Isolates 1.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.24
Nodule 0.22
Rhizoplane 14.48
Rhizosphere 67.71
Stem 0
Stem Tuber 0
Unclassified 7.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10114016 3300001990 Bacteria 799
2 JGI24743J22301_10053779 3300001991 Bacteria 823
3 JGI24744J21845_10007134 3300002077 Bacteria 2309
4 JGI24751J29686_10050678 3300002459 Bacteria 856
5 rootH2_10003517 3300003320 Bacteria 2453
6 Ga0070683_100024037 3300005329 Bacteria 5454
7 Ga0070670_100048768 3300005331 Bacteria 3644
8 Ga0068869_100045084 3300005334 Bacteria 3173
9 Ga0070680_100378585 3300005336 Bacteria 1205
10 Ga0070682_100059755 3300005337 Bacteria 2408
11 Ga0070682_100522214 3300005337 Bacteria 924
12 Ga0070660_100136064 3300005339 Bacteria 1969
13 Ga0070689_100158784 3300005340 Bacteria 1827
14 Ga0070661_100550966 3300005344 Bacteria 928
15 Ga0070692_10072662 3300005345 Bacteria 1836
16 Ga0070668_100001409 3300005347 Bacteria 17298
17 Ga0070668_100307742 3300005347 Bacteria 1331
18 Ga0070671_100005370 3300005355 Bacteria 10216
19 Ga0070671_100160232 3300005355 Bacteria 1902
20 Ga0070674_100111796 3300005356 Bacteria 2007
21 Ga0070674_100375282 3300005356 Bacteria 1155
22 Ga0070674_101020337 3300005356 Bacteria 727
23 Ga0070673_100402363 3300005364 Bacteria 1224
24 Ga0070659_100167104 3300005366 Bacteria 1800
25 Ga0070667_100014088 3300005367 Bacteria 6607
26 Ga0070667_100253098 3300005367 Bacteria 1575
27 Ga0070709_10174016 3300005434 Bacteria 1507
28 Ga0070714_100290605 3300005435 Bacteria 1521
29 Ga0070714_100538804 3300005435 Bacteria 1116
30 Ga0070713_100651580 3300005436 Bacteria 1003
31 Ga0070713_100915910 3300005436 Bacteria 843
32 Ga0070713_101074094 3300005436 Bacteria 778
33 Ga0070710_10006671 3300005437 Bacteria 5557
34 Ga0070710_10092821 3300005437 Bacteria 1783
35 Ga0070711_100058309 3300005439 Bacteria 2677
36 Ga0070711_100143966 3300005439 Bacteria 1790
37 Ga0070711_100211234 3300005439 Bacteria 1503
38 Ga0070711_100637241 3300005439 Bacteria 892
39 Ga0070700_100425455 3300005441 Bacteria 1004
40 Ga0070700_100498119 3300005441 Bacteria 936
41 Ga0070694_100190166 3300005444 Bacteria 1524
42 Ga0070663_100076745 3300005455 Bacteria 2444
43 Ga0070678_100596762 3300005456 Bacteria 985
44 Ga0070681_10534799 3300005458 Bacteria 1085
45 Ga0068867_100157744 3300005459 Bacteria 1787
46 Ga0068867_100185091 3300005459 Bacteria 1658
47 Ga0070685_10029806 3300005466 Bacteria 3035
48 Ga0070685_10237502 3300005466 Bacteria 1202
49 Ga0070679_100748604 3300005530 Bacteria 920
50 Ga0070684_100181188 3300005535 Bacteria 1915
51 Ga0070684_100282107 3300005535 Bacteria 1522
52 Ga0070684_100287136 3300005535 Bacteria 1508
53 Ga0070684_101264486 3300005535 Bacteria 694
54 Ga0070686_100464140 3300005544 Bacteria 976
55 Ga0070695_100171115 3300005545 Bacteria 1532
56 Ga0070693_100239965 3300005547 Bacteria 1196
57 Ga0070665_100040526 3300005548 Bacteria 4681
58 Ga0070665_100105557 3300005548 Bacteria 2819
59 Ga0070665_100275256 3300005548 Bacteria 1685
60 Ga0070665_100324631 3300005548 Bacteria 1543
61 Ga0070665_100361899 3300005548 Bacteria 1457
62 Ga0070665_100635154 3300005548 Bacteria 1081
63 Ga0070704_100151891 3300005549 Bacteria 1821
64 Ga0068855_100980455 3300005563 Bacteria 889
65 Ga0070664_100459424 3300005564 Bacteria 1170
66 Ga0068857_100495043 3300005577 Bacteria 1147
67 Ga0068854_100190325 3300005578 Bacteria 1607
68 Ga0068856_100314480 3300005614 Bacteria 1583
69 Ga0068856_100569884 3300005614 Bacteria 1153
70 Ga0070702_100011315 3300005615 Bacteria 4434
71 Ga0070702_100088602 3300005615 Bacteria 1871
72 Ga0068852_101360573 3300005616 Bacteria 732
73 Ga0068859_100240391 3300005617 Bacteria 1900
74 Ga0068866_10005788 3300005718 Bacteria 5127
75 Ga0068861_100243600 3300005719 Bacteria 1530
76 Ga0068861_100374119 3300005719 Bacteria 1257
77 Ga0068870_10146544 3300005840 Bacteria 1386
78 Ga0068863_100056106 3300005841 Bacteria 3729
79 Ga0068858_100040899 3300005842 Bacteria 4299
80 Ga0068858_100244014 3300005842 Bacteria 1705
81 Ga0068858_100457050 3300005842 Bacteria 1231
82 Ga0068858_100530695 3300005842 Bacteria 1139
83 Ga0068858_100835944 3300005842 Bacteria 899
84 Ga0068860_100160836 3300005843 Bacteria 2165
85 Ga0068860_100165861 3300005843 Bacteria 2132
86 Ga0068860_100530656 3300005843 Bacteria 1177
87 Ga0068862_101123656 3300005844 Bacteria 782
88 Ga0068862_101322843 3300005844 Bacteria 722
89 Ga0081540_1101460 3300005983 Bacteria 1238
90 Ga0075365_10010534 3300006038 Bacteria 5389
91 Ga0075365_10092840 3300006038 Bacteria 2058
92 Ga0075365_10185718 3300006038 Bacteria 1454
93 Ga0075365_10342884 3300006038 Bacteria 1053
94 Ga0075363_100035641 3300006048 Bacteria 2605
95 Ga0075364_10020947 3300006051 Bacteria 4117
96 Ga0075364_10453242 3300006051 Bacteria 876
97 Ga0075364_10491482 3300006051 Bacteria 839
98 Ga0070716_100002913 3300006173 Bacteria 7972
99 Ga0070716_100006776 3300006173 Bacteria 5613
100 Ga0070712_100015349 3300006175 Bacteria 4930
101 Ga0075369_10000287 3300006186 Bacteria 14948
102 Ga0075369_10005735 3300006186 Bacteria 4660
103 Ga0075369_10008758 3300006186 Bacteria 3908
104 Ga0075369_10009291 3300006186 Bacteria 3814
105 Ga0075369_10012279 3300006186 Bacteria 3383
106 Ga0075369_10072942 3300006186 Bacteria 1513
107 Ga0075369_10199384 3300006186 Bacteria 923
108 Ga0097621_100202545 3300006237 Bacteria 1724
109 Ga0097621_100296991 3300006237 Bacteria 1426
110 Ga0075370_10004860 3300006353 Bacteria 6591
111 Ga0075370_10052378 3300006353 Bacteria 2315
112 Ga0075370_10085364 3300006353 Bacteria 1818
113 Ga0068871_100358177 3300006358 Bacteria 1292
114 Ga0075430_100177133 3300006846 Bacteria 1774
115 Ga0075431_100052984 3300006847 Bacteria 4184
116 Ga0068865_100568970 3300006881 Bacteria 954
117 Ga0097620_100240403 3300006931 Bacteria 1900
118 Ga0099795_10091166 3300007788 Bacteria 1182
119 Ga0105240_10445960 3300009093 Bacteria 1449
120 Ga0105245_10436754 3300009098 Bacteria 1315
121 Ga0105247_10065981 3300009101 Bacteria 2252
122 Ga0105247_10141999 3300009101 Bacteria 1574
123 Ga0105243_10604338 3300009148 Bacteria 1056
124 Ga0105243_10705199 3300009148 Bacteria 984
125 Ga0105241_10298389 3300009174 Bacteria 1382
126 Ga0105242_10252745 3300009176 Bacteria 1589
127 Ga0105242_11598201 3300009176 Bacteria 685
128 Ga0105248_10074116 3300009177 Bacteria 3826
129 Ga0105248_11248553 3300009177 Bacteria 840
130 Ga0105237_10005283 3300009545 Bacteria 14604
131 Ga0105237_10095136 3300009545 Bacteria 2968
132 Ga0105237_10168167 3300009545 Bacteria 2192
133 Ga0105237_10345738 3300009545 Bacteria 1492
134 Ga0105238_10068510 3300009551 Bacteria 3550
135 Ga0105238_10196840 3300009551 Bacteria 1991
136 Ga0105238_10554300 3300009551 Bacteria 1154
137 Ga0105249_10124783 3300009553 Bacteria 2450
138 Ga0105249_10168863 3300009553 Bacteria 2120
139 Ga0105249_10628281 3300009553 Bacteria 1130
140 Ga0105249_12012464 3300009553 Bacteria 650
141 Ga0105239_10038236 3300010375 Bacteria 5259
142 Ga0105239_10051607 3300010375 Bacteria 4508
143 Ga0105239_10081259 3300010375 Bacteria 3567
144 Ga0105239_10354241 3300010375 Bacteria 1657
145 Ga0105239_10895299 3300010375 Bacteria 1018
146 Ga0105246_10714955 3300011119 Bacteria 879
147 Ga0157370_10042198 3300013104 Bacteria 4397
148 Ga0157369_10019567 3300013105 Bacteria 7576
149 Ga0157369_10086027 3300013105 Bacteria 3358
150 Ga0157369_10121390 3300013105 Bacteria 2773
151 Ga0157369_10641774 3300013105 Bacteria 1095
152 Ga0157369_11092167 3300013105 Bacteria 815
153 Ga0157374_10005075 3300013296 Bacteria 11042
154 Ga0157374_10042882 3300013296 Bacteria 4177
155 Ga0157374_10569377 3300013296 Bacteria 1141
156 Ga0157378_10184526 3300013297 Bacteria 1964
157 Ga0157378_10379632 3300013297 Bacteria 1388
158 Ga0163162_10033762 3300013306 Bacteria 5086
159 Ga0163162_10239551 3300013306 Bacteria 1945
160 Ga0163162_10360506 3300013306 Bacteria 1587
161 Ga0163162_11045748 3300013306 Bacteria 924
162 Ga0157372_10085238 3300013307 Bacteria 3583
163 Ga0157372_10335800 3300013307 Bacteria 1760
164 Ga0157375_10032508 3300013308 Bacteria 4950
165 Ga0157375_10284015 3300013308 Bacteria 1818
166 Ga0157375_10366164 3300013308 Bacteria 1608
167 Ga0157375_10711111 3300013308 Bacteria 1158
168 Ga0163163_10022551 3300014325 Bacteria 5965
169 Ga0163163_10118465 3300014325 Bacteria 2680
170 Ga0163163_10313832 3300014325 Bacteria 1621
171 Ga0163163_10432051 3300014325 Bacteria 1376
172 Ga0163163_10593252 3300014325 Bacteria 1171
173 Ga0157380_10479891 3300014326 Bacteria 1202
174 Ga0157380_11543659 3300014326 Bacteria 718
175 Ga0157377_10269802 3300014745 Bacteria 1111
176 Ga0157379_10240746 3300014968 Bacteria 1641
177 Ga0157376_10011495 3300014969 Bacteria 6529
178 Ga0157376_10240675 3300014969 Bacteria 1686
179 Ga0163161_10050001 3300017792 Bacteria 3023
180 Ga0163161_10159833 3300017792 Bacteria 1718
181 Ga0163161_10206376 3300017792 Bacteria 1516
182 Ga0213876_10032006 3300021384 Bacteria 2774
183 Ga0213876_10043136 3300021384 Bacteria 2384
184 Ga0209051_1000330 3300025303 Bacteria 71428
185 Ga0207653_10040795 3300025885 Bacteria 1523
186 Ga0207710_10348924 3300025900 Bacteria 754
187 Ga0207647_10025620 3300025904 Bacteria 3871
188 Ga0207647_10048978 3300025904 Bacteria 2622
189 Ga0207685_10015770 3300025905 Bacteria 2402
190 Ga0207699_10058700 3300025906 Bacteria 2303
191 Ga0207699_10157557 3300025906 Bacteria 1508
192 Ga0207645_10307328 3300025907 Bacteria 1056
193 Ga0207643_10068187 3300025908 Bacteria 2043
194 Ga0207671_10018609 3300025914 Bacteria 5323
195 Ga0207671_10324949 3300025914 Bacteria 1218
196 Ga0207657_10420756 3300025919 Bacteria 1050
197 Ga0207649_10071524 3300025920 Bacteria 2216
198 Ga0207652_10266954 3300025921 Bacteria 1544
199 Ga0207681_10100610 3300025923 Bacteria 2084
200 Ga0207694_10248013 3300025924 Bacteria 1456
201 Ga0207694_10321022 3300025924 Bacteria 1278
202 Ga0207650_10379434 3300025925 Bacteria 1167
203 Ga0207687_10689449 3300025927 Bacteria 866
204 Ga0207700_10451937 3300025928 Bacteria 1132
205 Ga0207664_10178634 3300025929 Bacteria 1821
206 Ga0207664_11127290 3300025929 Bacteria 701
207 Ga0207644_10093197 3300025931 Bacteria 2248
208 Ga0207644_11099988 3300025931 Bacteria 668
209 Ga0207690_10115458 3300025932 Bacteria 1940
210 Ga0207690_10751417 3300025932 Bacteria 804
211 Ga0207706_10006229 3300025933 Bacteria 11087
212 Ga0207670_10340517 3300025936 Bacteria 1185
213 Ga0207669_10220987 3300025937 Bacteria 1390
214 Ga0207704_10078332 3300025938 Bacteria 2125
215 Ga0207665_10162551 3300025939 Bacteria 1607
216 Ga0207665_10252661 3300025939 Bacteria 1303
217 Ga0207691_10127449 3300025940 Bacteria 2251
218 Ga0207711_10343253 3300025941 Bacteria 1382
219 Ga0207711_10446604 3300025941 Bacteria 1204
220 Ga0207689_10065205 3300025942 Bacteria 2996
221 Ga0207689_10215068 3300025942 Bacteria 1588
222 Ga0207661_10196117 3300025944 Bacteria 1773
223 Ga0207661_10416029 3300025944 Bacteria 1221
224 Ga0207667_10634016 3300025949 Bacteria 1075
225 Ga0207651_10465240 3300025960 Bacteria 1087
226 Ga0207712_10180038 3300025961 Bacteria 1659
227 Ga0207712_10294182 3300025961 Bacteria 1330
228 Ga0207712_10626195 3300025961 Bacteria 933
229 Ga0207668_10000534 3300025972 Bacteria 23819
230 Ga0207668_10134457 3300025972 Bacteria 1893
231 Ga0207668_10342210 3300025972 Bacteria 1248
232 Ga0207668_10609273 3300025972 Bacteria 952
233 Ga0207658_10030663 3300025986 Bacteria 3810
234 Ga0207658_10299858 3300025986 Bacteria 1384
235 Ga0207677_10009521 3300026023 Bacteria 5468
236 Ga0207703_10066524 3300026035 Bacteria 2964
237 Ga0207703_10145689 3300026035 Bacteria 2059
238 Ga0207703_10228003 3300026035 Bacteria 1669
239 Ga0207703_10321616 3300026035 Bacteria 1417
240 Ga0207639_10348204 3300026041 Bacteria 1323
241 Ga0207678_10005609 3300026067 Bacteria 11226
242 Ga0207678_10173712 3300026067 Bacteria 1840
243 Ga0207708_10003468 3300026075 Bacteria 11624
244 Ga0207708_10140760 3300026075 Bacteria 1892
245 Ga0207708_10237187 3300026075 Bacteria 1466
246 Ga0207702_10055439 3300026078 Bacteria 3361
247 Ga0207702_10493431 3300026078 Bacteria 1193
248 Ga0207641_10002119 3300026088 Bacteria 18758
249 Ga0207641_10233961 3300026088 Bacteria 1709
250 Ga0207641_10475403 3300026088 Bacteria 1211
251 Ga0207648_10023141 3300026089 Bacteria 5572
252 Ga0207648_10108054 3300026089 Bacteria 2442
253 Ga0207676_10947153 3300026095 Bacteria 846
254 Ga0207674_10387309 3300026116 Bacteria 1351
255 Ga0207675_100030992 3300026118 Bacteria 4980
256 Ga0207675_100050854 3300026118 Bacteria 3867
257 Ga0207675_100084140 3300026118 Bacteria 2985
258 Ga0207683_10044332 3300026121 Bacteria 3889
259 Ga0207683_10130256 3300026121 Bacteria 2262
260 Ga0209179_1042581 3300027512 Bacteria 959
261 Ga0268266_10023906 3300028379 Bacteria 5200
262 Ga0268266_10123327 3300028379 Bacteria 2308
263 Ga0268265_10217072 3300028380 Bacteria 1671
264 Ga0268264_10178709 3300028381 Bacteria 1925
265 Ga0307405_10073069 3300031731 Bacteria 2213
266 Ga0307409_100781072 3300031995 Bacteria 961
267 Ga0373934_0105496 3300035086 Bacteria 1141
268 Ga0373941_0086768 3300035115 Bacteria 1066
269 Ga0373942_0144546 3300035207 Bacteria 760
270 Ga0373931_0068890 3300035691 Bacteria 1927
271 Ga0373933_0006438 3300035724 Bacteria 6395
272 Ga0436364_1308388 3300037853 Bacteria 35210
273 Ga0436364_1326261 3300037853 Bacteria 4234
274 Ga0436365_0167673 3300039437 Bacteria 1333
275 Ga0436365_0642234 3300039437 Bacteria 19010
276 Ga0436365_0945559 3300039437 Bacteria 2526
277 Ga0436365_1636257 3300039437 Bacteria 2607
278 Ga0436365_1785794 3300039437 Bacteria 9905
279 Ga0436362_0359449 3300039453 Bacteria 684
280 Ga0436362_1213396 3300039453 Bacteria 873
281 Ga0439461_0001191 3300041410 Bacteria 3973
282 Ga0439465_0082732 3300041413 Bacteria 1091
283 Ga0451797_1368319 3300041453 Bacteria 1097
284 Ga0451795_0700446 3300041456 Bacteria 1808
285 Ga0451806_186320 3300041462 Bacteria 957
286 Ga0451855_0360734 3300041511 Bacteria 918
287 Ga0439431_0005097 3300041997 Bacteria 2896
288 Ga0439445_0008078 3300042004 Bacteria 2456
289 Ga0439434_0122019 3300042435 Bacteria 850
290 Ga0439459_0089296 3300042438 Bacteria 739
291 Ga0466969_0037015 3300044656 Bacteria 2462
292 Ga0466972_0014404 3300044658 Bacteria 3960
293 Ga0466972_0200988 3300044658 Bacteria 933
294 Ga0466965_0004566 3300044683 Bacteria 6163
295 Ga0466965_0032496 3300044683 Bacteria 2549
296 Ga0466966_0402496 3300044684 Bacteria 822
297 Ga0466961_0018831 3300044693 Bacteria 4442
298 Ga0466961_0218234 3300044693 Bacteria 1176
299 Ga0466964_0064154 3300044706 Bacteria 1536
300 Ga0466971_0120431 3300044719 Bacteria 1215
301 Ga0466971_0304639 3300044719 Bacteria 765
302 Ga0466968_0004438 3300044735 Bacteria 5249
303 Ga0466970_0068853 3300044765 Bacteria 1902
304 Ga0466957_0008307 3300044842 Bacteria 5901
305 Ga0466960_0000130 3300044901 Bacteria 25332
306 Ga0466960_0231272 3300044901 Bacteria 1020
307 Ga0466959_0192356 3300045049 Bacteria 1423
308 Ga0466967_0014281 3300045976 Bacteria 6179
309 Ga0495651_0012073 3300046462 Bacteria 6648
310 Ga0495653_0027680 3300046463 Bacteria 4537
311 Ga0495664_0008454 3300046477 Bacteria 5744
312 Ga0495583_0017828 3300046506 Bacteria 3757
313 Ga0495606_0057456 3300046507 Bacteria 2506
314 Ga0495628_0175897 3300046516 Bacteria 1621
315 Ga0495648_0011420 3300046524 Bacteria 6690
316 Ga0495642_0154433 3300046528 Bacteria 994
317 Ga0495652_0425693 3300046529 Bacteria 934
318 Ga0495654_0150065 3300046530 Bacteria 1032
319 Ga0495645_0207650 3300046543 Bacteria 1324
320 Ga0495667_0040376 3300046559 Bacteria 3098
321 Ga0495668_0045631 3300046616 Bacteria 2437
322 Ga0495611_0088700 3300046648 Bacteria 1428
323 Ga0495635_0071391 3300046663 Bacteria 2380
324 Ga0495657_0085405 3300046675 Bacteria 2034
325 Ga0495649_0323036 3300046694 Bacteria 783
326 Ga0495600_0042257 3300046809 Bacteria 2972
327 Ga0495604_0319503 3300047317 Bacteria 1038
328 Ga0495674_0064776 3300047319 Bacteria 3176
329 Ga0495672_0007953 3300047320 Bacteria 7905
330 Ga0495680_0063435 3300047322 Bacteria 2837
331 Ga0495675_0191547 3300047444 Bacteria 1248
332 Ga0495673_0006964 3300047469 Bacteria 6578
333 Ga0495602_0037306 3300048088 Bacteria 4513
334 Ga0496100_0206236 3300048903 Bacteria 1435
335 Ga0496100_0302015 3300048903 Bacteria 1198
336 Ga0496100_0484288 3300048903 Bacteria 952
337 Ga0496100_0495633 3300048903 Bacteria 941
338 Ga0496100_0782515 3300048903 Bacteria 747
339 Ga0496101_0000024 3300048904 Bacteria 205570
340 Ga0496101_0012239 3300048904 Bacteria 5720
341 Ga0496101_0024544 3300048904 Bacteria 4173
342 Ga0496101_0048964 3300048904 Bacteria 3038
343 Ga0496101_0993707 3300048904 Bacteria 660
344 Ga0496102_0000001 3300048905 Bacteria 873433
345 Ga0496102_0028976 3300048905 Bacteria 4949
346 Ga0496102_0053713 3300048905 Bacteria 3672
347 Ga0496102_0116281 3300048905 Bacteria 2496
348 Ga0496102_1203048 3300048905 Bacteria 677
349 Ga0496103_0000003 3300048906 Bacteria 603967
350 Ga0496103_0023206 3300048906 Bacteria 3740
351 Ga0496103_0401060 3300048906 Bacteria 881
352 Ga0496104_0008326 3300048907 Bacteria 9210
353 Ga0496104_0037926 3300048907 Bacteria 4507
354 Ga0496104_0059786 3300048907 Bacteria 3608
355 Ga0496104_0228441 3300048907 Bacteria 1773
356 Ga0496105_0014595 3300048908 Bacteria 6256
357 Ga0496105_0022825 3300048908 Bacteria 5071
358 Ga0496105_0052146 3300048908 Bacteria 3378
359 Ga0496106_0089013 3300048909 Bacteria 2380
360 Ga0496106_0534587 3300048909 Bacteria 941
361 Ga0496106_0688521 3300048909 Bacteria 815
362 Ga0496107_0045832 3300048910 Bacteria 3146
363 Ga0496107_0056927 3300048910 Bacteria 2826
364 Ga0496107_0076113 3300048910 Bacteria 2443
365 Ga0496107_0706428 3300048910 Bacteria 741
366 Ga0496107_0752029 3300048910 Bacteria 715
367 Ga0496108_0003205 3300048911 Bacteria 13161
368 Ga0496108_0021052 3300048911 Bacteria 5358
369 Ga0496108_0125051 3300048911 Bacteria 2207
370 Ga0496108_0202641 3300048911 Bacteria 1722
371 Ga0496108_0321994 3300048911 Bacteria 1348
372 Ga0496108_0541493 3300048911 Bacteria 1016
373 Ga0496109_0040971 3300048912 Bacteria 4196
374 Ga0496109_0230266 3300048912 Bacteria 1743
375 Ga0496109_0563947 3300048912 Bacteria 1074
376 Ga0496110_0051654 3300048913 Bacteria 3613
377 Ga0496110_0087115 3300048913 Bacteria 2789
378 Ga0496110_0120786 3300048913 Bacteria 2360
379 Ga0496110_0123939 3300048913 Bacteria 2330
380 Ga0496110_0203357 3300048913 Bacteria 1800
381 Ga0496111_0016139 3300048914 Bacteria 5144
382 Ga0496111_0322310 3300048914 Bacteria 1144
383 Ga0496111_0765441 3300048914 Bacteria 700
384 Ga0496111_0841187 3300048914 Bacteria 663
385 Ga0496112_0003401 3300048915 Bacteria 13142
386 Ga0496112_0032348 3300048915 Bacteria 5079
387 Ga0496112_0153109 3300048915 Bacteria 2273
388 Ga0496112_0925561 3300048915 Bacteria 793
389 Ga0496112_0943807 3300048915 Bacteria 784
390 Ga0496113_0044796 3300048916 Bacteria 3279
391 Ga0496113_0118828 3300048916 Bacteria 2065
392 Ga0496113_0460296 3300048916 Bacteria 1022
393 Ga0496114_0023818 3300048917 Bacteria 4996
394 Ga0496114_1085872 3300048917 Bacteria 685
395 Ga0496115_0190397 3300048918 Bacteria 1695
396 Ga0496116_0000013 3300048919 Bacteria 603993
397 Ga0496117_0000013 3300048920 Bacteria 603995
398 Ga0496118_0000011 3300048921 Bacteria 603995
399 Ga0496119_0038532 3300048922 Bacteria 3086
400 Ga0496120_0033500 3300048923 Bacteria 3086
401 Ga0496122_0038291 3300048925 Bacteria 3845
402 Ga0496123_0035717 3300048926 Bacteria 3537
403 Ga0496124_0197151 3300048927 Bacteria 1535
404 Ga0496125_0173034 3300048928 Bacteria 1449
405 Ga0496125_0378250 3300048928 Bacteria 836
406 Ga0496125_0565945 3300048928 Bacteria 627
407 Ga0496126_0002817 3300048929 Bacteria 22813
408 Ga0496126_0004888 3300048929 Bacteria 15665
409 Ga0496126_0093245 3300048929 Bacteria 2644
410 Ga0496126_0265847 3300048929 Bacteria 1425
411 nmdc:mga03n38_27965_c1 3300050490 Bacteria 2345
412 nmdc:mga00v17_144500_c1 3300050491 Bacteria 1527
413 nmdc:mga00v17_39143_c1 3300050491 Bacteria 2838
414 nmdc:mga00v17_4196_c1 3300050491 Bacteria 7477
415 nmdc:mga0yw44_116869_c1 3300050492 Bacteria 1714
416 nmdc:mga0yw44_64603_c1 3300050492 Bacteria 2253
417 nmdc:mga07m45_35839_c1 3300050496 Bacteria 2760
418 nmdc:mga07m45_66680_c1 3300050496 Bacteria 2045
419 nmdc:mga07m45_8204_c1 3300050496 Bacteria 5359
420 nmdc:mga05p37_393054_c1 3300050507 Bacteria 1621
421 nmdc:mga0qj67_176921_c1 3300050509 Bacteria 1733
422 nmdc:mga06r32_440036_c1 3300050510 Bacteria 1284
423 nmdc:mga0sz30_155508_c1 3300050516 Bacteria 1012
424 nmdc:mga0sz30_21564_c1 3300050516 Bacteria 2608
425 nmdc:mga0sz30_26695_c1 3300050516 Bacteria 2369
426 nmdc:mga0sz30_29415_c1 3300050516 Bacteria 2265
427 nmdc:mga0sz30_55738_c1 3300050516 Bacteria 1682
428 nmdc:mga0sz30_7413_c1 3300050516 Bacteria 4113
429 nmdc:mga0sz30_7796_c1 3300050516 Bacteria 4024
430 Ga0500635_0003022 3300053080 Bacteria 4194
431 Ga0500635_0195250 3300053080 Bacteria 785
432 Ga0500643_005411 3300053087 Bacteria 5504
433 Ga0500641_0047706 3300053096 Bacteria 1753
434 Ga0500642_0085071 3300053130 Bacteria 1457
435 Ga0500652_001215 3300053131 Bacteria 8214
436 Ga0500561_0044504 3300053137 Bacteria 1187
437 Ga0500568_0022923 3300053139 Bacteria 2662
438 Ga0500616_0007062 3300053153 Bacteria 7206
439 Ga0500611_092507 3300053727 Bacteria 772
440 Ga0500645_000126 3300053730 Bacteria 60162
441 Ga0466962_0245355 3300061719 Bacteria 879

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048910 Ga0496107_0752029 Ga0496107_0752029_180_680 151
2 3300048903 Ga0496100_0484288 Ga0496100_0484288_442_915 156
3 3300009553 Ga0105249_10124783 Ga0105249_101247833 166
4 3300048911 Ga0496108_0125051 Ga0496108_0125051_1238_1804 166
5 3300048915 Ga0496112_0003401 Ga0496112_0003401_10340_10906 166
6 3300044658 Ga0466972_0014404 Ga0466972_0014404_2357_2938 171
7 3300044683 Ga0466965_0004566 Ga0466965_0004566_5086_5667 171
8 3300044706 Ga0466964_0064154 Ga0466964_0064154_154_735 171
9 3300044719 Ga0466971_0120431 Ga0466971_0120431_352_933 171
10 3300044735 Ga0466968_0004438 Ga0466968_0004438_2912_3493 171
11 3300041511 Ga0451855_0360734 Ga0451855_0360734_195_713 172
12 3300044842 Ga0466957_0008307 Ga0466957_0008307_1321_1905 172
13 3300044901 Ga0466960_0231272 Ga0466960_0231272_417_1001 172
14 3300045976 Ga0466967_0014281 Ga0466967_0014281_2097_2681 172
15 3300005547 Ga0070693_100239965 Ga0070693_1002399651 174
16 3300005578 Ga0068854_100190325 Ga0068854_1001903252 174
17 3300017792 Ga0163161_10050001 Ga0163161_100500012 174
18 3300025907 Ga0207645_10307328 Ga0207645_103073282 174
19 3300026067 Ga0207678_10005609 Ga0207678_100056092 174
20 3300002459 JGI24751J29686_10050678 JGI24751J29686_100506781 175
21 3300005329 Ga0070683_100024037 Ga0070683_1000240376 175
22 3300005331 Ga0070670_100048768 Ga0070670_1000487682 175
23 3300005355 Ga0070671_100005370 Ga0070671_1000053705 175
24 3300005356 Ga0070674_100375282 Ga0070674_1003752821 175
25 3300005367 Ga0070667_100014088 Ga0070667_10001408810 175
26 3300005437 Ga0070710_10006671 Ga0070710_100066712 175
27 3300005439 Ga0070711_100143966 Ga0070711_1001439663 175
28 3300005441 Ga0070700_100425455 Ga0070700_1004254551 175
29 3300005544 Ga0070686_100464140 Ga0070686_1004641401 175
30 3300005548 Ga0070665_100040526 Ga0070665_1000405262 175
31 3300005549 Ga0070704_100151891 Ga0070704_1001518913 175
32 3300005615 Ga0070702_100011315 Ga0070702_1000113156 175
33 3300005617 Ga0068859_100240391 Ga0068859_1002403912 175
34 3300005841 Ga0068863_100056106 Ga0068863_1000561063 175
35 3300005842 Ga0068858_100244014 Ga0068858_1002440142 175
36 3300006173 Ga0070716_100006776 Ga0070716_1000067766 175
37 3300006175 Ga0070712_100015349 Ga0070712_1000153493 175
38 3300006931 Ga0097620_100240403 Ga0097620_1002404032 175
39 3300013306 Ga0163162_11045748 Ga0163162_110457482 175
40 3300014325 Ga0163163_10022551 Ga0163163_100225519 175
41 3300025900 Ga0207710_10348924 Ga0207710_103489241 175
42 3300025925 Ga0207650_10379434 Ga0207650_103794341 175
43 3300025931 Ga0207644_10093197 Ga0207644_100931973 175
44 3300025938 Ga0207704_10078332 Ga0207704_100783321 175
45 3300025961 Ga0207712_10180038 Ga0207712_101800382 175
46 3300025986 Ga0207658_10030663 Ga0207658_100306632 175
47 3300026088 Ga0207641_10002119 Ga0207641_100021199 175
48 3300026121 Ga0207683_10044332 Ga0207683_100443326 175
49 3300028379 Ga0268266_10023906 Ga0268266_100239063 175
50 3300048903 Ga0496100_0782515 Ga0496100_0782515_20_592 175
51 3300048904 Ga0496101_0024544 Ga0496101_0024544_336_908 175
52 3300048905 Ga0496102_0028976 Ga0496102_0028976_2838_3428 175
53 3300048905 Ga0496102_0053713 Ga0496102_0053713_1455_2027 175
54 3300048906 Ga0496103_0023206 Ga0496103_0023206_944_1516 175
55 3300048907 Ga0496104_0008326 Ga0496104_0008326_2631_3203 175
56 3300048908 Ga0496105_0022825 Ga0496105_0022825_3768_4340 175
57 3300048909 Ga0496106_0534587 Ga0496106_0534587_217_807 175
58 3300048913 Ga0496110_0123939 Ga0496110_0123939_1216_1788 175
59 3300048914 Ga0496111_0322310 Ga0496111_0322310_20_592 175
60 3300048916 Ga0496113_0460296 Ga0496113_0460296_36_608 175
61 3300048928 Ga0496125_0378250 Ga0496125_0378250_232_804 175
62 3300006186 Ga0075369_10072942 Ga0075369_100729422 176
63 3300006353 Ga0075370_10004860 Ga0075370_100048605 176
64 3300013306 Ga0163162_10239551 Ga0163162_102395513 176
65 3300013307 Ga0157372_10085238 Ga0157372_100852384 176
66 3300050516 nmdc:mga0sz30_55738_c1 nmdc:mga0sz30_55738_c1_821_1405 176
67 3300005444 Ga0070694_100190166 Ga0070694_1001901662 177
68 3300009177 Ga0105248_11248553 Ga0105248_112485532 177
69 3300025904 Ga0207647_10048978 Ga0207647_100489785 177
70 3300026075 Ga0207708_10140760 Ga0207708_101407602 177
71 3300048918 Ga0496115_0190397 Ga0496115_0190397_246_842 178
72 iso_pu_bacteria 2902837492 2902840851 180
73 3300006038 Ga0075365_10092840 Ga0075365_100928402 181
74 iso_pu_bacteria 2643221687 2644487752 183
75 3300025944 Ga0207661_10416029 Ga0207661_104160292 184
76 3300046559 Ga0495667_0040376 Ga0495667_0040376_2503_3057 184
77 3300005439 Ga0070711_100211234 Ga0070711_1002112343 185
78 iso_pu_bacteria 2738541274 2738703598 185
79 3300005355 Ga0070671_100160232 Ga0070671_1001602324 186
80 3300005535 Ga0070684_100287136 Ga0070684_1002871361 186
81 3300010375 Ga0105239_10895299 Ga0105239_108952992 186
82 3300014325 Ga0163163_10313832 Ga0163163_103138322 186
83 3300025932 Ga0207690_10751417 Ga0207690_107514171 186
84 3300026041 Ga0207639_10348204 Ga0207639_103482042 186
85 3300026067 Ga0207678_10173712 Ga0207678_101737122 186
86 3300026075 Ga0207708_10237187 Ga0207708_102371873 186
87 3300048903 Ga0496100_0495633 Ga0496100_0495633_311_904 186
88 3300048911 Ga0496108_0321994 Ga0496108_0321994_179_772 186
89 3300048913 Ga0496110_0051654 Ga0496110_0051654_971_1564 186
90 3300048914 Ga0496111_0841187 Ga0496111_0841187_23_616 186
91 3300048915 Ga0496112_0032348 Ga0496112_0032348_4080_4673 186
92 3300048916 Ga0496113_0118828 Ga0496113_0118828_66_659 186
93 3300041413 Ga0439465_0082732 Ga0439465_0082732_475_1059 187
94 3300042438 Ga0439459_0089296 Ga0439459_0089296_70_654 187
95 3300006038 Ga0075365_10185718 Ga0075365_101857182 188
96 3300006186 Ga0075369_10199384 Ga0075369_101993841 188
97 3300041453 Ga0451797_1368319 Ga0451797_1368319_222_788 188
98 3300041456 Ga0451795_0700446 Ga0451795_0700446_644_1210 188
99 3300041462 Ga0451806_186320 Ga0451806_186320_124_690 188
100 3300048910 Ga0496107_0076113 Ga0496107_0076113_1004_1594 188
101 3300050491 nmdc:mga00v17_39143_c1 nmdc:mga00v17_39143_c1_1429_1995 188
102 3300050492 nmdc:mga0yw44_116869_c1 nmdc:mga0yw44_116869_c1_639_1205 188
103 3300050496 nmdc:mga07m45_8204_c1 nmdc:mga07m45_8204_c1_490_1056 188
104 3300050516 nmdc:mga0sz30_155508_c1 nmdc:mga0sz30_155508_c1_16_582 188
105 iso_pu_bacteria 2902810491 2902813179 188
106 3300006186 Ga0075369_10008758 Ga0075369_100087584 189
107 3300009148 Ga0105243_10705199 Ga0105243_107051992 189
108 3300048928 Ga0496125_0173034 Ga0496125_0173034_73_675 189
109 3300048928 Ga0496125_0565945 Ga0496125_0565945_19_588 189
110 3300053080 Ga0500635_0195250 Ga0500635_0195250_98_667 189
111 3300053096 Ga0500641_0047706 Ga0500641_0047706_878_1447 189
112 3300053730 Ga0500645_000126 Ga0500645_000126_31767_32336 189
113 iso_pu_bacteria 2643221715 2644636401 189
114 3300005436 Ga0070713_100651580 Ga0070713_1006515802 190
115 3300039437 Ga0436365_1636257 Ga0436365_1636257_956_1528 190
116 3300005340 Ga0070689_100158784 Ga0070689_1001587842 191
117 3300005455 Ga0070663_100076745 Ga0070663_1000767455 191
118 3300005530 Ga0070679_100748604 Ga0070679_1007486041 191
119 3300006051 Ga0075364_10453242 Ga0075364_104532421 191
120 3300006051 Ga0075364_10491482 Ga0075364_104914821 191
121 3300006186 Ga0075369_10012279 Ga0075369_100122795 191
122 3300006353 Ga0075370_10052378 Ga0075370_100523783 191
123 3300025303 Ga0209051_1000330 Ga0209051_100033037 191
124 3300025924 Ga0207694_10248013 Ga0207694_102480132 191
125 3300044656 Ga0466969_0037015 Ga0466969_0037015_277_852 191
126 3300044684 Ga0466966_0402496 Ga0466966_0402496_168_743 191
127 3300044693 Ga0466961_0018831 Ga0466961_0018831_1530_2105 191
128 3300044693 Ga0466961_0218234 Ga0466961_0218234_191_766 191
129 3300044719 Ga0466971_0304639 Ga0466971_0304639_103_678 191
130 3300044765 Ga0466970_0068853 Ga0466970_0068853_177_752 191
131 3300045049 Ga0466959_0192356 Ga0466959_0192356_687_1262 191
132 3300050496 nmdc:mga07m45_35839_c1 nmdc:mga07m45_35839_c1_202_777 191
133 3300050516 nmdc:mga0sz30_29415_c1 nmdc:mga0sz30_29415_c1_1663_2238 191
134 3300050516 nmdc:mga0sz30_7796_c1 nmdc:mga0sz30_7796_c1_568_1143 191
135 3300061719 Ga0466962_0245355 Ga0466962_0245355_115_690 191
136 3300003320 rootH2_10003517 rootH2_100035172 192
137 3300005336 Ga0070680_100378585 Ga0070680_1003785852 192
138 3300005345 Ga0070692_10072662 Ga0070692_100726622 192
139 3300005356 Ga0070674_101020337 Ga0070674_1010203371 192
140 3300005366 Ga0070659_100167104 Ga0070659_1001671041 192
141 3300005434 Ga0070709_10174016 Ga0070709_101740161 192
142 3300005435 Ga0070714_100290605 Ga0070714_1002906052 192
143 3300005436 Ga0070713_101074094 Ga0070713_1010740941 192
144 3300005437 Ga0070710_10092821 Ga0070710_100928211 192
145 3300005439 Ga0070711_100058309 Ga0070711_1000583092 192
146 3300005456 Ga0070678_100596762 Ga0070678_1005967621 192
147 3300005459 Ga0068867_100157744 Ga0068867_1001577442 192
148 3300005548 Ga0070665_100635154 Ga0070665_1006351542 192
149 3300005718 Ga0068866_10005788 Ga0068866_100057882 192
150 3300005719 Ga0068861_100243600 Ga0068861_1002436002 192
151 3300005719 Ga0068861_100374119 Ga0068861_1003741192 192
152 3300005843 Ga0068860_100530656 Ga0068860_1005306561 192
153 3300005844 Ga0068862_101123656 Ga0068862_1011236561 192
154 3300006038 Ga0075365_10342884 Ga0075365_103428842 192
155 3300006051 Ga0075364_10020947 Ga0075364_100209473 192
156 3300006173 Ga0070716_100002913 Ga0070716_1000029133 192
157 3300006186 Ga0075369_10000287 Ga0075369_100002875 192
158 3300006186 Ga0075369_10005735 Ga0075369_100057358 192
159 3300006237 Ga0097621_100202545 Ga0097621_1002025453 192
160 3300006358 Ga0068871_100358177 Ga0068871_1003581772 192
161 3300006846 Ga0075430_100177133 Ga0075430_1001771332 192
162 3300007788 Ga0099795_10091166 Ga0099795_100911662 192
163 3300009174 Ga0105241_10298389 Ga0105241_102983892 192
164 3300009176 Ga0105242_10252745 Ga0105242_102527453 192
165 3300009177 Ga0105248_10074116 Ga0105248_100741163 192
166 3300009545 Ga0105237_10168167 Ga0105237_101681672 192
167 3300009553 Ga0105249_10628281 Ga0105249_106282812 192
168 3300013105 Ga0157369_10086027 Ga0157369_100860274 192
169 3300013105 Ga0157369_10121390 Ga0157369_101213902 192
170 3300013297 Ga0157378_10184526 Ga0157378_101845262 192
171 3300013306 Ga0163162_10033762 Ga0163162_100337624 192
172 3300013306 Ga0163162_10360506 Ga0163162_103605061 192
173 3300013308 Ga0157375_10366164 Ga0157375_103661642 192
174 3300014326 Ga0157380_10479891 Ga0157380_104798911 192
175 3300014745 Ga0157377_10269802 Ga0157377_102698021 192
176 3300017792 Ga0163161_10159833 Ga0163161_101598333 192
177 3300017792 Ga0163161_10206376 Ga0163161_102063762 192
178 3300021384 Ga0213876_10032006 Ga0213876_100320063 192
179 3300021384 Ga0213876_10043136 Ga0213876_100431363 192
180 3300025885 Ga0207653_10040795 Ga0207653_100407953 192
181 3300025906 Ga0207699_10157557 Ga0207699_101575573 192
182 3300025923 Ga0207681_10100610 Ga0207681_101006102 192
183 3300025932 Ga0207690_10115458 Ga0207690_101154582 192
184 3300025933 Ga0207706_10006229 Ga0207706_1000622910 192
185 3300025937 Ga0207669_10220987 Ga0207669_102209871 192
186 3300025939 Ga0207665_10162551 Ga0207665_101625513 192
187 3300025940 Ga0207691_10127449 Ga0207691_101274491 192
188 3300025961 Ga0207712_10294182 Ga0207712_102941823 192
189 3300025972 Ga0207668_10134457 Ga0207668_101344572 192
190 3300025972 Ga0207668_10609273 Ga0207668_106092732 192
191 3300026035 Ga0207703_10228003 Ga0207703_102280033 192
192 3300026075 Ga0207708_10003468 Ga0207708_100034685 192
193 3300026089 Ga0207648_10023141 Ga0207648_100231416 192
194 3300026118 Ga0207675_100030992 Ga0207675_1000309924 192
195 3300026118 Ga0207675_100050854 Ga0207675_1000508545 192
196 3300026118 Ga0207675_100084140 Ga0207675_1000841403 192
197 3300027512 Ga0209179_1042581 Ga0209179_10425811 192
198 3300028380 Ga0268265_10217072 Ga0268265_102170723 192
199 3300031731 Ga0307405_10073069 Ga0307405_100730692 192
200 3300031995 Ga0307409_100781072 Ga0307409_1007810721 192
201 3300035115 Ga0373941_0086768 Ga0373941_0086768_111_689 192
202 3300035207 Ga0373942_0144546 Ga0373942_0144546_140_718 192
203 3300035691 Ga0373931_0068890 Ga0373931_0068890_1104_1682 192
204 3300037853 Ga0436364_1326261 Ga0436364_1326261_687_1265 192
205 3300039437 Ga0436365_0642234 Ga0436365_0642234_6445_7023 192
206 3300039437 Ga0436365_1785794 Ga0436365_1785794_6993_7571 192
207 3300039453 Ga0436362_1213396 Ga0436362_1213396_142_720 192
208 3300041410 Ga0439461_0001191 Ga0439461_0001191_3054_3632 192
209 3300041997 Ga0439431_0005097 Ga0439431_0005097_1728_2306 192
210 3300042004 Ga0439445_0008078 Ga0439445_0008078_837_1415 192
211 3300042435 Ga0439434_0122019 Ga0439434_0122019_251_829 192
212 3300048903 Ga0496100_0302015 Ga0496100_0302015_206_784 192
213 3300048905 Ga0496102_0116281 Ga0496102_0116281_1839_2417 192
214 3300048906 Ga0496103_0401060 Ga0496103_0401060_175_753 192
215 3300048909 Ga0496106_0688521 Ga0496106_0688521_49_627 192
216 3300048910 Ga0496107_0706428 Ga0496107_0706428_29_607 192
217 3300048914 Ga0496111_0765441 Ga0496111_0765441_81_659 192
218 3300048915 Ga0496112_0925561 Ga0496112_0925561_98_676 192
219 3300048927 Ga0496124_0197151 Ga0496124_0197151_604_1182 192
220 3300050491 nmdc:mga00v17_4196_c1 nmdc:mga00v17_4196_c1_6486_7064 192
221 3300050509 nmdc:mga0qj67_176921_c1 nmdc:mga0qj67_176921_c1_320_898 192
222 3300050516 nmdc:mga0sz30_21564_c1 nmdc:mga0sz30_21564_c1_401_979 192
223 3300050516 nmdc:mga0sz30_26695_c1 nmdc:mga0sz30_26695_c1_1510_2088 192
224 3300053080 Ga0500635_0003022 Ga0500635_0003022_531_1109 192
225 3300053130 Ga0500642_0085071 Ga0500642_0085071_314_892 192
226 3300053131 Ga0500652_001215 Ga0500652_001215_586_1164 192
227 3300053137 Ga0500561_0044504 Ga0500561_0044504_46_624 192
228 3300053153 Ga0500616_0007062 Ga0500616_0007062_5249_5827 192
229 3300053727 Ga0500611_092507 Ga0500611_092507_128_706 192
230 iso_pu_bacteria 2842134933 2842139748 192
231 iso_pu_bacteria 2929212328 2929213814 192
232 3300005337 Ga0070682_100522214 Ga0070682_1005222141 193
233 3300005344 Ga0070661_100550966 Ga0070661_1005509661 193
234 3300005347 Ga0070668_100307742 Ga0070668_1003077421 193
235 3300005356 Ga0070674_100111796 Ga0070674_1001117963 193
236 3300005459 Ga0068867_100185091 Ga0068867_1001850913 193
237 3300005466 Ga0070685_10237502 Ga0070685_102375022 193
238 3300005535 Ga0070684_100181188 Ga0070684_1001811884 193
239 3300005548 Ga0070665_100105557 Ga0070665_1001055572 193
240 3300005548 Ga0070665_100275256 Ga0070665_1002752562 193
241 3300005564 Ga0070664_100459424 Ga0070664_1004594242 193
242 3300005614 Ga0068856_100569884 Ga0068856_1005698842 193
243 3300005615 Ga0070702_100088602 Ga0070702_1000886023 193
244 3300005616 Ga0068852_101360573 Ga0068852_1013605731 193
245 3300005840 Ga0068870_10146544 Ga0068870_101465442 193
246 3300005842 Ga0068858_100457050 Ga0068858_1004570502 193
247 3300005842 Ga0068858_100530695 Ga0068858_1005306951 193
248 3300005844 Ga0068862_101322843 Ga0068862_1013228431 193
249 3300006881 Ga0068865_100568970 Ga0068865_1005689701 193
250 3300009098 Ga0105245_10436754 Ga0105245_104367542 193
251 3300009101 Ga0105247_10141999 Ga0105247_101419993 193
252 3300009176 Ga0105242_11598201 Ga0105242_115982011 193
253 3300009551 Ga0105238_10554300 Ga0105238_105543002 193
254 3300009553 Ga0105249_10168863 Ga0105249_101688634 193
255 3300009553 Ga0105249_12012464 Ga0105249_120124641 193
256 3300010375 Ga0105239_10051607 Ga0105239_100516076 193
257 3300010375 Ga0105239_10354241 Ga0105239_103542412 193
258 3300013105 Ga0157369_10019567 Ga0157369_100195677 193
259 3300013105 Ga0157369_11092167 Ga0157369_110921671 193
260 3300013296 Ga0157374_10569377 Ga0157374_105693772 193
261 3300013307 Ga0157372_10335800 Ga0157372_103358002 193
262 3300013308 Ga0157375_10284015 Ga0157375_102840151 193
263 3300013308 Ga0157375_10711111 Ga0157375_107111112 193
264 3300014325 Ga0163163_10432051 Ga0163163_104320512 193
265 3300014325 Ga0163163_10593252 Ga0163163_105932522 193
266 3300014968 Ga0157379_10240746 Ga0157379_102407461 193
267 3300025908 Ga0207643_10068187 Ga0207643_100681874 193
268 3300025919 Ga0207657_10420756 Ga0207657_104207562 193
269 3300025920 Ga0207649_10071524 Ga0207649_100715245 193
270 3300025927 Ga0207687_10689449 Ga0207687_106894492 193
271 3300025928 Ga0207700_10451937 Ga0207700_104519372 193
272 3300025941 Ga0207711_10343253 Ga0207711_103432531 193
273 3300025942 Ga0207689_10215068 Ga0207689_102150681 193
274 3300025944 Ga0207661_10196117 Ga0207661_101961172 193
275 3300025961 Ga0207712_10626195 Ga0207712_106261952 193
276 3300025972 Ga0207668_10342210 Ga0207668_103422101 193
277 3300026035 Ga0207703_10321616 Ga0207703_103216162 193
278 3300026078 Ga0207702_10493431 Ga0207702_104934311 193
279 3300026088 Ga0207641_10475403 Ga0207641_104754032 193
280 3300026089 Ga0207648_10108054 Ga0207648_101080545 193
281 3300026095 Ga0207676_10947153 Ga0207676_109471531 193
282 3300026116 Ga0207674_10387309 Ga0207674_103873091 193
283 3300026121 Ga0207683_10130256 Ga0207683_101302563 193
284 3300028379 Ga0268266_10123327 Ga0268266_101233273 193
285 3300044658 Ga0466972_0200988 Ga0466972_0200988_128_709 193
286 3300044683 Ga0466965_0032496 Ga0466965_0032496_237_818 193
287 3300044901 Ga0466960_0000130 Ga0466960_0000130_11586_12167 193
288 3300046506 Ga0495583_0017828 Ga0495583_0017828_701_1282 193
289 3300046524 Ga0495648_0011420 Ga0495648_0011420_2609_3190 193
290 3300046528 Ga0495642_0154433 Ga0495642_0154433_86_667 193
291 3300046530 Ga0495654_0150065 Ga0495654_0150065_278_859 193
292 3300046616 Ga0495668_0045631 Ga0495668_0045631_406_987 193
293 3300046648 Ga0495611_0088700 Ga0495611_0088700_283_864 193
294 3300047320 Ga0495672_0007953 Ga0495672_0007953_3660_4241 193
295 3300047469 Ga0495673_0006964 Ga0495673_0006964_2283_2864 193
296 3300048911 Ga0496108_0202641 Ga0496108_0202641_831_1412 193
297 3300048911 Ga0496108_0541493 Ga0496108_0541493_21_602 193
298 3300048912 Ga0496109_0563947 Ga0496109_0563947_463_1044 193
299 3300048913 Ga0496110_0203357 Ga0496110_0203357_1172_1753 193
300 3300048915 Ga0496112_0153109 Ga0496112_0153109_1514_2143 193
301 3300048917 Ga0496114_1085872 Ga0496114_1085872_20_601 193
302 3300053087 Ga0500643_005411 Ga0500643_005411_2423_3004 193
303 3300005983 Ga0081540_1101460 Ga0081540_11014602 194
304 3300006038 Ga0075365_10010534 Ga0075365_100105346 194
305 3300006048 Ga0075363_100035641 Ga0075363_1000356412 194
306 3300006186 Ga0075369_10009291 Ga0075369_100092915 194
307 3300006353 Ga0075370_10085364 Ga0075370_100853642 194
308 3300039437 Ga0436365_0945559 Ga0436365_0945559_1116_1700 194
309 3300048904 Ga0496101_0993707 Ga0496101_0993707_40_627 194
310 3300048929 Ga0496126_0002817 Ga0496126_0002817_17316_17900 194
311 3300050490 nmdc:mga03n38_27965_c1 nmdc:mga03n38_27965_c1_1371_1955 194
312 3300050491 nmdc:mga00v17_144500_c1 nmdc:mga00v17_144500_c1_660_1244 194
313 3300050492 nmdc:mga0yw44_64603_c1 nmdc:mga0yw44_64603_c1_653_1237 194
314 3300050496 nmdc:mga07m45_66680_c1 nmdc:mga07m45_66680_c1_515_1099 194
315 3300050516 nmdc:mga0sz30_7413_c1 nmdc:mga0sz30_7413_c1_518_1102 194
316 3300005436 Ga0070713_100915910 Ga0070713_1009159101 195
317 3300005458 Ga0070681_10534799 Ga0070681_105347991 195
318 3300005535 Ga0070684_100282107 Ga0070684_1002821072 195
319 3300005545 Ga0070695_100171115 Ga0070695_1001711152 195
320 3300005843 Ga0068860_100160836 Ga0068860_1001608362 195
321 3300006237 Ga0097621_100296991 Ga0097621_1002969912 195
322 3300009101 Ga0105247_10065981 Ga0105247_100659812 195
323 3300009148 Ga0105243_10604338 Ga0105243_106043382 195
324 3300009545 Ga0105237_10095136 Ga0105237_100951366 195
325 3300009551 Ga0105238_10068510 Ga0105238_100685104 195
326 3300010375 Ga0105239_10081259 Ga0105239_100812592 195
327 3300013104 Ga0157370_10042198 Ga0157370_100421985 195
328 3300013296 Ga0157374_10042882 Ga0157374_100428826 195
329 3300013297 Ga0157378_10379632 Ga0157378_103796322 195
330 3300013308 Ga0157375_10032508 Ga0157375_100325087 195
331 3300014969 Ga0157376_10011495 Ga0157376_100114955 195
332 3300025921 Ga0207652_10266954 Ga0207652_102669542 195
333 3300025939 Ga0207665_10252661 Ga0207665_102526612 195
334 3300026035 Ga0207703_10145689 Ga0207703_101456893 195
335 3300048904 Ga0496101_0012239 Ga0496101_0012239_1229_1825 195
336 3300048905 Ga0496102_1203048 Ga0496102_1203048_17_604 195
337 3300048907 Ga0496104_0059786 Ga0496104_0059786_1624_2211 195
338 3300048908 Ga0496105_0014595 Ga0496105_0014595_1982_2569 195
339 3300048911 Ga0496108_0003205 Ga0496108_0003205_742_1329 195
340 3300048912 Ga0496109_0230266 Ga0496109_0230266_1092_1679 195
341 3300048913 Ga0496110_0120786 Ga0496110_0120786_261_848 195
342 3300048914 Ga0496111_0016139 Ga0496111_0016139_385_972 195
343 3300048915 Ga0496112_0943807 Ga0496112_0943807_140_727 195
344 3300048916 Ga0496113_0044796 Ga0496113_0044796_388_984 195
345 3300048925 Ga0496122_0038291 Ga0496122_0038291_150_746 195
346 3300048926 Ga0496123_0035717 Ga0496123_0035717_1436_2032 195
347 3300048929 Ga0496126_0265847 Ga0496126_0265847_798_1394 195
348 3300005439 Ga0070711_100637241 Ga0070711_1006372411 196
349 3300005535 Ga0070684_101264486 Ga0070684_1012644861 196
350 3300005548 Ga0070665_100361899 Ga0070665_1003618991 196
351 3300013105 Ga0157369_10641774 Ga0157369_106417741 196
352 3300025929 Ga0207664_10178634 Ga0207664_101786342 196
353 3300025931 Ga0207644_11099988 Ga0207644_110999881 196
354 3300025941 Ga0207711_10446604 Ga0207711_104466042 196
355 3300046507 Ga0495606_0057456 Ga0495606_0057456_260_865 196
356 3300048903 Ga0496100_0206236 Ga0496100_0206236_145_735 196
357 3300048904 Ga0496101_0048964 Ga0496101_0048964_1668_2258 196
358 3300048907 Ga0496104_0228441 Ga0496104_0228441_1127_1717 196
359 3300048908 Ga0496105_0052146 Ga0496105_0052146_206_796 196
360 3300048910 Ga0496107_0056927 Ga0496107_0056927_1731_2321 196
361 3300048917 Ga0496114_0023818 Ga0496114_0023818_2590_3180 196
362 3300048929 Ga0496126_0093245 Ga0496126_0093245_1352_1942 196
363 iso_pu_bacteria 2902792274 2902798436 196
364 3300005339 Ga0070660_100136064 Ga0070660_1001360643 197
365 3300046694 Ga0495649_0323036 Ga0495649_0323036_171_764 197
366 3300006847 Ga0075431_100052984 Ga0075431_1000529846 198
367 3300009545 Ga0105237_10005283 Ga0105237_1000528313 198
368 3300009551 Ga0105238_10196840 Ga0105238_101968401 198
369 3300010375 Ga0105239_10038236 Ga0105239_100382369 198
370 3300025914 Ga0207671_10018609 Ga0207671_100186091 198
371 3300025924 Ga0207694_10321022 Ga0207694_103210222 198
372 3300025949 Ga0207667_10634016 Ga0207667_106340162 198
373 3300050510 nmdc:mga06r32_440036_c1 nmdc:mga06r32_440036_c1_173_769 198
374 3300005347 Ga0070668_100001409 Ga0070668_1000014099 200
375 3300005367 Ga0070667_100253098 Ga0070667_1002530982 200
376 3300005842 Ga0068858_100835944 Ga0068858_1008359441 200
377 3300005843 Ga0068860_100165861 Ga0068860_1001658613 200
378 3300025972 Ga0207668_10000534 Ga0207668_1000053412 200
379 3300025986 Ga0207658_10299858 Ga0207658_102998582 200
380 3300028381 Ga0268264_10178709 Ga0268264_101787092 200
381 3300048904 Ga0496101_0000024 Ga0496101_0000024_4237_4839 200
382 3300048905 Ga0496102_0000001 Ga0496102_0000001_868096_868698 200
383 3300048906 Ga0496103_0000003 Ga0496103_0000003_599158_599760 200
384 3300048910 Ga0496107_0045832 Ga0496107_0045832_1912_2514 200
385 3300048919 Ga0496116_0000013 Ga0496116_0000013_4234_4836 200
386 3300048920 Ga0496117_0000013 Ga0496117_0000013_599158_599760 200
387 3300048921 Ga0496118_0000011 Ga0496118_0000011_4236_4838 200
388 3300048922 Ga0496119_0038532 Ga0496119_0038532_1912_2514 200
389 3300048923 Ga0496120_0033500 Ga0496120_0033500_573_1175 200
390 3300048929 Ga0496126_0004888 Ga0496126_0004888_4237_4839 200
391 3300039437 Ga0436365_0167673 Ga0436365_0167673_306_911 201
392 3300005577 Ga0068857_100495043 Ga0068857_1004950431 202
393 3300005614 Ga0068856_100314480 Ga0068856_1003144804 202
394 3300026078 Ga0207702_10055439 Ga0207702_100554396 202
395 3300035086 Ga0373934_0105496 Ga0373934_0105496_511_1119 202
396 3300035724 Ga0373933_0006438 Ga0373933_0006438_5188_5796 202
397 3300046462 Ga0495651_0012073 Ga0495651_0012073_3168_3776 202
398 3300046463 Ga0495653_0027680 Ga0495653_0027680_2016_2624 202
399 3300046477 Ga0495664_0008454 Ga0495664_0008454_4499_5107 202
400 3300046516 Ga0495628_0175897 Ga0495628_0175897_600_1208 202
401 3300046529 Ga0495652_0425693 Ga0495652_0425693_292_900 202
402 3300046543 Ga0495645_0207650 Ga0495645_0207650_341_949 202
403 3300046663 Ga0495635_0071391 Ga0495635_0071391_538_1146 202
404 3300046675 Ga0495657_0085405 Ga0495657_0085405_31_639 202
405 3300046809 Ga0495600_0042257 Ga0495600_0042257_1968_2576 202
406 3300047317 Ga0495604_0319503 Ga0495604_0319503_242_850 202
407 3300047319 Ga0495674_0064776 Ga0495674_0064776_1461_2069 202
408 3300047322 Ga0495680_0063435 Ga0495680_0063435_525_1133 202
409 3300047444 Ga0495675_0191547 Ga0495675_0191547_498_1106 202
410 3300048088 Ga0495602_0037306 Ga0495602_0037306_716_1324 202
411 3300005435 Ga0070714_100538804 Ga0070714_1005388042 203
412 3300025906 Ga0207699_10058700 Ga0207699_100587003 203
413 3300025929 Ga0207664_11127290 Ga0207664_111272901 203
414 3300039453 Ga0436362_0359449 Ga0436362_0359449_13_624 203
415 3300014326 Ga0157380_11543659 Ga0157380_115436591 204
416 3300050507 nmdc:mga05p37_393054_c1 nmdc:mga05p37_393054_c1_431_1045 204
417 3300053139 Ga0500568_0022923 Ga0500568_0022923_57_671 204
418 3300037853 Ga0436364_1308388 Ga0436364_1308388_31532_32158 208
419 3300001990 JGI24737J22298_10114016 JGI24737J22298_101140161 209
420 3300001991 JGI24743J22301_10053779 JGI24743J22301_100537791 209
421 3300002077 JGI24744J21845_10007134 JGI24744J21845_100071342 209
422 3300005334 Ga0068869_100045084 Ga0068869_1000450845 209
423 3300005337 Ga0070682_100059755 Ga0070682_1000597553 209
424 3300005364 Ga0070673_100402363 Ga0070673_1004023631 209
425 3300005441 Ga0070700_100498119 Ga0070700_1004981191 209
426 3300005466 Ga0070685_10029806 Ga0070685_100298065 209
427 3300005548 Ga0070665_100324631 Ga0070665_1003246313 209
428 3300005563 Ga0068855_100980455 Ga0068855_1009804551 209
429 3300005842 Ga0068858_100040899 Ga0068858_1000408995 209
430 3300009093 Ga0105240_10445960 Ga0105240_104459602 209
431 3300009545 Ga0105237_10345738 Ga0105237_103457382 209
432 3300011119 Ga0105246_10714955 Ga0105246_107149552 209
433 3300013296 Ga0157374_10005075 Ga0157374_100050759 209
434 3300014325 Ga0163163_10118465 Ga0163163_101184655 209
435 3300014969 Ga0157376_10240675 Ga0157376_102406752 209
436 3300025904 Ga0207647_10025620 Ga0207647_100256205 209
437 3300025905 Ga0207685_10015770 Ga0207685_100157705 209
438 3300025914 Ga0207671_10324949 Ga0207671_103249492 209
439 3300025936 Ga0207670_10340517 Ga0207670_103405172 209
440 3300025942 Ga0207689_10065205 Ga0207689_100652052 209
441 3300025960 Ga0207651_10465240 Ga0207651_104652402 209
442 3300026023 Ga0207677_10009521 Ga0207677_100095216 209
443 3300026035 Ga0207703_10066524 Ga0207703_100665245 209
444 3300026088 Ga0207641_10233961 Ga0207641_102339611 209
445 3300048907 Ga0496104_0037926 Ga0496104_0037926_2076_2705 209
446 3300048909 Ga0496106_0089013 Ga0496106_0089013_1558_2187 209
447 3300048911 Ga0496108_0021052 Ga0496108_0021052_2207_2836 209
448 3300048912 Ga0496109_0040971 Ga0496109_0040971_3239_3868 209
449 3300048913 Ga0496110_0087115 Ga0496110_0087115_133_762 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

23

69

0.93

PF13305

TetR_C_33

Tetracyclin repressor-like, C-terminal domain

95

195

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zk8-assembly1.cif.gz_B crystal structure of transcriptional regulator from bacillus cereus atcc 14579 0.8652 15 192
1zk8-assembly1.cif.gz_B crystal structure of transcriptional regulator from bacillus cereus atcc 14579 0.8429 15 192
3on2-assembly3.cif.gz_C structure of a protein with unknown function from rhodococcus sp. rha1 0.8297 15 191
3cjd-assembly1.cif.gz_A crystal structure of putative tetr transcriptional regulator (yp_510936.1) from jannaschia sp. ccs1 at 1.79 a resolution 0.8288 12 189
3on2-assembly1.cif.gz_A structure of a protein with unknown function from rhodococcus sp. rha1 0.8234 15 191
ID Description Score Start End Superfamily
2y30A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9483 15 60 1.10.10.60
2y31B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.946 15 60 1.10.10.60
2y31A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9392 15 60 1.10.10.60
2eh3A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9341 15 60 1.10.10.60
3zqlD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9254 15 60 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A1C6T8M0-F1-model_v4 deleted 0.98 1 189
AF-A0A209C064-F1-model_v4 TetR family transcriptional regulator 0.9794 1 188 GO:0000976
GO:0003700
AF-A0A4R3EHN3-F1-model_v4 deleted 0.979 1 189
AF-A0A2S8MPY0-F1-model_v4 deleted 0.9783 21 143
AF-A0A552ZNZ7-F1-model_v4 TetR/AcrR family transcriptional regulator 0.978 1 189 GO:0000976
GO:0003700

Feature Viewer

pLDDT pTM Quality
90.08 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map