F446286

General Info

Members Datasets Scaffolds Average Seq Length
448 292 896 462

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8025530807|8025537905
Length 505
Sequence LTRAVRRAQRHASVSRGPKGPGALSPEHYACRVTIRLYDTGARQIRDFSPLVAGCVSIYLCGATVQAAPHIGHIRSGLNFDILRRWFAYRGYDVTFVRNVTDIDDKIIAKSAVQDRPWWAIGYENERAFNSGYDVLGCLPPTYEPRATGHVPEMIEMMRGLIERGHAYASEGNVYFDVRSFPEYLQLSNQDIDDLRQPSGEGETGKRDQRDFAMWKATKPGEPDWETPWGRGRPGWHLECSAMAHKYLGSAFDIHGGGLDLIFPHHENEIAQAKAYGDDFAEYWVHNAWVTMSGEKMSKSLGNSVLVSEMVKQWRPIVLRYYLGTPHYRSMIEYSEEALREAESAFGRIEGFVQRVIEMAGHVVEPADEVPPAFAEAMDDDLGVPGALAIIHTTVRQGNSALAADDKEAAVARLAEVRAMLGVLGLDPLDAHWTGTGAGDGGPDGEGNRLNGVVDTLVRLVLDQREAARGRKDWATADAIRDQLQQSGLVIEDGPAGPRWTLGPR

Samples

Sample ID Description Type Environment
1 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
2 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
3 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
5 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
6 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
7 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
8 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
9 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
10 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
11 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
12 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
13 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
14 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
15 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
16 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
17 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
18 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
19 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
20 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
21 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
22 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
29 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
31 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
32 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
33 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
34 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
35 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
36 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
37 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
38 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
39 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
40 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
41 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
42 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
43 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
44 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
45 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
46 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
47 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
48 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
49 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
50 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
51 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
52 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
53 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
54 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
55 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
56 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
57 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
58 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
59 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
60 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
61 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
62 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
63 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
64 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
65 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
66 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
67 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
68 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
69 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
70 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
71 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
72 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
73 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
74 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
75 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
76 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
77 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
78 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
79 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
80 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
81 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
82 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
83 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
84 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
85 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
86 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
87 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
88 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
89 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
90 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
91 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
92 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
93 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
94 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
95 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
96 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
97 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
100 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
101 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
102 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
103 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
104 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
105 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
106 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
109 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
110 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
111 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
112 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
113 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
117 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
118 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
119 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
122 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
125 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
126 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
127 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
128 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
129 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
130 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
131 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
132 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
133 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
154 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
169 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
170 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
171 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
172 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
173 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
174 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
175 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
176 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
177 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
178 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
179 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
180 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
181 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
182 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
185 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
187 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
188 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
189 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
190 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
191 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
192 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
193 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
194 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
195 2643221548 Streptomyces sp. Root55 Isolate Unclassified
196 2643221549 Agromyces sp. Root1464 Isolate Unclassified
197 2643221578 Streptomyces sp. Root63 Isolate Unclassified
198 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
199 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
200 2643221619 Agromyces sp. Root81 Isolate Unclassified
201 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
202 2643221647 Streptomyces sp. Root369 Isolate Unclassified
203 2643221670 Streptomyces sp. Root431 Isolate Unclassified
204 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
205 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
206 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
207 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
208 2643221714 Streptomyces sp. Root264 Isolate Unclassified
209 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
210 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
211 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
212 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
213 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
214 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
215 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
216 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
217 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
218 2808606448 Streptomyces sp. 193411 Isolate Unclassified
219 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
220 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
221 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
222 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
223 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
224 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
225 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
226 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
227 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
228 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
229 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
230 2862574272 Streptomyces sp. AcE210 Isolate Nodule
231 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
232 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
233 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
234 2867369537 Streptomyces sp. Z26 Isolate Unclassified
235 2867428634 Streptomyces sp. RP5T Isolate Unclassified
236 2867475112 Streptomyces sp. TM32 Isolate Unclassified
237 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
238 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
239 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
240 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
241 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
242 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
243 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
244 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
245 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
246 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
247 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
248 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
249 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
250 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
251 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
252 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
253 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
254 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
255 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
256 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
257 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
258 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
259 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
260 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
261 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
262 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
263 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
264 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
265 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
266 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
267 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
268 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
269 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
270 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
271 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
272 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
273 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
274 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
275 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
276 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
277 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
278 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
279 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
280 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
281 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
282 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
283 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
284 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
285 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
286 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
287 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
288 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
289 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
290 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
291 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
292 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.12
Metatranscriptomes 0.22
Isolates 23.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.46
Nodule 0.89
Rhizoplane 0.67
Rhizosphere 77.46
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25160J50197_1007531 3300003354 Bacteria 4248
2 Ga0070713_100088886 3300005436 Bacteria 2653
3 Ga0081455_10020190 3300005937 Bacteria 6283
4 Ga0075368_10009266 3300006042 Bacteria 3538
5 Ga0075363_100015023 3300006048 Bacteria 3797
6 Ga0075367_10012394 3300006178 Bacteria 4544
7 Ga0075428_100104667 3300006844 Bacteria 3086
8 Ga0075428_100115367 3300006844 Bacteria 2926
9 Ga0075429_100101749 3300006880 Bacteria 2509
10 Ga0099826_10006479 3300006948 Bacteria 8535
11 Ga0105251_10017187 3300009011 Bacteria 3884
12 Ga0114129_10278847 3300009147 Bacteria 2234
13 Ga0105248_10037346 3300009177 Bacteria 5434
14 Ga0105238_10065469 3300009551 Bacteria 3635
15 Ga0105246_10005388 3300011119 Bacteria 7788
16 Ga0105246_10060870 3300011119 Bacteria 2625
17 Ga0157372_10046742 3300013307 Bacteria 4806
18 Ga0182008_10001457 3300014497 Bacteria 15816
19 Ga0182007_10003883 3300015262 Bacteria 6932
20 Ga0183367_1005 3300015688 Bacteria 652063
21 Ga0206353_11447188 3300020082 Bacteria 3516
22 Ga0213875_10004163 3300021388 Bacteria 8009
23 Ga0213875_10014989 3300021388 Bacteria 3775
24 Ga0207426_1006879 3300025302 Bacteria 4850
25 Ga0207426_1008804 3300025302 Bacteria 4041
26 Ga0207696_1012389 3300025711 Bacteria 3016
27 Ga0207688_10032791 3300025901 Bacteria 2871
28 Ga0207687_10063986 3300025927 Bacteria 2606
29 Ga0207664_10034214 3300025929 Bacteria 3912
30 Ga0207711_10057102 3300025941 Bacteria 3355
31 Ga0207678_10206074 3300026067 Bacteria 1682
32 Ga0207678_10207380 3300026067 Bacteria 1676
33 Ga0209813_10017230 3300027866 Bacteria 1981
34 Ga0268266_10148267 3300028379 Bacteria 2112
35 Ga0268266_10169329 3300028379 Bacteria 1982
36 Ga0307517_10010734 3300028786 Bacteria 12774
37 Ga0307517_10031996 3300028786 Bacteria 6100
38 Ga0307515_10003702 3300028794 Bacteria 32085
39 Ga0307515_10103839 3300028794 Bacteria 3403
40 Ga0307511_10001286 3300030521 Bacteria 26612
41 Ga0307511_10092206 3300030521 Bacteria 2045
42 Ga0307512_10001726 3300030522 Bacteria 29809
43 Ga0307512_10006664 3300030522 Bacteria 11634
44 Ga0307513_10007043 3300031456 Bacteria 14627
45 Ga0307509_10021010 3300031507 Bacteria 7395
46 Ga0307508_10009614 3300031616 Bacteria 8885
47 Ga0307514_10056510 3300031649 Bacteria 3012
48 Ga0307514_10057177 3300031649 Bacteria 2990
49 Ga0307514_10141814 3300031649 Bacteria 1632
50 Ga0307516_10018156 3300031730 Bacteria 7315
51 Ga0307516_10021397 3300031730 Bacteria 6655
52 Ga0307516_10176758 3300031730 Bacteria 1871
53 Ga0307410_10059619 3300031852 Bacteria 2606
54 Ga0307416_100016533 3300032002 Bacteria 5132
55 Ga0307507_10000009 3300033179 Bacteria 265992
56 Ga0307507_10033642 3300033179 Bacteria 5317
57 Ga0307507_10116823 3300033179 Bacteria 2153
58 Ga0307510_10079574 3300033180 Bacteria 3195
59 Ga0307510_10100934 3300033180 Bacteria 2677
60 Ga0395900_0311111 3300037418 Bacteria 1558
61 Ga0395898_0005710 3300037466 Bacteria 13410
62 Ga0395898_0052545 3300037466 Bacteria 3981
63 Ga0436364_0138124 3300037853 Bacteria 7843
64 Ga0436364_1059010 3300037853 Bacteria 60327
65 Ga0395901_0066415 3300038443 Bacteria 3757
66 Ga0439436_0000221 3300041404 Bacteria 13685
67 Ga0439436_0000369 3300041404 Bacteria 11193
68 Ga0439439_0035561 3300041406 Bacteria 1280
69 Ga0451837_0262800 3300041494 Bacteria 6414
70 Ga0451853_0598105 3300041512 Bacteria 3812
71 Ga0439448_0003157 3300042005 Bacteria 4543
72 Ga0439449_0001351 3300042007 Bacteria 9619
73 Ga0439455_0007185 3300042012 Bacteria 2347
74 Ga0439457_001048 3300042014 Bacteria 8357
75 Ga0450894_000165 3300042131 Bacteria 11729
76 Ga0450896_002141 3300042133 Bacteria 2521
77 Ga0450898_002004 3300042134 Bacteria 2789
78 Ga0450899_000799 3300042135 Bacteria 3589
79 Ga0450902_006277 3300042137 Bacteria 1819
80 Ga0450903_001146 3300042138 Bacteria 5020
81 Ga0450906_006462 3300042145 Bacteria 2367
82 Ga0439458_0003573 3300042157 Bacteria 3625
83 Ga0466969_0000315 3300044656 Bacteria 26654
84 Ga0466969_0003650 3300044656 Bacteria 8192
85 Ga0466969_0008200 3300044656 Bacteria 5543
86 Ga0466969_0008922 3300044656 Bacteria 5318
87 Ga0466969_0022178 3300044656 Bacteria 3280
88 Ga0466969_0028727 3300044656 Bacteria 2842
89 Ga0466972_0012631 3300044658 Bacteria 4243
90 Ga0466972_0024695 3300044658 Bacteria 2982
91 Ga0466965_0001233 3300044683 Bacteria 10123
92 Ga0466966_0002684 3300044684 Bacteria 11653
93 Ga0466966_0007376 3300044684 Bacteria 7296
94 Ga0466966_0010102 3300044684 Bacteria 6261
95 Ga0466966_0020464 3300044684 Bacteria 4350
96 Ga0466966_0048350 3300044684 Bacteria 2709
97 Ga0466961_0000772 3300044693 Bacteria 20081
98 Ga0466961_0028783 3300044693 Bacteria 3573
99 Ga0466961_0053854 3300044693 Bacteria 2567
100 Ga0466961_0057597 3300044693 Bacteria 2473
101 Ga0466961_0087124 3300044693 Bacteria 1973
102 Ga0466963_0001543 3300044694 Bacteria 12482
103 Ga0466963_0001954 3300044694 Bacteria 11303
104 Ga0466963_0098453 3300044694 Bacteria 1999
105 Ga0466964_0001683 3300044706 Bacteria 7639
106 Ga0466971_0017161 3300044719 Bacteria 3200
107 Ga0466971_0023931 3300044719 Bacteria 2723
108 Ga0466971_0029240 3300044719 Bacteria 2464
109 Ga0466968_0064633 3300044735 Bacteria 1583
110 Ga0466970_0000179 3300044765 Bacteria 30305
111 Ga0466970_0003079 3300044765 Bacteria 8094
112 Ga0466957_0001101 3300044842 Bacteria 13974
113 Ga0466959_0000363 3300045049 Bacteria 26871
114 Ga0466959_0000799 3300045049 Bacteria 18547
115 Ga0466958_0000745 3300045836 Bacteria 14269
116 Ga0466958_0046011 3300045836 Bacteria 2633
117 Ga0466967_0003603 3300045976 Bacteria 10166
118 Ga0466967_0003605 3300045976 Bacteria 10164
119 Ga0466967_0035661 3300045976 Bacteria 4237
120 Ga0466967_0306408 3300045976 Bacteria 1529
121 Ga0495603_0001554 3300046455 Bacteria 13423
122 Ga0495603_0001594 3300046455 Bacteria 13301
123 Ga0495603_0008073 3300046455 Bacteria 6360
124 Ga0495603_0023633 3300046455 Bacteria 3718
125 Ga0495603_0023634 3300046455 Bacteria 3717
126 Ga0495603_0031932 3300046455 Bacteria 3169
127 Ga0495629_0004390 3300046459 Bacteria 10566
128 Ga0495629_0006864 3300046459 Bacteria 8404
129 Ga0495629_0029808 3300046459 Bacteria 3868
130 Ga0495629_0036825 3300046459 Bacteria 3451
131 Ga0495629_0036937 3300046459 Bacteria 3445
132 Ga0495638_0065302 3300046460 Bacteria 2240
133 Ga0495638_0072895 3300046460 Bacteria 2097
134 Ga0495638_0077755 3300046460 Bacteria 2020
135 Ga0495651_0001322 3300046462 Bacteria 19203
136 Ga0495651_0012383 3300046462 Bacteria 6576
137 Ga0495653_0071838 3300046463 Bacteria 2586
138 Ga0495580_0006356 3300046472 Bacteria 9639
139 Ga0495605_0004397 3300046474 Bacteria 8293
140 Ga0495662_0000163 3300046476 Bacteria 26131
141 Ga0495662_0018676 3300046476 Bacteria 3356
142 Ga0495664_0000580 3300046477 Bacteria 18416
143 Ga0495664_0016992 3300046477 Bacteria 4155
144 Ga0495664_0019021 3300046477 Bacteria 3945
145 Ga0495585_0003798 3300046492 Bacteria 10058
146 Ga0495594_0013556 3300046499 Bacteria 4256
147 Ga0495594_0045956 3300046499 Bacteria 2397
148 Ga0495594_0078069 3300046499 Bacteria 1847
149 Ga0495607_0026567 3300046501 Bacteria 3591
150 Ga0495608_0035505 3300046511 Bacteria 3362
151 Ga0495616_0008463 3300046513 Bacteria 6094
152 Ga0495618_0009067 3300046514 Bacteria 6005
153 Ga0495618_0014656 3300046514 Bacteria 4780
154 Ga0495628_0009159 3300046516 Bacteria 8462
155 Ga0495628_0020902 3300046516 Bacteria 5391
156 Ga0495628_0021496 3300046516 Bacteria 5306
157 Ga0495628_0066511 3300046516 Bacteria 2817
158 Ga0495630_0004652 3300046517 Bacteria 9629
159 Ga0495631_0002930 3300046518 Bacteria 9449
160 Ga0495643_0021288 3300046522 Bacteria 3722
161 Ga0495643_0028373 3300046522 Bacteria 3138
162 Ga0495648_0025546 3300046524 Bacteria 3996
163 Ga0495648_0090660 3300046524 Bacteria 1712
164 Ga0495666_0066997 3300046526 Bacteria 1711
165 Ga0495652_0036680 3300046529 Bacteria 4259
166 Ga0495652_0050227 3300046529 Bacteria 3566
167 Ga0495652_0076257 3300046529 Bacteria 2781
168 Ga0495640_0005364 3300046533 Bacteria 10196
169 Ga0495640_0014000 3300046533 Bacteria 6086
170 Ga0495586_0015709 3300046535 Bacteria 4028
171 Ga0495587_0002579 3300046536 Bacteria 12116
172 Ga0495587_0095266 3300046536 Bacteria 1718
173 Ga0495645_0015218 3300046543 Bacteria 5471
174 Ga0495645_0043360 3300046543 Bacteria 3281
175 Ga0495645_0049416 3300046543 Bacteria 3063
176 Ga0495645_0097436 3300046543 Bacteria 2094
177 Ga0495622_0002963 3300046557 Bacteria 8080
178 Ga0495668_0065551 3300046616 Bacteria 1999
179 Ga0495634_0009698 3300046642 Bacteria 7086
180 Ga0495634_0033394 3300046642 Bacteria 3536
181 Ga0495611_0023705 3300046648 Bacteria 2665
182 Ga0495611_0046260 3300046648 Bacteria 1951
183 Ga0495625_0001776 3300046660 Bacteria 24861
184 Ga0495625_0076759 3300046660 Bacteria 2335
185 Ga0495635_0130433 3300046663 Bacteria 1713
186 Ga0495661_0015484 3300046665 Bacteria 5090
187 Ga0495588_0100385 3300046674 Bacteria 1520
188 Ga0495657_0002543 3300046675 Bacteria 15305
189 Ga0495657_0028623 3300046675 Bacteria 3916
190 Ga0495623_0002795 3300046679 Bacteria 11517
191 Ga0495623_0028482 3300046679 Bacteria 3593
192 Ga0495623_0086650 3300046679 Bacteria 1930
193 Ga0495646_0002025 3300046680 Bacteria 12277
194 Ga0495646_0002859 3300046680 Bacteria 10688
195 Ga0495646_0015161 3300046680 Bacteria 4895
196 Ga0495658_0026513 3300046683 Bacteria 3107
197 Ga0495613_0006519 3300046689 Bacteria 8723
198 Ga0495613_0019805 3300046689 Bacteria 5013
199 Ga0495613_0037131 3300046689 Bacteria 3612
200 Ga0495624_0026459 3300046690 Bacteria 3802
201 Ga0495624_0159132 3300046690 Bacteria 1380
202 Ga0495671_0006228 3300046692 Bacteria 6916
203 Ga0495649_0019433 3300046694 Bacteria 3817
204 Ga0495589_0004731 3300046794 Bacteria 7225
205 Ga0495600_0001446 3300046809 Bacteria 13159
206 Ga0495600_0006790 3300046809 Bacteria 6978
207 Ga0495600_0015394 3300046809 Bacteria 4834
208 Ga0495600_0031304 3300046809 Bacteria 3446
209 Ga0495660_0022104 3300046810 Bacteria 3635
210 Ga0495581_0033377 3300047315 Bacteria 2980
211 Ga0495604_0000878 3300047317 Bacteria 25046
212 Ga0495604_0001885 3300047317 Bacteria 17044
213 Ga0495604_0012665 3300047317 Bacteria 6710
214 Ga0495604_0013742 3300047317 Bacteria 6455
215 Ga0495604_0066265 3300047317 Bacteria 2747
216 Ga0495604_0069433 3300047317 Bacteria 2670
217 Ga0495636_0013319 3300047318 Bacteria 3263
218 Ga0495636_0013433 3300047318 Bacteria 3250
219 Ga0495636_0019767 3300047318 Bacteria 2709
220 Ga0495676_0000150 3300047321 Bacteria 53407
221 Ga0495676_0001728 3300047321 Bacteria 19083
222 Ga0495676_0005833 3300047321 Bacteria 11302
223 Ga0495676_0006750 3300047321 Bacteria 10555
224 Ga0495680_0054048 3300047322 Bacteria 3120
225 Ga0495680_0165932 3300047322 Bacteria 1601
226 Ga0495687_003240 3300047443 Bacteria 12019
227 Ga0495687_032479 3300047443 Bacteria 2381
228 Ga0495687_040060 3300047443 Bacteria 2067
229 Ga0495675_0002410 3300047444 Bacteria 11174
230 Ga0495675_0010899 3300047444 Bacteria 5697
231 Ga0495675_0014992 3300047444 Bacteria 4899
232 Ga0495685_001035 3300047447 Bacteria 8466
233 Ga0495685_010246 3300047447 Bacteria 3141
234 Ga0495681_0001177 3300047470 Bacteria 19878
235 Ga0495684_0162320 3300047471 Bacteria 1666
236 Ga0495686_0094066 3300047472 Bacteria 1817
237 Ga0495593_0001376 3300047673 Bacteria 14229
238 Ga0495593_0051613 3300047673 Bacteria 2175
239 Ga0495593_0076170 3300047673 Bacteria 1739
240 Ga0495602_0068402 3300048088 Bacteria 3049
241 Ga0495602_0073364 3300048088 Bacteria 2913
242 Ga0495614_0009355 3300048089 Bacteria 4333
243 Ga0495614_0023166 3300048089 Bacteria 2678
244 Ga0496102_0135570 3300048905 Bacteria 2307
245 Ga0496106_0061932 3300048909 Bacteria 2840
246 Ga0501031_0003647 3300049568 Bacteria 9910
247 Ga0501031_0018938 3300049568 Bacteria 4482
248 Ga0501031_0121892 3300049568 Bacteria 1703
249 Ga0501032_0007684 3300049569 Bacteria 7858
250 Ga0501032_0007954 3300049569 Bacteria 7725
251 Ga0501032_0046331 3300049569 Bacteria 2939
252 Ga0501033_0014569 3300049570 Bacteria 5969
253 Ga0501033_0018660 3300049570 Bacteria 5242
254 Ga0501033_0026344 3300049570 Bacteria 4376
255 Ga0501033_0039779 3300049570 Bacteria 3511
256 Ga0501034_0012764 3300049571 Bacteria 8664
257 Ga0501034_0016284 3300049571 Bacteria 7632
258 Ga0501034_0035254 3300049571 Bacteria 5073
259 Ga0501034_0053692 3300049571 Bacteria 4057
260 Ga0501036_0007966 3300049572 Bacteria 8671
261 Ga0501036_0031599 3300049572 Bacteria 4474
262 Ga0501036_0094515 3300049572 Bacteria 2526
263 Ga0501037_0003961 3300049573 Bacteria 10742
264 Ga0501037_0008259 3300049573 Bacteria 7632
265 Ga0501038_0012221 3300049574 Bacteria 7839
266 Ga0501038_0066017 3300049574 Bacteria 3082
267 Ga0501038_0109208 3300049574 Bacteria 2292
268 Ga0501039_0012712 3300049575 Bacteria 6432
269 Ga0501039_0081179 3300049575 Bacteria 2524
270 Ga0501039_0159962 3300049575 Bacteria 1770
271 Ga0501040_0004621 3300049576 Bacteria 8930
272 Ga0501040_0028946 3300049576 Bacteria 3736
273 Ga0501041_0034922 3300049577 Bacteria 3045
274 Ga0501042_0004260 3300049578 Bacteria 9107
275 Ga0501042_0051942 3300049578 Bacteria 2924
276 Ga0501042_0054775 3300049578 Bacteria 2845
277 Ga0501043_0005709 3300049579 Bacteria 10024
278 Ga0501046_0019114 3300049580 Bacteria 5683
279 Ga0501046_0020154 3300049580 Bacteria 5519
280 Ga0501047_0000033 3300049581 Bacteria 206961
281 Ga0501047_0001481 3300049581 Bacteria 22897
282 Ga0501047_0006618 3300049581 Bacteria 10901
283 Ga0501047_0140815 3300049581 Bacteria 2290
284 Ga0501047_0171604 3300049581 Bacteria 2037
285 Ga0501048_0016037 3300049582 Bacteria 5524
286 Ga0501048_0058163 3300049582 Bacteria 2740
287 Ga0501067_0005755 3300049583 Bacteria 6878
288 Ga0501068_0002878 3300049584 Bacteria 9163
289 Ga0501070_0006175 3300049586 Bacteria 10207
290 Ga0501071_0000622 3300049587 Bacteria 18372
291 Ga0501071_0041755 3300049587 Bacteria 3285
292 Ga0501071_0104618 3300049587 Bacteria 2089
293 Ga0501072_0011566 3300049588 Bacteria 6743
294 Ga0501072_0062028 3300049588 Bacteria 2949
295 Ga0501073_0044039 3300049589 Bacteria 3145
296 Ga0501074_0003420 3300049590 Bacteria 11243
297 Ga0501075_0032765 3300049591 Bacteria 3863
298 Ga0501076_0017776 3300049592 Bacteria 5406
299 Ga0501079_0007822 3300049741 Bacteria 8094
300 Ga0501079_0018797 3300049741 Bacteria 5281
301 Ga0501079_0020330 3300049741 Bacteria 5073
302 Ga0501080_0083601 3300049742 Bacteria 2965
303 Ga0501083_0001270 3300049744 Bacteria 17091
304 Ga0501035_0011367 3300049822 Bacteria 8251
305 Ga0501035_0013135 3300049822 Bacteria 7643
306 Ga0501035_0023442 3300049822 Bacteria 5661
307 Ga0501035_0028772 3300049822 Bacteria 5070
308 Ga0501035_0041237 3300049822 Bacteria 4168
309 Ga0501035_0054529 3300049822 Bacteria 3572
310 Ga0501044_0003451 3300049823 Bacteria 17804
311 Ga0501044_0015983 3300049823 Bacteria 8075
312 Ga0501044_0033712 3300049823 Bacteria 5377
313 Ga0501044_0043884 3300049823 Bacteria 4643
314 Ga0501044_0139520 3300049823 Bacteria 2413
315 Ga0501044_0233347 3300049823 Bacteria 1786
316 Ga0501045_0053907 3300049824 Bacteria 2939
317 Ga0501045_0057322 3300049824 Bacteria 2850
318 nmdc:mga06z11_7284_c1 3300050494 Bacteria 4543
319 nmdc:mga04h51_20346_c1 3300050495 Bacteria 1980
320 nmdc:mga07m45_59464_c1 3300050496 Bacteria 2162
321 Ga0495601_0006464 3300053077 Bacteria 6854
322 Ga0495601_0017269 3300053077 Bacteria 4378
323 Ga0495612_0009614 3300053078 Bacteria 3915
324 Ga0500640_048598 3300053095 Bacteria 1859
325 Ga0500654_037433 3300053099 Bacteria 2811
326 Ga0500560_012930 3300053107 Bacteria 2179
327 Ga0500569_003691 3300053109 Bacteria 3156
328 Ga0500614_005842 3300053123 Bacteria 2583
329 Ga0500628_003693 3300053129 Bacteria 2526
330 Ga0500652_021406 3300053131 Bacteria 2435
331 Ga0500561_0001699 3300053137 Bacteria 3614
332 Ga0500634_0033653 3300053161 Bacteria 2793
333 Ga0500656_000570 3300053732 Bacteria 2810
334 Ga0501084_0038167 3300054114 Bacteria 4015
335 Ga0501082_0011694 3300060353 Bacteria 7546
336 Ga0466962_0000458 3300061719 Bacteria 17725
337 Ga0466962_0001155 3300061719 Bacteria 12183
338 Ga0466962_0001291 3300061719 Bacteria 11564
339 Ga0466962_0015014 3300061719 Bacteria 3734
340 Ga0466962_0025225 3300061719 Bacteria 2854
341 Ga0466962_0052026 3300061719 Bacteria 1958
342 Ga0530510_0151199 3300061734 Bacteria 1714
343 8025537905 8025530807 Bacteria 8495698
344 2547408242 2547132111 Bacteria 8013147
345 2554257206 2554235005 Bacteria 6457341
346 2585299264 2582581312 Bacteria 7308206
347 2585308916 2582581313 Bacteria 10042643
348 2585313608 2582581314 Bacteria 11452267
349 2616694941 2616644814 Bacteria 11555299
350 2616904587 2616644941 Bacteria 8510691
351 2643765062 2643221548 Bacteria 8053412
352 2643768456 2643221549 Bacteria 4042819
353 2643899150 2643221578 Bacteria 9213798
354 2643942405 2643221587 Bacteria 7586415
355 2644014767 2643221601 Bacteria 7493239
356 2644111834 2643221619 Bacteria 4158469
357 2644176202 2643221631 Bacteria 8168043
358 2644262419 2643221647 Bacteria 10741251
359 2644390029 2643221670 Bacteria 6497041
360 2644403333 2643221673 Bacteria 9196637
361 2644429486 2643221677 Bacteria 7584031
362 2644437255 2643221678 Bacteria 9540101
363 2644461099 2643221682 Bacteria 6743283
364 2644628993 2643221714 Bacteria 9015452
365 2723641317 2721755702 Bacteria 4373124
366 2784588708 2784132148 Bacteria 8627943
367 2785343166 2784746763 Bacteria 9783172
368 2785369637 2784746768 Bacteria 10036182
369 2786670723 2786546132 Bacteria 10419719
370 2793978329 2791355406 Bacteria 11364898
371 2804846773 2802429296 Bacteria 7227771
372 2808842156 2808606359 Bacteria 9866990
373 2808920691 2808606375 Bacteria 9466072
374 2809232318 2808606448 Bacteria 8656184
375 2811849163 2808606982 Bacteria 7791042
376 2812357970 2811994879 Bacteria 9313447
377 2812480420 2811994917 Bacteria 7761064
378 2819695522 2818991463 Bacteria 7948711
379 2819742015 2818991472 Bacteria 10089953
380 2852636538 2852635781 Bacteria 8251373
381 2862179361 2862178590 Bacteria 8583590
382 2862285773 2862281513 Bacteria 9621493
383 2862290515 2862290372 Bacteria 7471434
384 2862386918 2862382967 Bacteria 10317375
385 2862511699 2862507626 Bacteria 9425308
386 2862579134 2862574272 Bacteria 10567477
387 2862706473 2862705112 Bacteria 6563286
388 2863404467 2863404153 Bacteria 9672205
389 2867348925 2867346516 Bacteria 7608576
390 2867371990 2867369537 Bacteria 6501581
391 2867432456 2867428634 Bacteria 9590268
392 2867478822 2867475112 Bacteria 6909112
393 2873155616 2873151551 Bacteria 8625867
394 2875395571 2875391855 Bacteria 7600475
395 2877680989 2877676314 Bacteria 9512378
396 2912719834 2912715099 Bacteria 9460473
397 2912724231 2912723979 Bacteria 8557534
398 2912760896 2912757875 Bacteria 7940295
399 2918505456 2918501144 Bacteria 8668083
400 2919445716 2919443155 Bacteria 4072969
401 2919469417 2919468124 Bacteria 9133025
402 2935393302 2935390628 Bacteria 7043367
403 2935410730 2935409751 Bacteria 4179611
404 2946049884 2946045630 Bacteria 8527308
405 2946067873 2946064051 Bacteria 8957905
406 2946076012 2946072368 Bacteria 8999607
407 2947229074 2947224130 Bacteria 9938529
408 2954007261 2954002825 Bacteria 9173742
409 2954386099 2954380949 Bacteria 10050426
410 2954677048 2954673503 Bacteria 9685905
411 2954687108 2954682443 Bacteria 9862841
412 2954696739 2954691527 Bacteria 10720516
413 2954705399 2954701450 Bacteria 10834262
414 2954716120 2954711539 Bacteria 10867210
415 2954726063 2954721474 Bacteria 10456478
416 2954735747 2954731030 Bacteria 10243860
417 2954744989 2954740390 Bacteria 10229294
418 2954754602 2954749733 Bacteria 10366972
419 2954763961 2954759201 Bacteria 9358192
420 2966601761 2966598605 Bacteria 7676064
421 2990045331 2990044586 Bacteria 6603797
422 2990063205 2990059506 Bacteria 9321252
423 2990092101 2990088156 Bacteria 6657676
424 2995465949 2995463766 Bacteria 8577691
425 2997457734 2997451912 Bacteria 8492419
426 2997600305 2997600082 Bacteria 9896405
427 3006325201 3006321560 Bacteria 8247479
428 3006394465 3006393351 Bacteria 6615579
429 3006428802 3006425503 Bacteria 6491253
430 3006491595 3006486233 Bacteria 8157040
431 3006500866 3006493962 Bacteria 8825450
432 8008490306 8008485437 Bacteria 7198341
433 8008567124 8008558824 Bacteria 10610750
434 8008578785 8008574985 Bacteria 7815457
435 8023627103 8023623736 Bacteria 8593882
436 8025413712 8025413630 Bacteria 7014048
437 8025483847 8025478263 Bacteria 8209203
438 8025529608 8025524527 Bacteria 7197316
439 8033690274 8033684223 Bacteria 6906479
440 8047897973 8047893842 Bacteria 11723082
441 8048133043 8048127548 Bacteria 11053136
442 8048360921 8048356638 Bacteria 11044339
443 8048374936 8048369669 Bacteria 11666822
444 8048383269 8048379754 Bacteria 11877923
445 8048413921 8048406513 Bacteria 8936924
446 8054161761 8054160619 Bacteria 7783213
447 8056671237 8056667051 Bacteria 6953971
448 8056833504 8056829672 Bacteria 9045328
449 JGI25160J50197_1007531
450 Ga0070713_100088886
451 Ga0081455_10020190
452 Ga0075368_10009266
453 Ga0075363_100015023
454 Ga0075367_10012394
455 Ga0075428_100104667
456 Ga0075428_100115367
457 Ga0075429_100101749
458 Ga0099826_10006479
459 Ga0105251_10017187
460 Ga0114129_10278847
461 Ga0105248_10037346
462 Ga0105238_10065469
463 Ga0105246_10005388
464 Ga0105246_10060870
465 Ga0157372_10046742
466 Ga0182008_10001457
467 Ga0182007_10003883
468 Ga0183367_1005
469 Ga0206353_11447188
470 Ga0213875_10004163
471 Ga0213875_10014989
472 Ga0207426_1006879
473 Ga0207426_1008804
474 Ga0207696_1012389
475 Ga0207688_10032791
476 Ga0207687_10063986
477 Ga0207664_10034214
478 Ga0207711_10057102
479 Ga0207678_10206074
480 Ga0207678_10207380
481 Ga0209813_10017230
482 Ga0268266_10148267
483 Ga0268266_10169329
484 Ga0307517_10010734
485 Ga0307517_10031996
486 Ga0307515_10003702
487 Ga0307515_10103839
488 Ga0307511_10001286
489 Ga0307511_10092206
490 Ga0307512_10001726
491 Ga0307512_10006664
492 Ga0307513_10007043
493 Ga0307509_10021010
494 Ga0307508_10009614
495 Ga0307514_10056510
496 Ga0307514_10057177
497 Ga0307514_10141814
498 Ga0307516_10018156
499 Ga0307516_10021397
500 Ga0307516_10176758
501 Ga0307410_10059619
502 Ga0307416_100016533
503 Ga0307507_10000009
504 Ga0307507_10033642
505 Ga0307507_10116823
506 Ga0307510_10079574
507 Ga0307510_10100934
508 Ga0395900_0311111
509 Ga0395898_0005710
510 Ga0395898_0052545
511 Ga0436364_0138124
512 Ga0436364_1059010
513 Ga0395901_0066415
514 Ga0439436_0000221
515 Ga0439436_0000369
516 Ga0439439_0035561
517 Ga0451837_0262800
518 Ga0451853_0598105
519 Ga0439448_0003157
520 Ga0439449_0001351
521 Ga0439455_0007185
522 Ga0439457_001048
523 Ga0450894_000165
524 Ga0450896_002141
525 Ga0450898_002004
526 Ga0450899_000799
527 Ga0450902_006277
528 Ga0450903_001146
529 Ga0450906_006462
530 Ga0439458_0003573
531 Ga0466969_0000315
532 Ga0466969_0003650
533 Ga0466969_0008200
534 Ga0466969_0008922
535 Ga0466969_0022178
536 Ga0466969_0028727
537 Ga0466972_0012631
538 Ga0466972_0024695
539 Ga0466965_0001233
540 Ga0466966_0002684
541 Ga0466966_0007376
542 Ga0466966_0010102
543 Ga0466966_0020464
544 Ga0466966_0048350
545 Ga0466961_0000772
546 Ga0466961_0028783
547 Ga0466961_0053854
548 Ga0466961_0057597
549 Ga0466961_0087124
550 Ga0466963_0001543
551 Ga0466963_0001954
552 Ga0466963_0098453
553 Ga0466964_0001683
554 Ga0466971_0017161
555 Ga0466971_0023931
556 Ga0466971_0029240
557 Ga0466968_0064633
558 Ga0466970_0000179
559 Ga0466970_0003079
560 Ga0466957_0001101
561 Ga0466959_0000363
562 Ga0466959_0000799
563 Ga0466958_0000745
564 Ga0466958_0046011
565 Ga0466967_0003603
566 Ga0466967_0003605
567 Ga0466967_0035661
568 Ga0466967_0306408
569 Ga0495603_0001554
570 Ga0495603_0001594
571 Ga0495603_0008073
572 Ga0495603_0023633
573 Ga0495603_0023634
574 Ga0495603_0031932
575 Ga0495629_0004390
576 Ga0495629_0006864
577 Ga0495629_0029808
578 Ga0495629_0036825
579 Ga0495629_0036937
580 Ga0495638_0065302
581 Ga0495638_0072895
582 Ga0495638_0077755
583 Ga0495651_0001322
584 Ga0495651_0012383
585 Ga0495653_0071838
586 Ga0495580_0006356
587 Ga0495605_0004397
588 Ga0495662_0000163
589 Ga0495662_0018676
590 Ga0495664_0000580
591 Ga0495664_0016992
592 Ga0495664_0019021
593 Ga0495585_0003798
594 Ga0495594_0013556
595 Ga0495594_0045956
596 Ga0495594_0078069
597 Ga0495607_0026567
598 Ga0495608_0035505
599 Ga0495616_0008463
600 Ga0495618_0009067
601 Ga0495618_0014656
602 Ga0495628_0009159
603 Ga0495628_0020902
604 Ga0495628_0021496
605 Ga0495628_0066511
606 Ga0495630_0004652
607 Ga0495631_0002930
608 Ga0495643_0021288
609 Ga0495643_0028373
610 Ga0495648_0025546
611 Ga0495648_0090660
612 Ga0495666_0066997
613 Ga0495652_0036680
614 Ga0495652_0050227
615 Ga0495652_0076257
616 Ga0495640_0005364
617 Ga0495640_0014000
618 Ga0495586_0015709
619 Ga0495587_0002579
620 Ga0495587_0095266
621 Ga0495645_0015218
622 Ga0495645_0043360
623 Ga0495645_0049416
624 Ga0495645_0097436
625 Ga0495622_0002963
626 Ga0495668_0065551
627 Ga0495634_0009698
628 Ga0495634_0033394
629 Ga0495611_0023705
630 Ga0495611_0046260
631 Ga0495625_0001776
632 Ga0495625_0076759
633 Ga0495635_0130433
634 Ga0495661_0015484
635 Ga0495588_0100385
636 Ga0495657_0002543
637 Ga0495657_0028623
638 Ga0495623_0002795
639 Ga0495623_0028482
640 Ga0495623_0086650
641 Ga0495646_0002025
642 Ga0495646_0002859
643 Ga0495646_0015161
644 Ga0495658_0026513
645 Ga0495613_0006519
646 Ga0495613_0019805
647 Ga0495613_0037131
648 Ga0495624_0026459
649 Ga0495624_0159132
650 Ga0495671_0006228
651 Ga0495649_0019433
652 Ga0495589_0004731
653 Ga0495600_0001446
654 Ga0495600_0006790
655 Ga0495600_0015394
656 Ga0495600_0031304
657 Ga0495660_0022104
658 Ga0495581_0033377
659 Ga0495604_0000878
660 Ga0495604_0001885
661 Ga0495604_0012665
662 Ga0495604_0013742
663 Ga0495604_0066265
664 Ga0495604_0069433
665 Ga0495636_0013319
666 Ga0495636_0013433
667 Ga0495636_0019767
668 Ga0495676_0000150
669 Ga0495676_0001728
670 Ga0495676_0005833
671 Ga0495676_0006750
672 Ga0495680_0054048
673 Ga0495680_0165932
674 Ga0495687_003240
675 Ga0495687_032479
676 Ga0495687_040060
677 Ga0495675_0002410
678 Ga0495675_0010899
679 Ga0495675_0014992
680 Ga0495685_001035
681 Ga0495685_010246
682 Ga0495681_0001177
683 Ga0495684_0162320
684 Ga0495686_0094066
685 Ga0495593_0001376
686 Ga0495593_0051613
687 Ga0495593_0076170
688 Ga0495602_0068402
689 Ga0495602_0073364
690 Ga0495614_0009355
691 Ga0495614_0023166
692 Ga0496102_0135570
693 Ga0496106_0061932
694 Ga0501031_0003647
695 Ga0501031_0018938
696 Ga0501031_0121892
697 Ga0501032_0007684
698 Ga0501032_0007954
699 Ga0501032_0046331
700 Ga0501033_0014569
701 Ga0501033_0018660
702 Ga0501033_0026344
703 Ga0501033_0039779
704 Ga0501034_0012764
705 Ga0501034_0016284
706 Ga0501034_0035254
707 Ga0501034_0053692
708 Ga0501036_0007966
709 Ga0501036_0031599
710 Ga0501036_0094515
711 Ga0501037_0003961
712 Ga0501037_0008259
713 Ga0501038_0012221
714 Ga0501038_0066017
715 Ga0501038_0109208
716 Ga0501039_0012712
717 Ga0501039_0081179
718 Ga0501039_0159962
719 Ga0501040_0004621
720 Ga0501040_0028946
721 Ga0501041_0034922
722 Ga0501042_0004260
723 Ga0501042_0051942
724 Ga0501042_0054775
725 Ga0501043_0005709
726 Ga0501046_0019114
727 Ga0501046_0020154
728 Ga0501047_0000033
729 Ga0501047_0001481
730 Ga0501047_0006618
731 Ga0501047_0140815
732 Ga0501047_0171604
733 Ga0501048_0016037
734 Ga0501048_0058163
735 Ga0501067_0005755
736 Ga0501068_0002878
737 Ga0501070_0006175
738 Ga0501071_0000622
739 Ga0501071_0041755
740 Ga0501071_0104618
741 Ga0501072_0011566
742 Ga0501072_0062028
743 Ga0501073_0044039
744 Ga0501074_0003420
745 Ga0501075_0032765
746 Ga0501076_0017776
747 Ga0501079_0007822
748 Ga0501079_0018797
749 Ga0501079_0020330
750 Ga0501080_0083601
751 Ga0501083_0001270
752 Ga0501035_0011367
753 Ga0501035_0013135
754 Ga0501035_0023442
755 Ga0501035_0028772
756 Ga0501035_0041237
757 Ga0501035_0054529
758 Ga0501044_0003451
759 Ga0501044_0015983
760 Ga0501044_0033712
761 Ga0501044_0043884
762 Ga0501044_0139520
763 Ga0501044_0233347
764 Ga0501045_0053907
765 Ga0501045_0057322
766 nmdc:mga06z11_7284_c1
767 nmdc:mga04h51_20346_c1
768 nmdc:mga07m45_59464_c1
769 Ga0495601_0006464
770 Ga0495601_0017269
771 Ga0495612_0009614
772 Ga0500640_048598
773 Ga0500654_037433
774 Ga0500560_012930
775 Ga0500569_003691
776 Ga0500614_005842
777 Ga0500628_003693
778 Ga0500652_021406
779 Ga0500561_0001699
780 Ga0500634_0033653
781 Ga0500656_000570
782 Ga0501084_0038167
783 Ga0501082_0011694
784 Ga0466962_0000458
785 Ga0466962_0001155
786 Ga0466962_0001291
787 Ga0466962_0015014
788 Ga0466962_0025225
789 Ga0466962_0052026
790 Ga0530510_0151199
791 8025537905
792 2547408242
793 2554257206
794 2585299264
795 2585308916
796 2585313608
797 2616694941
798 2616904587
799 2643765062
800 2643768456
801 2643899150
802 2643942405
803 2644014767
804 2644111834
805 2644176202
806 2644262419
807 2644390029
808 2644403333
809 2644429486
810 2644437255
811 2644461099
812 2644628993
813 2723641317
814 2784588708
815 2785343166
816 2785369637
817 2786670723
818 2793978329
819 2804846773
820 2808842156
821 2808920691
822 2809232318
823 2811849163
824 2812357970
825 2812480420
826 2819695522
827 2819742015
828 2852636538
829 2862179361
830 2862285773
831 2862290515
832 2862386918
833 2862511699
834 2862579134
835 2862706473
836 2863404467
837 2867348925
838 2867371990
839 2867432456
840 2867478822
841 2873155616
842 2875395571
843 2877680989
844 2912719834
845 2912724231
846 2912760896
847 2918505456
848 2919445716
849 2919469417
850 2935393302
851 2935410730
852 2946049884
853 2946067873
854 2946076012
855 2947229074
856 2954007261
857 2954386099
858 2954677048
859 2954687108
860 2954696739
861 2954705399
862 2954716120
863 2954726063
864 2954735747
865 2954744989
866 2954754602
867 2954763961
868 2966601761
869 2990045331
870 2990063205
871 2990092101
872 2995465949
873 2997457734
874 2997600305
875 3006325201
876 3006394465
877 3006428802
878 3006491595
879 3006500866
880 8008490306
881 8008567124
882 8008578785
883 8023627103
884 8025413712
885 8025483847
886 8025529608
887 8033690274
888 8047897973
889 8048133043
890 8048360921
891 8048374936
892 8048383269
893 8048413921
894 8054161761
895 8056671237
896 8056833504

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01406

tRNA-synt_1e

tRNA synthetases class I (C) catalytic domain

47

344

0.98

PF23493

458

500

0.91

PF09190

DALR_2

DALR domain

373

428

0.89

PF09334

tRNA-synt_1g

tRNA synthetases class I (M)

261

355

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8qhp-assembly1.cif.gz_B cysteine trna ligase homodimer 0.9207 1 395
3tqo-assembly1.cif.gz_A structure of the cysteinyl-trna synthetase (cyss) from coxiella burnetii. 0.9196 1 395
1li7-assembly1.cif.gz_A crystal structure of cysteinyl-trna synthetase with cysteine substrate bound 0.9156 3 396
1li7-assembly2.cif.gz_B crystal structure of cysteinyl-trna synthetase with cysteine substrate bound 0.9148 3 396
1li5-assembly2.cif.gz_B crystal structure of cysteinyl-trna synthetase 0.9127 3 396
ID Description Score Start End Superfamily
af_P9WFW1_1_304_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9723 1 296 3.40.50.620
af_Q2G2M6_1_304_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9581 3 298 3.40.50.620
af_C0PHQ1_15_336_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9517 2 298 3.40.50.620
af_P9WFW1_1_304_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9439 1 296 3.40.50.620
1li7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9331 18 298 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A6B3FE22-F1-model_v4 Cysteine--tRNA ligase 0.9935 56 231 GO:0004817
GO:0005524
GO:0005829
GO:0006423
AF-A0A6I2ZTT0-F1-model_v4 deleted 0.982 1 259
AF-X8AYE0-F1-model_v4 deleted 0.972 14 199
AF-A0A6B3FE22-F1-model_v4 Cysteine--tRNA ligase 0.9715 56 231 GO:0004817
GO:0005524
GO:0005829
GO:0006423
AF-A0A0R2NVC9-F1-model_v4 Cysteine--tRNA ligase (EC 6.1.1.16) 0.9685 1 298 GO:0004817
GO:0005524
GO:0005829
GO:0006423

Map