F446282

General Info

Members Datasets Scaffolds Average Seq Length
448 271 896 299

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2954380949|2954385913
Length 359
Sequence VEKPEPLQVPGLVHLHTGKVRELYQNEAGDLVMVASDRISAFDWVLPTEIPDKGRVLTQLSLWWFDQIADLLPNHVLSTAVPDGAPADWAGRTLVCKSLQMIPVEAVARGYLTGSGLLEYNESRTVCGLALPEGLVDGSELPAPIFTPATKAAVGEHDENVSYEEVARQVGADTAAQLRQATLAVYSRGRDIARDRGIILADTKFEFGFDGETLVIADEVLTPDSSRFWPGRAVGAGARAAVVRQAVRARLADLGGVRLGPQERAAPAAAAAGGRGPHPRQVHRGVRAPDGHELVVALVVTEKPPGENRGASRWSERRGSNSRPQPWQGCALPTELRSHAPWRENHYTQPRSRASRTAV

Samples

Sample ID Description Type Environment
1 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
4 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
5 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
6 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
7 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
8 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
9 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
10 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
11 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
12 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
13 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
14 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
15 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
16 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
17 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
18 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
19 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
26 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
28 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
29 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
30 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
31 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
32 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
33 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
34 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
35 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
36 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
37 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
38 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
39 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
40 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
41 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
42 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
43 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
44 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
45 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
46 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
47 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
48 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
49 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
50 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
51 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
52 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
53 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
54 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
55 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
56 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
57 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
58 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
59 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
60 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
61 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
62 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
63 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
64 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
65 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
66 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
67 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
68 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
69 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
70 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
71 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
72 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
73 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
74 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
75 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
76 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
77 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
78 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
79 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
80 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
81 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
82 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
83 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
84 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
85 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
86 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
87 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
88 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
89 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
90 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
91 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
92 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
93 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
94 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
95 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
96 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
97 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
98 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
99 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
100 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
101 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
102 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
103 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
104 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
105 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
106 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
107 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
108 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
109 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
110 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
113 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
117 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
118 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
119 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
122 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
125 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
126 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
127 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
128 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
129 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
130 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
131 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
132 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
133 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
134 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
135 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
136 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
137 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
153 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
154 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
168 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
169 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
172 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
173 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
174 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
175 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
176 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
177 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
181 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
182 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
183 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
184 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
185 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
186 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
187 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
188 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
189 2643221548 Streptomyces sp. Root55 Isolate Unclassified
190 2643221578 Streptomyces sp. Root63 Isolate Unclassified
191 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
192 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
193 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
194 2643221647 Streptomyces sp. Root369 Isolate Unclassified
195 2643221670 Streptomyces sp. Root431 Isolate Unclassified
196 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
197 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
198 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
199 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
200 2643221714 Streptomyces sp. Root264 Isolate Unclassified
201 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
202 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
203 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
204 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
205 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
206 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
207 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
208 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
209 2808606448 Streptomyces sp. 193411 Isolate Unclassified
210 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
211 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
212 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
213 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
214 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
215 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
216 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
217 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
218 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
219 2862574272 Streptomyces sp. AcE210 Isolate Nodule
220 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
221 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
222 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
223 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
224 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
225 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
226 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
227 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
228 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
229 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
230 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
231 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
232 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
233 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
234 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
235 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
236 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
237 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
238 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
239 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
240 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
241 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
242 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
243 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
244 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
245 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
246 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
247 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
248 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
249 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
250 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
251 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
252 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
253 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
254 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
255 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
256 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
257 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
258 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
259 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
260 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
261 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
262 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
263 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
264 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
265 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
266 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
267 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
268 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
269 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
270 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
271 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.69
Metatranscriptomes 0.22
Isolates 20.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.79
Nodule 0.67
Rhizoplane 0.22
Rhizosphere 79.46
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25160J50197_1022689 3300003354 Bacteria 1833
2 JGI25160J50197_1029841 3300003354 Bacteria 1433
3 Ga0006562J51391_1095071 3300003578 Bacteria 7160
4 Ga0068853_100034682 3300005539 Bacteria 4284
5 Ga0070672_100338649 3300005543 Bacteria 1281
6 Ga0070665_100111096 3300005548 Bacteria 2743
7 Ga0068856_100161529 3300005614 Bacteria 2251
8 Ga0099826_10047997 3300006948 Bacteria 2894
9 Ga0105251_10029310 3300009011 Bacteria 2772
10 Ga0105244_10105207 3300009036 Bacteria 1377
11 Ga0105245_10222537 3300009098 Bacteria 1822
12 Ga0105245_10272204 3300009098 Bacteria 1652
13 Ga0105243_10026159 3300009148 Bacteria 4465
14 Ga0105248_10031304 3300009177 Bacteria 5945
15 Ga0105246_10002848 3300011119 Bacteria 10466
16 Ga0105246_10329682 3300011119 Bacteria 1243
17 Ga0157372_10130152 3300013307 Bacteria 2895
18 Ga0182007_10001033 3300015262 Bacteria 15217
19 Ga0213875_10015088 3300021388 Bacteria 3762
20 Ga0209758_1005384 3300025297 Bacteria 9903
21 Ga0207426_1002142 3300025302 Bacteria 13473
22 Ga0207426_1011990 3300025302 Bacteria 3275
23 Ga0207426_1020580 3300025302 Bacteria 2291
24 Ga0207655_1068210 3300025728 Bacteria 1335
25 Ga0207713_1042977 3300025735 Bacteria 1871
26 Ga0207647_10007957 3300025904 Bacteria 7621
27 Ga0207709_10204693 3300025935 Bacteria 1412
28 Ga0207709_10224235 3300025935 Bacteria 1357
29 Ga0207691_10217313 3300025940 Bacteria 1658
30 Ga0207702_10495713 3300026078 Bacteria 1190
31 Ga0209371_1033426 3300027312 Bacteria 1097
32 Ga0268266_10137104 3300028379 Bacteria 2193
33 Ga0268266_10247968 3300028379 Bacteria 1646
34 Ga0307517_10017001 3300028786 Bacteria 9512
35 Ga0307515_10006510 3300028794 Bacteria 23364
36 Ga0307515_10156693 3300028794 Bacteria 2346
37 Ga0268256_1011796 3300030500 Bacteria 2740
38 Ga0307511_10000678 3300030521 Bacteria 36277
39 Ga0307511_10039720 3300030521 Bacteria 4014
40 Ga0307511_10102793 3300030521 Bacteria 1865
41 Ga0307512_10008326 3300030522 Bacteria 10129
42 Ga0307512_10011092 3300030522 Bacteria 8553
43 Ga0307513_10056301 3300031456 Bacteria 4199
44 Ga0307513_10337628 3300031456 Bacteria 1258
45 Ga0307509_10014615 3300031507 Bacteria 9219
46 Ga0307509_10062421 3300031507 Bacteria 3929
47 Ga0307508_10013420 3300031616 Bacteria 7491
48 Ga0307508_10023194 3300031616 Bacteria 5637
49 Ga0307514_10038688 3300031649 Bacteria 3770
50 Ga0307514_10065490 3300031649 Bacteria 2752
51 Ga0307516_10049921 3300031730 Bacteria 4107
52 Ga0307518_10044535 3300031838 Bacteria 3228
53 Ga0307518_10074202 3300031838 Bacteria 2461
54 Ga0307518_10087985 3300031838 Bacteria 2238
55 Ga0307518_10242814 3300031838 Bacteria 1153
56 Ga0307409_100218465 3300031995 Bacteria 1719
57 Ga0307416_100140457 3300032002 Bacteria 2194
58 Ga0307507_10019677 3300033179 Bacteria 7593
59 Ga0307507_10020379 3300033179 Bacteria 7428
60 Ga0307507_10066453 3300033179 Bacteria 3306
61 Ga0307510_10034412 3300033180 Bacteria 5673
62 Ga0307510_10067345 3300033180 Bacteria 3606
63 Ga0307510_10067680 3300033180 Bacteria 3592
64 Ga0307510_10077992 3300033180 Bacteria 3244
65 Ga0395898_0077439 3300037466 Bacteria 3210
66 Ga0436364_1380948 3300037853 Bacteria 29628
67 Ga0439439_0002654 3300041406 Bacteria 3830
68 Ga0439439_0015005 3300041406 Bacteria 1889
69 Ga0451849_1052688 3300041505 Bacteria 990
70 Ga0451853_3360029 3300041512 Bacteria 2368
71 Ga0439432_015116 3300042006 Bacteria 2608
72 Ga0439449_0000357 3300042007 Bacteria 16784
73 Ga0439449_0021782 3300042007 Bacteria 2399
74 Ga0439457_003315 3300042014 Bacteria 4397
75 Ga0439462_0007364 3300042015 Bacteria 2754
76 Ga0450900_006215 3300042136 Bacteria 1439
77 Ga0450903_000183 3300042138 Bacteria 13862
78 Ga0466969_0002852 3300044656 Bacteria 9235
79 Ga0466969_0017564 3300044656 Bacteria 3733
80 Ga0466969_0093385 3300044656 Bacteria 1423
81 Ga0466972_0017221 3300044658 Bacteria 3615
82 Ga0466965_0002504 3300044683 Bacteria 7818
83 Ga0466965_0004091 3300044683 Bacteria 6475
84 Ga0466965_0119258 3300044683 Bacteria 1361
85 Ga0466966_0005197 3300044684 Bacteria 8549
86 Ga0466966_0006341 3300044684 Bacteria 7819
87 Ga0466966_0017997 3300044684 Bacteria 4666
88 Ga0466961_0004350 3300044693 Bacteria 8876
89 Ga0466961_0007996 3300044693 Bacteria 6741
90 Ga0466963_0000277 3300044694 Bacteria 22841
91 Ga0466963_0018077 3300044694 Bacteria 4401
92 Ga0466964_0012805 3300044706 Bacteria 3176
93 Ga0466971_0002861 3300044719 Bacteria 7320
94 Ga0466971_0075060 3300044719 Bacteria 1537
95 Ga0466970_0004108 3300044765 Bacteria 7155
96 Ga0466970_0006029 3300044765 Bacteria 6043
97 Ga0466970_0035346 3300044765 Bacteria 2647
98 Ga0466957_0000940 3300044842 Bacteria 14902
99 Ga0466959_0004593 3300045049 Bacteria 9269
100 Ga0466959_0012542 3300045049 Bacteria 6128
101 Ga0466959_0016672 3300045049 Bacteria 5373
102 Ga0466959_0259579 3300045049 Bacteria 1196
103 Ga0466967_0001066 3300045976 Bacteria 15136
104 Ga0466967_0025559 3300045976 Bacteria 4872
105 Ga0495617_027092 3300046452 Bacteria 1929
106 Ga0495617_056952 3300046452 Bacteria 1296
107 Ga0495627_023206 3300046453 Bacteria 2035
108 Ga0495592_0016759 3300046454 Bacteria 5562
109 Ga0495592_0084233 3300046454 Bacteria 2294
110 Ga0495603_0002960 3300046455 Bacteria 10047
111 Ga0495603_0005548 3300046455 Bacteria 7531
112 Ga0495603_0009162 3300046455 Bacteria 5980
113 Ga0495603_0020544 3300046455 Bacteria 4000
114 Ga0495603_0029340 3300046455 Bacteria 3317
115 Ga0495590_0009609 3300046457 Bacteria 3669
116 Ga0495590_0092409 3300046457 Bacteria 1071
117 Ga0495629_0004619 3300046459 Bacteria 10312
118 Ga0495629_0005729 3300046459 Bacteria 9271
119 Ga0495629_0007636 3300046459 Bacteria 7961
120 Ga0495629_0010563 3300046459 Bacteria 6718
121 Ga0495629_0012634 3300046459 Bacteria 6116
122 Ga0495629_0063281 3300046459 Bacteria 2584
123 Ga0495629_0104628 3300046459 Bacteria 1974
124 Ga0495629_0217336 3300046459 Bacteria 1319
125 Ga0495638_0088367 3300046460 Bacteria 1871
126 Ga0495651_0086300 3300046462 Bacteria 2362
127 Ga0495653_0013501 3300046463 Bacteria 6656
128 Ga0495605_0032141 3300046474 Bacteria 2674
129 Ga0495662_0001873 3300046476 Bacteria 10531
130 Ga0495662_0005912 3300046476 Bacteria 6118
131 Ga0495664_0011890 3300046477 Bacteria 4917
132 Ga0495664_0045192 3300046477 Bacteria 2611
133 Ga0495664_0175933 3300046477 Bacteria 1298
134 Ga0495585_0128851 3300046492 Bacteria 1333
135 Ga0495585_0157270 3300046492 Bacteria 1181
136 Ga0495585_0163049 3300046492 Bacteria 1155
137 Ga0495594_0000230 3300046499 Bacteria 27077
138 Ga0495594_0102424 3300046499 Bacteria 1610
139 Ga0495607_0037679 3300046501 Bacteria 2902
140 Ga0495583_0065577 3300046506 Bacteria 1608
141 Ga0495583_0136242 3300046506 Bacteria 1025
142 Ga0495606_0002627 3300046507 Bacteria 20492
143 Ga0495608_0011720 3300046511 Bacteria 6096
144 Ga0495608_0100093 3300046511 Bacteria 1869
145 Ga0495610_0040668 3300046512 Bacteria 2341
146 Ga0495616_0050976 3300046513 Bacteria 2067
147 Ga0495618_0099570 3300046514 Bacteria 1860
148 Ga0495628_0002613 3300046516 Bacteria 16167
149 Ga0495628_0027165 3300046516 Bacteria 4659
150 Ga0495630_0027518 3300046517 Bacteria 4219
151 Ga0495631_0037712 3300046518 Bacteria 2151
152 Ga0495631_0111411 3300046518 Bacteria 1177
153 Ga0495643_0089601 3300046522 Bacteria 1588
154 Ga0495644_0040596 3300046523 Bacteria 1754
155 Ga0495648_0042246 3300046524 Bacteria 2870
156 Ga0495666_0000236 3300046526 Bacteria 23671
157 Ga0495666_0065858 3300046526 Bacteria 1728
158 Ga0495666_0097705 3300046526 Bacteria 1384
159 Ga0495666_0140640 3300046526 Bacteria 1125
160 Ga0495652_0012217 3300046529 Bacteria 7754
161 Ga0495654_0006510 3300046530 Bacteria 6629
162 Ga0495640_0007731 3300046533 Bacteria 8454
163 Ga0495640_0029848 3300046533 Bacteria 3908
164 Ga0495586_0017969 3300046535 Bacteria 3761
165 Ga0495586_0053177 3300046535 Bacteria 2194
166 Ga0495587_0001940 3300046536 Bacteria 13771
167 Ga0495587_0187828 3300046536 Bacteria 1170
168 Ga0495609_0012324 3300046538 Bacteria 4055
169 Ga0495645_0016142 3300046543 Bacteria 5323
170 Ga0495645_0021098 3300046543 Bacteria 4708
171 Ga0495645_0089032 3300046543 Bacteria 2207
172 Ga0495645_0096296 3300046543 Bacteria 2109
173 Ga0495622_0001355 3300046557 Bacteria 12516
174 Ga0495622_0185822 3300046557 Bacteria 930
175 Ga0495633_0017984 3300046558 Bacteria 3596
176 Ga0495667_0001508 3300046559 Bacteria 15358
177 Ga0495667_0145571 3300046559 Bacteria 1526
178 Ga0495668_0084384 3300046616 Bacteria 1741
179 Ga0495634_0009843 3300046642 Bacteria 7033
180 Ga0495634_0010382 3300046642 Bacteria 6823
181 Ga0495634_0031147 3300046642 Bacteria 3675
182 Ga0495611_0018196 3300046648 Bacteria 3011
183 Ga0495611_0036313 3300046648 Bacteria 2186
184 Ga0495625_0007913 3300046660 Bacteria 9144
185 Ga0495625_0032665 3300046660 Bacteria 3856
186 Ga0495625_0059339 3300046660 Bacteria 2715
187 Ga0495625_0206022 3300046660 Bacteria 1295
188 Ga0495635_0006804 3300046663 Bacteria 7990
189 Ga0495635_0072996 3300046663 Bacteria 2350
190 Ga0495661_0032917 3300046665 Bacteria 3273
191 Ga0495588_0016591 3300046674 Bacteria 3560
192 Ga0495588_0033317 3300046674 Bacteria 2600
193 Ga0495588_0086119 3300046674 Bacteria 1643
194 Ga0495657_0017535 3300046675 Bacteria 5195
195 Ga0495657_0018267 3300046675 Bacteria 5078
196 Ga0495657_0160826 3300046675 Bacteria 1389
197 Ga0495599_0002709 3300046678 Bacteria 10335
198 Ga0495623_0011026 3300046679 Bacteria 5848
199 Ga0495623_0119043 3300046679 Bacteria 1592
200 Ga0495646_0003333 3300046680 Bacteria 9987
201 Ga0495646_0063727 3300046680 Bacteria 2187
202 Ga0495658_0160148 3300046683 Bacteria 1387
203 Ga0495613_0000765 3300046689 Bacteria 25123
204 Ga0495613_0002591 3300046689 Bacteria 13587
205 Ga0495613_0005919 3300046689 Bacteria 9153
206 Ga0495613_0007943 3300046689 Bacteria 7896
207 Ga0495613_0290931 3300046689 Bacteria 1132
208 Ga0495624_0006726 3300046690 Bacteria 8123
209 Ga0495624_0050098 3300046690 Bacteria 2646
210 Ga0495671_0003990 3300046692 Bacteria 8923
211 Ga0495671_0097970 3300046692 Bacteria 1434
212 Ga0495649_0078916 3300046694 Bacteria 1761
213 Ga0495589_0006194 3300046794 Bacteria 6317
214 Ga0495589_0034881 3300046794 Bacteria 2523
215 Ga0495600_0009972 3300046809 Bacteria 5885
216 Ga0495600_0063391 3300046809 Bacteria 2415
217 Ga0495600_0064132 3300046809 Bacteria 2401
218 Ga0495660_0102343 3300046810 Bacteria 1472
219 Ga0495660_0119476 3300046810 Bacteria 1335
220 Ga0495581_0006860 3300047315 Bacteria 6603
221 Ga0495581_0025211 3300047315 Bacteria 3448
222 Ga0495581_0040079 3300047315 Bacteria 2711
223 Ga0495604_0004135 3300047317 Bacteria 11521
224 Ga0495604_0004664 3300047317 Bacteria 10867
225 Ga0495604_0005785 3300047317 Bacteria 9809
226 Ga0495604_0048351 3300047317 Bacteria 3308
227 Ga0495604_0200763 3300047317 Bacteria 1383
228 Ga0495636_0010762 3300047318 Bacteria 3617
229 Ga0495636_0094166 3300047318 Bacteria 1303
230 Ga0495636_0159182 3300047318 Bacteria 1016
231 Ga0495676_0002298 3300047321 Bacteria 16968
232 Ga0495676_0004244 3300047321 Bacteria 13082
233 Ga0495676_0016915 3300047321 Bacteria 6457
234 Ga0495676_0109743 3300047321 Bacteria 2026
235 Ga0495676_0156134 3300047321 Bacteria 1618
236 Ga0495676_0225186 3300047321 Bacteria 1290
237 Ga0495676_0327721 3300047321 Bacteria 1027
238 Ga0495680_0007785 3300047322 Bacteria 9782
239 Ga0495683_0092593 3300047323 Bacteria 1462
240 Ga0495687_002091 3300047443 Bacteria 16779
241 Ga0495675_0011932 3300047444 Bacteria 5460
242 Ga0495675_0014091 3300047444 Bacteria 5054
243 Ga0495675_0020119 3300047444 Bacteria 4242
244 Ga0495685_003281 3300047447 Bacteria 5154
245 Ga0495685_012245 3300047447 Bacteria 2904
246 Ga0495681_0006593 3300047470 Bacteria 7603
247 Ga0495681_0076166 3300047470 Bacteria 1508
248 Ga0495684_0060826 3300047471 Bacteria 2874
249 Ga0495684_0118194 3300047471 Bacteria 1998
250 Ga0495686_0062079 3300047472 Bacteria 2318
251 Ga0495593_0000936 3300047673 Bacteria 17005
252 Ga0495602_0026061 3300048088 Bacteria 5647
253 Ga0495602_0147560 3300048088 Bacteria 1853
254 Ga0495614_0001871 3300048089 Bacteria 9227
255 Ga0495614_0001978 3300048089 Bacteria 9006
256 Ga0495614_0003844 3300048089 Bacteria 6751
257 Ga0501031_0004872 3300049568 Bacteria 8725
258 Ga0501031_0071030 3300049568 Bacteria 2268
259 Ga0501031_0107195 3300049568 Bacteria 1824
260 Ga0501032_0004038 3300049569 Bacteria 11129
261 Ga0501032_0249564 3300049569 Bacteria 1152
262 Ga0501033_0079490 3300049570 Bacteria 2406
263 Ga0501033_0169085 3300049570 Bacteria 1570
264 Ga0501034_0009173 3300049571 Bacteria 10378
265 Ga0501034_0011319 3300049571 Bacteria 9256
266 Ga0501034_0012032 3300049571 Bacteria 8944
267 Ga0501034_0012296 3300049571 Bacteria 8843
268 Ga0501034_0070535 3300049571 Bacteria 3505
269 Ga0501034_0286235 3300049571 Bacteria 1587
270 Ga0501034_0438425 3300049571 Bacteria 1225
271 Ga0501036_0012922 3300049572 Bacteria 6933
272 Ga0501036_0021151 3300049572 Bacteria 5464
273 Ga0501036_0037301 3300049572 Bacteria 4112
274 Ga0501036_0047012 3300049572 Bacteria 3654
275 Ga0501036_0062090 3300049572 Bacteria 3165
276 Ga0501036_0068947 3300049572 Bacteria 2992
277 Ga0501036_0329997 3300049572 Bacteria 1274
278 Ga0501037_0051286 3300049573 Bacteria 3017
279 Ga0501037_0075522 3300049573 Bacteria 2447
280 Ga0501037_0089510 3300049573 Bacteria 2227
281 Ga0501038_0000303 3300049574 Bacteria 41854
282 Ga0501038_0051643 3300049574 Bacteria 3547
283 Ga0501038_0055184 3300049574 Bacteria 3414
284 Ga0501038_0060622 3300049574 Bacteria 3237
285 Ga0501038_0136704 3300049574 Bacteria 2007
286 Ga0501039_0008174 3300049575 Bacteria 7973
287 Ga0501039_0107212 3300049575 Bacteria 2182
288 Ga0501040_0106436 3300049576 Bacteria 1959
289 Ga0501041_0011292 3300049577 Bacteria 5279
290 Ga0501042_0008580 3300049578 Bacteria 6760
291 Ga0501042_0018153 3300049578 Bacteria 4868
292 Ga0501043_0001902 3300049579 Bacteria 17894
293 Ga0501043_0007376 3300049579 Bacteria 8725
294 Ga0501043_0008745 3300049579 Bacteria 7971
295 Ga0501043_0024306 3300049579 Bacteria 4755
296 Ga0501043_0132756 3300049579 Bacteria 1951
297 Ga0501046_0045271 3300049580 Bacteria 3496
298 Ga0501047_0000093 3300049581 Bacteria 110613
299 Ga0501047_0010293 3300049581 Bacteria 8844
300 Ga0501047_0107266 3300049581 Bacteria 2674
301 Ga0501047_0138076 3300049581 Bacteria 2317
302 Ga0501047_0274295 3300049581 Bacteria 1532
303 Ga0501047_0277430 3300049581 Bacteria 1521
304 Ga0501047_0370796 3300049581 Bacteria 1266
305 Ga0501048_0003194 3300049582 Bacteria 12486
306 Ga0501048_0066992 3300049582 Bacteria 2538
307 Ga0501067_0027872 3300049583 Bacteria 3130
308 Ga0501068_0001002 3300049584 Bacteria 14870
309 Ga0501068_0153769 3300049584 Bacteria 1447
310 Ga0501069_0009567 3300049585 Bacteria 5117
311 Ga0501070_0001534 3300049586 Bacteria 20554
312 Ga0501070_0039851 3300049586 Bacteria 3917
313 Ga0501070_0275642 3300049586 Bacteria 1373
314 Ga0501070_0349049 3300049586 Bacteria 1201
315 Ga0501071_0009680 3300049587 Bacteria 6430
316 Ga0501072_0045217 3300049588 Bacteria 3461
317 Ga0501073_0058412 3300049589 Bacteria 2695
318 Ga0501076_0095725 3300049592 Bacteria 2391
319 Ga0501077_0014483 3300049593 Bacteria 4957
320 Ga0501079_0027357 3300049741 Bacteria 4371
321 Ga0501080_0030750 3300049742 Bacteria 5002
322 Ga0501080_0370926 3300049742 Bacteria 1290
323 Ga0501083_0005618 3300049744 Bacteria 8878
324 Ga0501035_0004849 3300049822 Bacteria 12755
325 Ga0501035_0014568 3300049822 Bacteria 7257
326 Ga0501035_0036477 3300049822 Bacteria 4455
327 Ga0501035_0048470 3300049822 Bacteria 3809
328 Ga0501035_0087297 3300049822 Bacteria 2749
329 Ga0501035_0226993 3300049822 Bacteria 1592
330 Ga0501044_0025955 3300049823 Bacteria 6208
331 Ga0501044_0075595 3300049823 Bacteria 3420
332 Ga0501044_0076356 3300049823 Bacteria 3400
333 Ga0501044_0077674 3300049823 Bacteria 3366
334 Ga0501044_0105840 3300049823 Bacteria 2825
335 Ga0501044_0201261 3300049823 Bacteria 1950
336 Ga0501044_0398786 3300049823 Bacteria 1288
337 Ga0501044_0407307 3300049823 Bacteria 1271
338 Ga0501044_0441722 3300049823 Bacteria 1209
339 Ga0501045_0014780 3300049824 Bacteria 5534
340 Ga0501045_0119356 3300049824 Bacteria 1958
341 Ga0501045_0176027 3300049824 Bacteria 1594
342 nmdc:mga03n38_75874_c1 3300050490 Bacteria 1567
343 nmdc:mga0yw44_74985_c1 3300050492 Bacteria 2108
344 nmdc:mga07m45_172192_c1 3300050496 Bacteria 1258
345 Ga0495601_0012255 3300053077 Bacteria 5141
346 Ga0500610_0180147 3300053079 Bacteria 1035
347 Ga0495655_0027645 3300053083 Bacteria 1347
348 Ga0500640_001995 3300053095 Bacteria 6557
349 Ga0500560_002092 3300053107 Bacteria 3718
350 Ga0500560_071378 3300053107 Bacteria 1145
351 Ga0500572_003963 3300053111 Bacteria 3363
352 Ga0500573_0013500 3300053140 Bacteria 4605
353 Ga0500573_0125796 3300053140 Bacteria 1423
354 Ga0500624_023015 3300053157 Bacteria 1018
355 Ga0501084_0062443 3300054114 Bacteria 3118
356 Ga0501082_0023770 3300060353 Bacteria 5284
357 Ga0466962_0005261 3300061719 Bacteria 6215
358 Ga0530510_0044251 3300061734 Bacteria 3217
359 2954385913 2954380949 Bacteria 10050426
360 2554257374 2554235005 Bacteria 6457341
361 2585300306 2582581312 Bacteria 7308206
362 2585310645 2582581313 Bacteria 10042643
363 2585314412 2582581314 Bacteria 11452267
364 2616700213 2616644814 Bacteria 11555299
365 2616905270 2616644941 Bacteria 8510691
366 2643762999 2643221548 Bacteria 8053412
367 2643899945 2643221578 Bacteria 9213798
368 2643947763 2643221587 Bacteria 7586415
369 2644015190 2643221601 Bacteria 7493239
370 2644175355 2643221631 Bacteria 8168043
371 2644263014 2643221647 Bacteria 10741251
372 2644390803 2643221670 Bacteria 6497041
373 2644405832 2643221673 Bacteria 9196637
374 2644433628 2643221677 Bacteria 7584031
375 2644443232 2643221678 Bacteria 9540101
376 2644464143 2643221682 Bacteria 6743283
377 2644626957 2643221714 Bacteria 9015452
378 2784588885 2784132148 Bacteria 8627943
379 2785343002 2784746763 Bacteria 9783172
380 2785369825 2784746768 Bacteria 10036182
381 2786670914 2786546132 Bacteria 10419719
382 2793983509 2791355406 Bacteria 11364898
383 2804846468 2802429296 Bacteria 7227771
384 2808842329 2808606359 Bacteria 9866990
385 2808920853 2808606375 Bacteria 9466072
386 2809232501 2808606448 Bacteria 8656184
387 2811849328 2808606982 Bacteria 7791042
388 2812357786 2811994879 Bacteria 9313447
389 2812480259 2811994917 Bacteria 7761064
390 2819741643 2818991472 Bacteria 10089953
391 2852637089 2852635781 Bacteria 8251373
392 2862183411 2862178590 Bacteria 8583590
393 2862285947 2862281513 Bacteria 9621493
394 2862291273 2862290372 Bacteria 7471434
395 2862508000 2862507626 Bacteria 9425308
396 2862578964 2862574272 Bacteria 10567477
397 2863404264 2863404153 Bacteria 9672205
398 2867347762 2867346516 Bacteria 7608576
399 2873155450 2873151551 Bacteria 8625867
400 2875395385 2875391855 Bacteria 7600475
401 2877680814 2877676314 Bacteria 9512378
402 2912719624 2912715099 Bacteria 9460473
403 2912731312 2912723979 Bacteria 8557534
404 2912761091 2912757875 Bacteria 7940295
405 2918505293 2918501144 Bacteria 8668083
406 2935390939 2935390628 Bacteria 7043367
407 2946049702 2946045630 Bacteria 8527308
408 2946068080 2946064051 Bacteria 8957905
409 2946076182 2946072368 Bacteria 8999607
410 2947228858 2947224130 Bacteria 9938529
411 2954006676 2954002825 Bacteria 9173742
412 2954677240 2954673503 Bacteria 9685905
413 2954686915 2954682443 Bacteria 9862841
414 2954696564 2954691527 Bacteria 10720516
415 2954705660 2954701450 Bacteria 10834262
416 2954715924 2954711539 Bacteria 10867210
417 2954725863 2954721474 Bacteria 10456478
418 2954735935 2954731030 Bacteria 10243860
419 2954744801 2954740390 Bacteria 10229294
420 2954754798 2954749733 Bacteria 10366972
421 2954763786 2954759201 Bacteria 9358192
422 2990048984 2990044586 Bacteria 6603797
423 2990065663 2990059506 Bacteria 9321252
424 2990088509 2990088156 Bacteria 6657676
425 2995468978 2995463766 Bacteria 8577691
426 2997454699 2997451912 Bacteria 8492419
427 3006328425 3006321560 Bacteria 8247479
428 3006399761 3006393351 Bacteria 6615579
429 3006493775 3006486233 Bacteria 8157040
430 3006499276 3006493962 Bacteria 8825450
431 8008487055 8008485437 Bacteria 7198341
432 8008566955 8008558824 Bacteria 10610750
433 8008578628 8008574985 Bacteria 7815457
434 8023629422 8023623736 Bacteria 8593882
435 8025413649 8025413630 Bacteria 7014048
436 8025478864 8025478263 Bacteria 8209203
437 8025525184 8025524527 Bacteria 7197316
438 8025536369 8025530807 Bacteria 8495698
439 8047897319 8047893842 Bacteria 11723082
440 8048128233 8048127548 Bacteria 11053136
441 8048361624 8048356638 Bacteria 11044339
442 8048374307 8048369669 Bacteria 11666822
443 8048383916 8048379754 Bacteria 11877923
444 8048412650 8048406513 Bacteria 8936924
445 8054162972 8054160619 Bacteria 7783213
446 8056451908 8056447290 Bacteria 7680491
447 8056672377 8056667051 Bacteria 6953971
448 8056833381 8056829672 Bacteria 9045328
449 JGI25160J50197_1022689
450 JGI25160J50197_1029841
451 Ga0006562J51391_1095071
452 Ga0068853_100034682
453 Ga0070672_100338649
454 Ga0070665_100111096
455 Ga0068856_100161529
456 Ga0099826_10047997
457 Ga0105251_10029310
458 Ga0105244_10105207
459 Ga0105245_10222537
460 Ga0105245_10272204
461 Ga0105243_10026159
462 Ga0105248_10031304
463 Ga0105246_10002848
464 Ga0105246_10329682
465 Ga0157372_10130152
466 Ga0182007_10001033
467 Ga0213875_10015088
468 Ga0209758_1005384
469 Ga0207426_1002142
470 Ga0207426_1011990
471 Ga0207426_1020580
472 Ga0207655_1068210
473 Ga0207713_1042977
474 Ga0207647_10007957
475 Ga0207709_10204693
476 Ga0207709_10224235
477 Ga0207691_10217313
478 Ga0207702_10495713
479 Ga0209371_1033426
480 Ga0268266_10137104
481 Ga0268266_10247968
482 Ga0307517_10017001
483 Ga0307515_10006510
484 Ga0307515_10156693
485 Ga0268256_1011796
486 Ga0307511_10000678
487 Ga0307511_10039720
488 Ga0307511_10102793
489 Ga0307512_10008326
490 Ga0307512_10011092
491 Ga0307513_10056301
492 Ga0307513_10337628
493 Ga0307509_10014615
494 Ga0307509_10062421
495 Ga0307508_10013420
496 Ga0307508_10023194
497 Ga0307514_10038688
498 Ga0307514_10065490
499 Ga0307516_10049921
500 Ga0307518_10044535
501 Ga0307518_10074202
502 Ga0307518_10087985
503 Ga0307518_10242814
504 Ga0307409_100218465
505 Ga0307416_100140457
506 Ga0307507_10019677
507 Ga0307507_10020379
508 Ga0307507_10066453
509 Ga0307510_10034412
510 Ga0307510_10067345
511 Ga0307510_10067680
512 Ga0307510_10077992
513 Ga0395898_0077439
514 Ga0436364_1380948
515 Ga0439439_0002654
516 Ga0439439_0015005
517 Ga0451849_1052688
518 Ga0451853_3360029
519 Ga0439432_015116
520 Ga0439449_0000357
521 Ga0439449_0021782
522 Ga0439457_003315
523 Ga0439462_0007364
524 Ga0450900_006215
525 Ga0450903_000183
526 Ga0466969_0002852
527 Ga0466969_0017564
528 Ga0466969_0093385
529 Ga0466972_0017221
530 Ga0466965_0002504
531 Ga0466965_0004091
532 Ga0466965_0119258
533 Ga0466966_0005197
534 Ga0466966_0006341
535 Ga0466966_0017997
536 Ga0466961_0004350
537 Ga0466961_0007996
538 Ga0466963_0000277
539 Ga0466963_0018077
540 Ga0466964_0012805
541 Ga0466971_0002861
542 Ga0466971_0075060
543 Ga0466970_0004108
544 Ga0466970_0006029
545 Ga0466970_0035346
546 Ga0466957_0000940
547 Ga0466959_0004593
548 Ga0466959_0012542
549 Ga0466959_0016672
550 Ga0466959_0259579
551 Ga0466967_0001066
552 Ga0466967_0025559
553 Ga0495617_027092
554 Ga0495617_056952
555 Ga0495627_023206
556 Ga0495592_0016759
557 Ga0495592_0084233
558 Ga0495603_0002960
559 Ga0495603_0005548
560 Ga0495603_0009162
561 Ga0495603_0020544
562 Ga0495603_0029340
563 Ga0495590_0009609
564 Ga0495590_0092409
565 Ga0495629_0004619
566 Ga0495629_0005729
567 Ga0495629_0007636
568 Ga0495629_0010563
569 Ga0495629_0012634
570 Ga0495629_0063281
571 Ga0495629_0104628
572 Ga0495629_0217336
573 Ga0495638_0088367
574 Ga0495651_0086300
575 Ga0495653_0013501
576 Ga0495605_0032141
577 Ga0495662_0001873
578 Ga0495662_0005912
579 Ga0495664_0011890
580 Ga0495664_0045192
581 Ga0495664_0175933
582 Ga0495585_0128851
583 Ga0495585_0157270
584 Ga0495585_0163049
585 Ga0495594_0000230
586 Ga0495594_0102424
587 Ga0495607_0037679
588 Ga0495583_0065577
589 Ga0495583_0136242
590 Ga0495606_0002627
591 Ga0495608_0011720
592 Ga0495608_0100093
593 Ga0495610_0040668
594 Ga0495616_0050976
595 Ga0495618_0099570
596 Ga0495628_0002613
597 Ga0495628_0027165
598 Ga0495630_0027518
599 Ga0495631_0037712
600 Ga0495631_0111411
601 Ga0495643_0089601
602 Ga0495644_0040596
603 Ga0495648_0042246
604 Ga0495666_0000236
605 Ga0495666_0065858
606 Ga0495666_0097705
607 Ga0495666_0140640
608 Ga0495652_0012217
609 Ga0495654_0006510
610 Ga0495640_0007731
611 Ga0495640_0029848
612 Ga0495586_0017969
613 Ga0495586_0053177
614 Ga0495587_0001940
615 Ga0495587_0187828
616 Ga0495609_0012324
617 Ga0495645_0016142
618 Ga0495645_0021098
619 Ga0495645_0089032
620 Ga0495645_0096296
621 Ga0495622_0001355
622 Ga0495622_0185822
623 Ga0495633_0017984
624 Ga0495667_0001508
625 Ga0495667_0145571
626 Ga0495668_0084384
627 Ga0495634_0009843
628 Ga0495634_0010382
629 Ga0495634_0031147
630 Ga0495611_0018196
631 Ga0495611_0036313
632 Ga0495625_0007913
633 Ga0495625_0032665
634 Ga0495625_0059339
635 Ga0495625_0206022
636 Ga0495635_0006804
637 Ga0495635_0072996
638 Ga0495661_0032917
639 Ga0495588_0016591
640 Ga0495588_0033317
641 Ga0495588_0086119
642 Ga0495657_0017535
643 Ga0495657_0018267
644 Ga0495657_0160826
645 Ga0495599_0002709
646 Ga0495623_0011026
647 Ga0495623_0119043
648 Ga0495646_0003333
649 Ga0495646_0063727
650 Ga0495658_0160148
651 Ga0495613_0000765
652 Ga0495613_0002591
653 Ga0495613_0005919
654 Ga0495613_0007943
655 Ga0495613_0290931
656 Ga0495624_0006726
657 Ga0495624_0050098
658 Ga0495671_0003990
659 Ga0495671_0097970
660 Ga0495649_0078916
661 Ga0495589_0006194
662 Ga0495589_0034881
663 Ga0495600_0009972
664 Ga0495600_0063391
665 Ga0495600_0064132
666 Ga0495660_0102343
667 Ga0495660_0119476
668 Ga0495581_0006860
669 Ga0495581_0025211
670 Ga0495581_0040079
671 Ga0495604_0004135
672 Ga0495604_0004664
673 Ga0495604_0005785
674 Ga0495604_0048351
675 Ga0495604_0200763
676 Ga0495636_0010762
677 Ga0495636_0094166
678 Ga0495636_0159182
679 Ga0495676_0002298
680 Ga0495676_0004244
681 Ga0495676_0016915
682 Ga0495676_0109743
683 Ga0495676_0156134
684 Ga0495676_0225186
685 Ga0495676_0327721
686 Ga0495680_0007785
687 Ga0495683_0092593
688 Ga0495687_002091
689 Ga0495675_0011932
690 Ga0495675_0014091
691 Ga0495675_0020119
692 Ga0495685_003281
693 Ga0495685_012245
694 Ga0495681_0006593
695 Ga0495681_0076166
696 Ga0495684_0060826
697 Ga0495684_0118194
698 Ga0495686_0062079
699 Ga0495593_0000936
700 Ga0495602_0026061
701 Ga0495602_0147560
702 Ga0495614_0001871
703 Ga0495614_0001978
704 Ga0495614_0003844
705 Ga0501031_0004872
706 Ga0501031_0071030
707 Ga0501031_0107195
708 Ga0501032_0004038
709 Ga0501032_0249564
710 Ga0501033_0079490
711 Ga0501033_0169085
712 Ga0501034_0009173
713 Ga0501034_0011319
714 Ga0501034_0012032
715 Ga0501034_0012296
716 Ga0501034_0070535
717 Ga0501034_0286235
718 Ga0501034_0438425
719 Ga0501036_0012922
720 Ga0501036_0021151
721 Ga0501036_0037301
722 Ga0501036_0047012
723 Ga0501036_0062090
724 Ga0501036_0068947
725 Ga0501036_0329997
726 Ga0501037_0051286
727 Ga0501037_0075522
728 Ga0501037_0089510
729 Ga0501038_0000303
730 Ga0501038_0051643
731 Ga0501038_0055184
732 Ga0501038_0060622
733 Ga0501038_0136704
734 Ga0501039_0008174
735 Ga0501039_0107212
736 Ga0501040_0106436
737 Ga0501041_0011292
738 Ga0501042_0008580
739 Ga0501042_0018153
740 Ga0501043_0001902
741 Ga0501043_0007376
742 Ga0501043_0008745
743 Ga0501043_0024306
744 Ga0501043_0132756
745 Ga0501046_0045271
746 Ga0501047_0000093
747 Ga0501047_0010293
748 Ga0501047_0107266
749 Ga0501047_0138076
750 Ga0501047_0274295
751 Ga0501047_0277430
752 Ga0501047_0370796
753 Ga0501048_0003194
754 Ga0501048_0066992
755 Ga0501067_0027872
756 Ga0501068_0001002
757 Ga0501068_0153769
758 Ga0501069_0009567
759 Ga0501070_0001534
760 Ga0501070_0039851
761 Ga0501070_0275642
762 Ga0501070_0349049
763 Ga0501071_0009680
764 Ga0501072_0045217
765 Ga0501073_0058412
766 Ga0501076_0095725
767 Ga0501077_0014483
768 Ga0501079_0027357
769 Ga0501080_0030750
770 Ga0501080_0370926
771 Ga0501083_0005618
772 Ga0501035_0004849
773 Ga0501035_0014568
774 Ga0501035_0036477
775 Ga0501035_0048470
776 Ga0501035_0087297
777 Ga0501035_0226993
778 Ga0501044_0025955
779 Ga0501044_0075595
780 Ga0501044_0076356
781 Ga0501044_0077674
782 Ga0501044_0105840
783 Ga0501044_0201261
784 Ga0501044_0398786
785 Ga0501044_0407307
786 Ga0501044_0441722
787 Ga0501045_0014780
788 Ga0501045_0119356
789 Ga0501045_0176027
790 nmdc:mga03n38_75874_c1
791 nmdc:mga0yw44_74985_c1
792 nmdc:mga07m45_172192_c1
793 Ga0495601_0012255
794 Ga0500610_0180147
795 Ga0495655_0027645
796 Ga0500640_001995
797 Ga0500560_002092
798 Ga0500560_071378
799 Ga0500572_003963
800 Ga0500573_0013500
801 Ga0500573_0125796
802 Ga0500624_023015
803 Ga0501084_0062443
804 Ga0501082_0023770
805 Ga0466962_0005261
806 Ga0530510_0044251
807 2954385913
808 2554257374
809 2585300306
810 2585310645
811 2585314412
812 2616700213
813 2616905270
814 2643762999
815 2643899945
816 2643947763
817 2644015190
818 2644175355
819 2644263014
820 2644390803
821 2644405832
822 2644433628
823 2644443232
824 2644464143
825 2644626957
826 2784588885
827 2785343002
828 2785369825
829 2786670914
830 2793983509
831 2804846468
832 2808842329
833 2808920853
834 2809232501
835 2811849328
836 2812357786
837 2812480259
838 2819741643
839 2852637089
840 2862183411
841 2862285947
842 2862291273
843 2862508000
844 2862578964
845 2863404264
846 2867347762
847 2873155450
848 2875395385
849 2877680814
850 2912719624
851 2912731312
852 2912761091
853 2918505293
854 2935390939
855 2946049702
856 2946068080
857 2946076182
858 2947228858
859 2954006676
860 2954677240
861 2954686915
862 2954696564
863 2954705660
864 2954715924
865 2954725863
866 2954735935
867 2954744801
868 2954754798
869 2954763786
870 2990048984
871 2990065663
872 2990088509
873 2995468978
874 2997454699
875 3006328425
876 3006399761
877 3006493775
878 3006499276
879 8008487055
880 8008566955
881 8008578628
882 8023629422
883 8025413649
884 8025478864
885 8025525184
886 8025536369
887 8047897319
888 8048128233
889 8048361624
890 8048374307
891 8048383916
892 8048412650
893 8054162972
894 8056451908
895 8056672377
896 8056833381

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01259

SAICAR_synt

SAICAR synthetase

14

259

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6yya-assembly1.cif.gz_A crystal structure of saicar synthetase (purc) from mycobacterium abscessus in complex with inhibitor 0.9439 16 297
6yyb-assembly1.cif.gz_A crystal structure of saicar synthetase (purc) from mycobacterium abscessus in complex with inhibitor 0.9417 16 297
6z0r-assembly1.cif.gz_A crystal structure of saicar synthetase (purc) from mycobacterium abscessus in complex with fragment 1 0.9406 16 297
3r9r-assembly1.cif.gz_A structure of a phosphoribosylaminoimidazole-succinocarboxamide synthase from mycobacterium abscessus atcc 19977 / dsm 44196 0.9401 16 297
6yya-assembly1.cif.gz_A crystal structure of saicar synthetase (purc) from mycobacterium abscessus in complex with inhibitor 0.8972 16 297
ID Description Score Start End Superfamily
3r9rA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9762 105 246 3.30.470.20
1obgA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9653 104 246 3.30.470.20
3r9rA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9499 105 246 3.30.470.20
1obgA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9397 104 246 3.30.470.20
af_P38025_185_330_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.913 106 239 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A3S4W3U4-F1-model_v4 deleted 0.9971 99 208
AF-A0A1C4TFX6-F1-model_v4 deleted 0.9932 1 299
AF-A0A4D4L9N7-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.9918 136 299 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A0K8Q882-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.9915 100 299 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-T1CG79-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.9909 94 245 GO:0004639
GO:0005524
GO:0005737
GO:0006189

Map