F446216

General Info

Members Datasets Scaffolds Average Seq Length
448 282 424 135

Family's Representative Sequence

Representative Sequence 3300042008|Ga0439450_083305|Ga0439450_083305_187_669
Length 160
Sequence MSQPDLSRAEHYFLKDRIMFKSTRGASPFILSLMLAAGPTAQAQTHVAPPGPAVKALMNKALEDYPGKEVLMLTVEFPPGAVDPLHRHDAHGFVYVLEGSIVMGVKGGKEQTLGPGQTFYEGPHDVHTVGRNASKTHPAKFVVFLLKDKAKPAVIPVKQP

Samples

Sample ID Description Type Environment
1 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
2 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
3 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
4 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
5 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
6 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
7 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
8 2643221645 Massilia sp. Root351 Isolate Unclassified
9 2643221664 Massilia sp. Root418 Isolate Unclassified
10 2738541280 Massilia sp. GV090 Isolate Unclassified
11 2738541300 Massilia sp. GV016 Isolate Unclassified
12 2738543018 Massilia sp. GV045 Isolate Unclassified
13 2738543030 Massilia sp. GV097 Isolate Unclassified
14 2818991446 Variovorax sp. 1180 Isolate Unclassified
15 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
16 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
17 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
18 2928070936 Variovorax gossypii 1167 Isolate Unclassified
19 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
20 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
21 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
22 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
23 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
24 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
25 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
26 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
27 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
28 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
29 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
30 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
31 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
32 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
33 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
34 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
35 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
36 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
37 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
38 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
39 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
40 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
41 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
42 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
43 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
44 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
45 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
46 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
47 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
48 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
49 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
50 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
51 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
52 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
53 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
54 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
55 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
56 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
57 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
58 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
92 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
93 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
99 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
102 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
150 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
151 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
152 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
153 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
154 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
155 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
156 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
157 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
158 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
159 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
160 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
161 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
162 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
163 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
164 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
165 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
166 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
167 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
168 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
171 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
182 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
183 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
184 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
185 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
186 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
187 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
188 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
189 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
190 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
194 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
195 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
200 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
201 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
202 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
203 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
204 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
207 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
208 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
209 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
210 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
213 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
214 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
215 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
216 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
217 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
218 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
219 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
220 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
221 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
222 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
223 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
234 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
235 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
236 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
237 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
238 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
239 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
242 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
243 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
244 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
248 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
249 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
250 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
251 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
252 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
253 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
254 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
255 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
256 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
257 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
268 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
269 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
270 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
271 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
272 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
273 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
274 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
275 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
276 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
277 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
278 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
279 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
280 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
281 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
282 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.64
Metatranscriptomes 0
Isolates 5.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.79
Nodule 0.67
Rhizoplane 1.34
Rhizosphere 60.49
Stem 0
Stem Tuber 0
Unclassified 8.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10128070 3300001979 Bacteria 634
2 JGI24737J22298_10103228 3300001990 Unclassified 845
3 JGI25150J39212_1007397 3300002774 Bacteria 2209
4 JGI25159J45721_1013549 3300002987 Bacteria 1880
5 JGI25151J46595_10000259 3300003187 Bacteria 61846
6 JGI25151J46595_10003556 3300003187 Bacteria 8554
7 JGI25151J46595_10004021 3300003187 Bacteria 7898
8 JGI25151J46595_10123165 3300003187 Bacteria 657
9 JGI25165J46597_1001765 3300003214 Bacteria 9411
10 JGI25153J46596_10000895 3300003215 Bacteria 18133
11 JGI25153J46596_10045260 3300003215 Bacteria 1315
12 rootH1_10003435 3300003316 Bacteria 18703
13 rootH1_10068183 3300003316 Bacteria 4841
14 rootH2_10008583 3300003320 Bacteria 1313
15 rootH2_10026308 3300003320 Bacteria 15258
16 rootH2_10058159 3300003320 Bacteria 5398
17 rootH1_10011523 3300003323 Bacteria 7927
18 rootH1_10178442 3300003323 Bacteria 1620
19 JGI25160J50197_1024980 3300003354 Bacteria 1682
20 JGI25161J50226_1001652 3300003374 Bacteria 6418
21 Ga0055533_1000456 3300003756 Bacteria 15554
22 Ga0055533_1001299 3300003756 Bacteria 6785
23 Ga0055532_1000013 3300003758 Bacteria 380677
24 Ga0055532_1020356 3300003758 Bacteria 692
25 Ga0055527_1000010 3300003760 Bacteria 380677
26 Ga0055527_1005637 3300003760 Bacteria 1615
27 Ga0055535_1000010 3300003761 Bacteria 380677
28 Ga0055535_1000236 3300003761 Bacteria 58205
29 Ga0055542_1000016 3300003762 Bacteria 380677
30 Ga0055542_1000028 3300003762 Bacteria 251458
31 Ga0055529_1000012 3300003763 Bacteria 380677
32 Ga0055526_1000109 3300003771 Bacteria 72192
33 Ga0055526_1000696 3300003771 Bacteria 25648
34 Ga0055526_1016866 3300003771 Bacteria 2826
35 Ga0055537_1000112 3300003773 Bacteria 61846
36 Ga0055537_1000239 3300003773 Bacteria 40300
37 Ga0055537_1015552 3300003773 Bacteria 1329
38 Ga0055524_1000235 3300003775 Bacteria 58352
39 Ga0055524_1009742 3300003775 Bacteria 3880
40 Ga0055524_1022435 3300003775 Bacteria 2063
41 Ga0055536_1000069 3300003781 Bacteria 94802
42 Ga0055536_1015687 3300003781 Bacteria 2577
43 Ga0055534_1000194 3300003784 Bacteria 44359
44 Ga0055534_1000835 3300003784 Bacteria 14196
45 Ga0055534_1001373 3300003784 Bacteria 9741
46 Ga0055534_1006093 3300003784 Bacteria 3099
47 Ga0055528_1000253 3300003790 Bacteria 45221
48 Ga0055528_1000279 3300003790 Bacteria 43534
49 Ga0055528_1000683 3300003790 Bacteria 24377
50 Ga0055540_1005426 3300003792 Bacteria 5360
51 Ga0055540_1006459 3300003792 Bacteria 4648
52 Ga0055531_10000170 3300003794 Bacteria 73120
53 Ga0055543_1000234 3300004625 Bacteria 43464
54 Ga0065165_1009764 3300005262 Bacteria 4245
55 Ga0070658_10010028 3300005327 Bacteria 7608
56 Ga0070658_11112635 3300005327 Bacteria 687
57 Ga0070676_10463353 3300005328 Bacteria 893
58 Ga0070670_100066079 3300005331 Bacteria 3103
59 Ga0070666_10000007 3300005335 Bacteria 293732
60 Ga0070666_10247219 3300005335 Bacteria 1262
61 Ga0070666_10772319 3300005335 Bacteria 707
62 Ga0070661_100023840 3300005344 Bacteria 4389
63 Ga0070668_100061213 3300005347 Bacteria 2916
64 Ga0070669_100191380 3300005353 Bacteria 1605
65 Ga0070669_100224760 3300005353 Bacteria 1485
66 Ga0070675_100166669 3300005354 Bacteria 1898
67 Ga0070673_100096063 3300005364 Bacteria 2431
68 Ga0070667_100046910 3300005367 Bacteria 3635
69 Ga0070667_102139695 3300005367 Bacteria 527
70 Ga0070663_100113497 3300005455 Bacteria 2039
71 Ga0070678_101419528 3300005456 Bacteria 648
72 Ga0070662_100080930 3300005457 Bacteria 2419
73 Ga0070662_100164774 3300005457 Bacteria 1736
74 Ga0070662_100583419 3300005457 Bacteria 939
75 Ga0068853_100330486 3300005539 Bacteria 1414
76 Ga0070672_100450370 3300005543 Bacteria 1109
77 Ga0070665_100005351 3300005548 Bacteria 13260
78 Ga0068856_100003215 3300005614 Bacteria 16633
79 Ga0068852_100000770 3300005616 Bacteria 21117
80 Ga0068852_100135843 3300005616 Bacteria 2270
81 Ga0068851_10055115 3300005834 Bacteria 2025
82 Ga0068858_100425431 3300005842 Bacteria 1277
83 Ga0068860_100210915 3300005843 Bacteria 1884
84 Ga0068862_101443969 3300005844 Bacteria 692
85 Ga0075369_10578618 3300006186 Bacteria 537
86 Ga0075366_10055096 3300006195 Bacteria 2362
87 Ga0075366_10745225 3300006195 Bacteria 609
88 Ga0097621_101098702 3300006237 Bacteria 746
89 Ga0075370_10000123 3300006353 Bacteria 25631
90 Ga0075370_10122278 3300006353 Bacteria 1516
91 Ga0075370_10275477 3300006353 Bacteria 999
92 Ga0097620_100113178 3300006931 Plasmid 2777
93 Ga0105251_10063544 3300009011 Bacteria 1732
94 Ga0105240_10000115 3300009093 Bacteria 165594
95 Ga0105240_10166503 3300009093 Bacteria 2614
96 Ga0105243_10844565 3300009148 Bacteria 906
97 Ga0105237_10000529 3300009545 Bacteria 53671
98 Ga0105238_10000173 3300009551 Bacteria 70523
99 Ga0105238_10012785 3300009551 Bacteria 8470
100 Ga0105239_10000802 3300010375 Bacteria 44448
101 Ga0105239_11094224 3300010375 Bacteria 917
102 Ga0105239_11190980 3300010375 Bacteria 878
103 Ga0105246_10574037 3300011119 Bacteria 970
104 Ga0157327_1009159 3300012512 Bacteria 905
105 Ga0157370_10005852 3300013104 Bacteria 13735
106 Ga0157370_10175219 3300013104 Bacteria 1993
107 Ga0157370_10458730 3300013104 Bacteria 1171
108 Ga0157369_10088179 3300013105 Bacteria 3312
109 Ga0157374_10222149 3300013296 Bacteria 1854
110 Ga0163162_10005255 3300013306 Bacteria 12483
111 Ga0163162_10005656 3300013306 Bacteria 12075
112 Ga0157372_10373436 3300013307 Bacteria 1662
113 Ga0183368_1004 3300015687 Bacteria 1211761
114 Ga0209436_103999 3300025208 Bacteria 3730
115 Ga0209674_100011 3300025226 Bacteria 997175
116 Ga0209674_107699 3300025226 Bacteria 1336
117 Ga0209672_100002 3300025228 Bacteria 1733325
118 Ga0209672_100140 3300025228 Bacteria 67991
119 Ga0209147_100003 3300025229 Bacteria 1733325
120 Ga0209147_102171 3300025229 Bacteria 5353
121 Ga0207427_100761 3300025231 Bacteria 14667
122 Ga0209258_100042 3300025242 Bacteria 380729
123 Ga0209258_100067 3300025242 Bacteria 287603
124 Ga0207425_1000455 3300025245 Bacteria 26503
125 Ga0207425_1011315 3300025245 Bacteria 2134
126 Ga0209677_113628 3300025253 Bacteria 1148
127 Ga0209148_1000006 3300025254 Bacteria 1733325
128 Ga0209148_1000067 3300025254 Bacteria 338678
129 Ga0209148_1001138 3300025254 Bacteria 15537
130 Ga0209759_1000009 3300025256 Bacteria 446623
131 Ga0209759_1005296 3300025256 Bacteria 4564
132 Ga0209129_1000230 3300025258 Bacteria 61865
133 Ga0209233_1000033 3300025261 Bacteria 596094
134 Ga0209565_1000032 3300025263 Bacteria 316777
135 Ga0209565_1000139 3300025263 Bacteria 101579
136 Ga0209565_1000218 3300025263 Bacteria 65247
137 Ga0209565_1002678 3300025263 Bacteria 6243
138 Ga0209455_1000003 3300025272 Bacteria 1471893
139 Ga0209673_1000029 3300025273 Bacteria 351978
140 Ga0209673_1000121 3300025273 Bacteria 170539
141 Ga0209673_1030162 3300025273 Bacteria 1713
142 Ga0209673_1033618 3300025273 Bacteria 1560
143 Ga0209130_1000119 3300025284 Bacteria 128249
144 Ga0209675_1000019 3300025291 Bacteria 351950
145 Ga0209675_1001058 3300025291 Bacteria 17066
146 Ga0209675_1001139 3300025291 Bacteria 16205
147 Ga0209675_1002240 3300025291 Bacteria 10106
148 Ga0209675_1003355 3300025291 Bacteria 7667
149 Ga0209676_1003437 3300025292 Bacteria 9739
150 Ga0209676_1003799 3300025292 Bacteria 8932
151 Ga0209676_1055253 3300025292 Bacteria 1018
152 Ga0209025_1000556 3300025294 Bacteria 69393
153 Ga0209025_1002046 3300025294 Bacteria 22976
154 Ga0209025_1002209 3300025294 Bacteria 21508
155 Ga0209025_1004415 3300025294 Bacteria 12239
156 Ga0209025_1074423 3300025294 Bacteria 1186
157 Ga0209025_1112120 3300025294 Bacteria 835
158 Ga0209564_1000261 3300025295 Bacteria 112287
159 Ga0209564_1000291 3300025295 Bacteria 101831
160 Ga0209564_1000293 3300025295 Bacteria 101618
161 Ga0209758_1000286 3300025297 Bacteria 99636
162 Ga0209758_1000518 3300025297 Bacteria 61898
163 Ga0209758_1004075 3300025297 Bacteria 12559
164 Ga0209050_1003223 3300025298 Bacteria 12336
165 Ga0209256_1000058 3300025299 Bacteria 272934
166 Ga0209256_1000171 3300025299 Bacteria 129711
167 Ga0209256_1000254 3300025299 Bacteria 94801
168 Ga0209256_1000340 3300025299 Bacteria 76961
169 Ga0209256_1000490 3300025299 Bacteria 58529
170 Ga0207426_1000068 3300025302 Bacteria 335134
171 Ga0207426_1064237 3300025302 Bacteria 1044
172 Ga0209051_1001193 3300025303 Bacteria 23490
173 Ga0209051_1006832 3300025303 Bacteria 6348
174 Ga0209257_1000341 3300025304 Bacteria 97266
175 Ga0207656_10136578 3300025321 Bacteria 1153
176 Ga0207713_1077801 3300025735 Bacteria 1203
177 Ga0207682_10201025 3300025893 Bacteria 916
178 Ga0207680_10000002 3300025903 Bacteria 1018646
179 Ga0207680_10004903 3300025903 Bacteria 6370
180 Ga0207647_10027670 3300025904 Bacteria 3693
181 Ga0207647_10036168 3300025904 Bacteria 3140
182 Ga0207647_10141032 3300025904 Bacteria 1412
183 Ga0207705_10013199 3300025909 Bacteria 5963
184 Ga0207695_10000116 3300025913 Bacteria 239510
185 Ga0207695_10140913 3300025913 Bacteria 2360
186 Ga0207671_10004445 3300025914 Bacteria 13397
187 Ga0207649_10035326 3300025920 Bacteria 3003
188 Ga0207681_10333300 3300025923 Bacteria 1210
189 Ga0207681_10351643 3300025923 Bacteria 1180
190 Ga0207694_10000237 3300025924 Bacteria 52878
191 Ga0207694_10016057 3300025924 Bacteria 5649
192 Ga0207650_10941085 3300025925 Bacteria 734
193 Ga0207659_10173507 3300025926 Bacteria 1702
194 Ga0207706_10024457 3300025933 Bacteria 5415
195 Ga0207706_10199100 3300025933 Bacteria 1757
196 Ga0207706_10426362 3300025933 Bacteria 1149
197 Ga0207691_10118668 3300025940 Bacteria 2347
198 Ga0207668_10453907 3300025972 Bacteria 1094
199 Ga0207703_10206725 3300026035 Bacteria 1748
200 Ga0207639_10124468 3300026041 Bacteria 2124
201 Ga0207678_11502801 3300026067 Unclassified 594
202 Ga0207702_10002246 3300026078 Bacteria 18531
203 Ga0207683_10889809 3300026121 Bacteria 827
204 Ga0207698_10000286 3300026142 Bacteria 30582
205 Ga0207698_10409029 3300026142 Bacteria 1299
206 Ga0268266_10000004 3300028379 Bacteria 1495817
207 Ga0268266_10783907 3300028379 Bacteria 920
208 Ga0268265_11738154 3300028380 Bacteria 630
209 Ga0268264_10417074 3300028381 Bacteria 1294
210 Ga0307513_10119987 3300031456 Bacteria 2600
211 Ga0307514_10044494 3300031649 Bacteria 3478
212 Ga0307405_10898999 3300031731 Bacteria 749
213 Ga0307411_10101766 3300032005 Bacteria 2034
214 Ga0307510_10037353 3300033180 Bacteria 5389
215 Ga0395899_0149436 3300037312 Bacteria 1656
216 Ga0439436_0000235 3300041404 Bacteria 13326
217 Ga0439438_045422 3300041405 Bacteria 1130
218 Ga0439439_0025110 3300041406 Bacteria 1498
219 Ga0439447_016789 3300041407 Bacteria 2003
220 Ga0439466_0001084 3300041411 Bacteria 10556
221 Ga0439465_0000894 3300041413 Bacteria 9434
222 Ga0439431_0001667 3300041997 Bacteria 4902
223 Ga0439431_0219655 3300041997 Bacteria 558
224 Ga0439433_0000395 3300041999 Bacteria 7863
225 Ga0439442_016869 3300042002 Bacteria 1507
226 Ga0439445_0000211 3300042004 Bacteria 10671
227 Ga0439432_012865 3300042006 Bacteria 2851
228 Ga0439449_0000653 3300042007 Bacteria 13074
229 Ga0439450_083305 3300042008 Bacteria 797
230 Ga0439452_007644 3300042010 Bacteria 3303
231 Ga0439457_002407 3300042014 Bacteria 5351
232 Ga0439462_0005061 3300042015 Bacteria 3234
233 Ga0439446_0048890 3300042156 Bacteria 1260
234 Ga0439458_0003420 3300042157 Bacteria 3714
235 Ga0450909_026215 3300042185 Bacteria 879
236 Ga0439434_0012196 3300042435 Bacteria 2543
237 Ga0466959_0003304 3300045049 Bacteria 10523
238 Ga0495592_0051661 3300046454 Bacteria 3053
239 Ga0495590_0025286 3300046457 Bacteria 2088
240 Ga0495590_0051655 3300046457 Bacteria 1436
241 Ga0495629_0067961 3300046459 Bacteria 2486
242 Ga0495629_0152421 3300046459 Bacteria 1606
243 Ga0495638_0027543 3300046460 Bacteria 3678
244 Ga0495641_0014001 3300046461 Bacteria 4366
245 Ga0495653_0030921 3300046463 Bacteria 4259
246 Ga0495650_0041535 3300046471 Bacteria 1966
247 Ga0495580_0023680 3300046472 Bacteria 4503
248 Ga0495580_0825645 3300046472 Bacteria 600
249 Ga0495582_0002002 3300046473 Bacteria 11413
250 Ga0495582_0255843 3300046473 Bacteria 1004
251 Ga0495662_0037605 3300046476 Bacteria 2338
252 Ga0495664_0001108 3300046477 Bacteria 13945
253 Ga0495664_0165086 3300046477 Bacteria 1343
254 Ga0495584_0001526 3300046491 Bacteria 13771
255 Ga0495584_0010529 3300046491 Bacteria 4750
256 Ga0495585_0003402 3300046492 Bacteria 10772
257 Ga0495596_0007169 3300046500 Bacteria 5047
258 Ga0495596_0357858 3300046500 Bacteria 568
259 Ga0495607_0016359 3300046501 Bacteria 4786
260 Ga0495583_0003908 3300046506 Bacteria 11030
261 Ga0495606_0009661 3300046507 Bacteria 8122
262 Ga0495606_0022610 3300046507 Bacteria 4575
263 Ga0495608_0031768 3300046511 Bacteria 3568
264 Ga0495610_0013721 3300046512 Bacteria 4797
265 Ga0495610_0034394 3300046512 Bacteria 2611
266 Ga0495616_0020832 3300046513 Bacteria 3561
267 Ga0495618_0003750 3300046514 Bacteria 9405
268 Ga0495628_0007853 3300046516 Bacteria 9198
269 Ga0495628_0024280 3300046516 Bacteria 4963
270 Ga0495628_0065020 3300046516 Bacteria 2854
271 Ga0495628_0172698 3300046516 Bacteria 1638
272 Ga0495630_0013150 3300046517 Bacteria 6017
273 Ga0495630_0016031 3300046517 Bacteria 5476
274 Ga0495643_0127005 3300046522 Unclassified 1283
275 Ga0495643_0181563 3300046522 Bacteria 1022
276 Ga0495648_0014137 3300046524 Bacteria 5861
277 Ga0495648_0050343 3300046524 Bacteria 2546
278 Ga0495666_0000778 3300046526 Bacteria 14730
279 Ga0495666_0025462 3300046526 Bacteria 2921
280 Ga0495652_0007621 3300046529 Bacteria 9972
281 Ga0495652_0136311 3300046529 Bacteria 1936
282 Ga0495654_0008539 3300046530 Bacteria 5650
283 Ga0495665_0072488 3300046531 Bacteria 1813
284 Ga0495640_0018703 3300046533 Bacteria 5129
285 Ga0495640_0030692 3300046533 Bacteria 3845
286 Ga0495586_0052574 3300046535 Bacteria 2205
287 Ga0495586_0316456 3300046535 Bacteria 895
288 Ga0495587_0001001 3300046536 Bacteria 18582
289 Ga0495587_0077691 3300046536 Bacteria 1927
290 Ga0495609_0000128 3300046538 Bacteria 81687
291 Ga0495609_0008463 3300046538 Bacteria 5039
292 Ga0495609_0023773 3300046538 Bacteria 2814
293 Ga0495621_0019911 3300046539 Bacteria 2196
294 Ga0495597_0079076 3300046542 Bacteria 1408
295 Ga0495597_0168176 3300046542 Bacteria 891
296 Ga0495645_0011970 3300046543 Bacteria 6113
297 Ga0495622_0248722 3300046557 Bacteria 782
298 Ga0495633_0004074 3300046558 Bacteria 9437
299 Ga0495668_0003908 3300046616 Bacteria 10886
300 Ga0495668_0011540 3300046616 Bacteria 5285
301 Ga0495668_0315507 3300046616 Bacteria 857
302 Ga0495634_0010602 3300046642 Bacteria 6748
303 Ga0495634_0019024 3300046642 Bacteria 4883
304 Ga0495625_0002228 3300046660 Bacteria 21425
305 Ga0495625_0006335 3300046660 Bacteria 10573
306 Ga0495625_0019875 3300046660 Bacteria 5198
307 Ga0495625_0106184 3300046660 Bacteria 1923
308 Ga0495625_0288108 3300046660 Bacteria 1054
309 Ga0495635_0038035 3300046663 Bacteria 3331
310 Ga0495659_0000087 3300046664 Bacteria 40627
311 Ga0495659_0005897 3300046664 Bacteria 3870
312 Ga0495661_0004101 3300046665 Bacteria 10611
313 Ga0495661_0033985 3300046665 Bacteria 3212
314 Ga0495661_0191432 3300046665 Bacteria 1077
315 Ga0495657_0031869 3300046675 Bacteria 3682
316 Ga0495599_0005104 3300046678 Bacteria 7821
317 Ga0495623_0044549 3300046679 Bacteria 2818
318 Ga0495623_0065705 3300046679 Bacteria 2267
319 Ga0495623_0345103 3300046679 Bacteria 812
320 Ga0495646_0003343 3300046680 Bacteria 9971
321 Ga0495646_0063598 3300046680 Bacteria 2190
322 Ga0495669_0000193 3300046684 Bacteria 37757
323 Ga0495613_0060220 3300046689 Bacteria 2781
324 Ga0495613_0081526 3300046689 Bacteria 2350
325 Ga0495624_0028438 3300046690 Bacteria 3653
326 Ga0495624_0029293 3300046690 Bacteria 3592
327 Ga0495624_0052807 3300046690 Bacteria 2567
328 Ga0495671_0001581 3300046692 Bacteria 15076
329 Ga0495671_0062620 3300046692 Bacteria 1833
330 Ga0495649_0013459 3300046694 Bacteria 4719
331 Ga0495649_0464517 3300046694 Bacteria 631
332 Ga0495589_0000460 3300046794 Bacteria 29846
333 Ga0495600_0009583 3300046809 Bacteria 5988
334 Ga0495600_0082861 3300046809 Bacteria 2093
335 Ga0495600_0213088 3300046809 Bacteria 1237
336 Ga0495660_0001071 3300046810 Bacteria 19711
337 Ga0495660_0033578 3300046810 Bacteria 2876
338 Ga0495581_0002933 3300047315 Bacteria 9756
339 Ga0495581_0051693 3300047315 Bacteria 2373
340 Ga0495604_0017031 3300047317 Bacteria 5812
341 Ga0495604_0023468 3300047317 Bacteria 4921
342 Ga0495604_0093930 3300047317 Bacteria 2218
343 Ga0495636_0005133 3300047318 Bacteria 5139
344 Ga0495636_0071941 3300047318 Bacteria 1477
345 Ga0495636_0220876 3300047318 Bacteria 870
346 Ga0495636_0387136 3300047318 Bacteria 664
347 Ga0495674_0328017 3300047319 Bacteria 1245
348 Ga0495672_0011713 3300047320 Bacteria 6167
349 Ga0495676_0048088 3300047321 Bacteria 3442
350 Ga0495676_0066278 3300047321 Bacteria 2799
351 Ga0495680_0003934 3300047322 Bacteria 14369
352 Ga0495680_0013730 3300047322 Bacteria 7049
353 Ga0495683_0001282 3300047323 Bacteria 17017
354 Ga0495683_0064384 3300047323 Bacteria 1810
355 Ga0495683_0071214 3300047323 Bacteria 1706
356 Ga0495687_113001 3300047443 Bacteria 994
357 Ga0495675_0005193 3300047444 Bacteria 7928
358 Ga0495675_0085560 3300047444 Bacteria 1982
359 Ga0495675_0142694 3300047444 Bacteria 1483
360 Ga0495677_0045638 3300047445 Bacteria 1607
361 Ga0495679_001011 3300047446 Bacteria 17278
362 Ga0495685_001940 3300047447 Bacteria 6405
363 Ga0495681_0003830 3300047470 Bacteria 10407
364 Ga0495681_0102792 3300047470 Bacteria 1247
365 Ga0495681_0124926 3300047470 Bacteria 1100
366 Ga0495684_0025796 3300047471 Bacteria 4516
367 Ga0495686_0000045 3300047472 Bacteria 284761
368 Ga0495686_0010987 3300047472 Bacteria 6405
369 Ga0495593_0017899 3300047673 Bacteria 3989
370 Ga0495593_0124667 3300047673 Bacteria 1309
371 Ga0495602_0034166 3300048088 Bacteria 4761
372 Ga0495602_0061753 3300048088 Bacteria 3255
373 Ga0495602_0327807 3300048088 Bacteria 1111
374 Ga0495614_0030147 3300048089 Bacteria 2333
375 Ga0495614_0209102 3300048089 Bacteria 884
376 Ga0495614_0296497 3300048089 Bacteria 746
377 Ga0496101_1592913 3300048904 Bacteria 507
378 Ga0496110_1067291 3300048913 Bacteria 715
379 Ga0496111_0631417 3300048914 Bacteria 783
380 Ga0496116_0097495 3300048919 Bacteria 1767
381 Ga0496117_0027873 3300048920 Bacteria 4386
382 Ga0496117_0118559 3300048920 Bacteria 1631
383 Ga0496119_0347121 3300048922 Bacteria 720
384 Ga0496121_0000738 3300048924 Bacteria 60238
385 Ga0496121_0021809 3300048924 Bacteria 6255
386 Ga0496121_0049562 3300048924 Bacteria 3560
387 Ga0496121_0077024 3300048924 Bacteria 2657
388 Ga0496122_0105321 3300048925 Bacteria 1871
389 Ga0496122_0182908 3300048925 Bacteria 1248
390 Ga0496122_0222981 3300048925 Bacteria 1080
391 Ga0496123_0027460 3300048926 Bacteria 4239
392 Ga0496124_0145288 3300048927 Bacteria 1867
393 Ga0496125_0069554 3300048928 Bacteria 2762
394 Ga0496125_0231328 3300048928 Bacteria 1182
395 Ga0496126_0165987 3300048929 Bacteria 1884
396 Ga0501031_0357966 3300049568 Unclassified 944
397 Ga0501034_0000067 3300049571 Bacteria 184398
398 Ga0501037_0076405 3300049573 Bacteria 2432
399 Ga0501039_0290940 3300049575 Bacteria 1284
400 Ga0501043_0071930 3300049579 Bacteria 2716
401 Ga0501046_0378783 3300049580 Bacteria 1024
402 Ga0501047_0226035 3300049581 Bacteria 1726
403 Ga0501235_069670 3300049669 Bacteria 831
404 Ga0501035_0023214 3300049822 Bacteria 5690
405 Ga0501044_0029297 3300049823 Bacteria 5805
406 Ga0501044_0116503 3300049823 Bacteria 2677
407 nmdc:mga0k408_43730_c1 3300050493 Bacteria 2582
408 nmdc:mga0k408_782798_c1 3300050493 Bacteria 556
409 nmdc:mga07m45_216849_c1 3300050496 Bacteria 1113
410 nmdc:mga07m45_2829_c1 3300050496 Bacteria 8208
411 nmdc:mga07m45_97175_c1 3300050496 Bacteria 1690
412 nmdc:mga0sz30_207565_c1 3300050516 Bacteria 870
413 nmdc:mga0sz30_455412_c1 3300050516 Bacteria 574
414 Ga0500644_0010285 3300053088 Bacteria 2528
415 Ga0500646_0015820 3300053090 Bacteria 1967
416 Ga0500594_0211994 3300053118 Bacteria 638
417 Ga0500595_000798 3300053119 Bacteria 18260
418 Ga0500607_033532 3300053121 Bacteria 2813
419 Ga0500642_0235031 3300053130 Unclassified 846
420 Ga0500658_0000038 3300053134 Bacteria 84273
421 Ga0500577_0193796 3300053142 Bacteria 875
422 Ga0500616_0087362 3300053153 Bacteria 1552
423 Ga0500619_011169 3300053154 Bacteria 2299
424 Ga0500636_0001274 3300053177 Bacteria 13676

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003187 JGI25151J46595_10004021 JGI25151J46595_100040212 126
2 3300003771 Ga0055526_1016866 Ga0055526_10168663 126
3 3300003781 Ga0055536_1000069 Ga0055536_100006916 126
4 3300003784 Ga0055534_1001373 Ga0055534_10013734 126
5 3300013306 Ga0163162_10005656 Ga0163162_1000565612 127
6 3300046516 Ga0495628_0007853 Ga0495628_0007853_2081_2473 127
7 3300047320 Ga0495672_0011713 Ga0495672_0011713_1141_1527 127
8 3300047472 Ga0495686_0000045 Ga0495686_0000045_225522_225914 127
9 iso_pu_bacteria 2513237150 2513956897 128
10 iso_pu_bacteria 2513237165 2514043342 128
11 iso_pu_bacteria 2643221645 2644250371 128
12 iso_pu_bacteria 2643221664 2644357635 128
13 iso_pu_bacteria 2738541280 2738741664 128
14 iso_pu_bacteria 2738541300 2738844041 128
15 iso_pu_bacteria 2738543018 2739274395 128
16 iso_pu_bacteria 2738543030 2739343439 128
17 iso_pu_bacteria 644736347 644747717 128
18 iso_pu_bacteria 8003014200 8003015686 128
19 iso_pu_bacteria 2834641062 2834644515 129
20 3300049568 Ga0501031_0357966 Ga0501031_0357966_471_878 130
21 3300003214 JGI25165J46597_1001765 JGI25165J46597_10017657 131
22 3300003756 Ga0055533_1000456 Ga0055533_100045616 131
23 3300003756 Ga0055533_1001299 Ga0055533_10012997 131
24 3300003758 Ga0055532_1000013 Ga0055532_100001316 131
25 3300003760 Ga0055527_1000010 Ga0055527_1000010352 131
26 3300003761 Ga0055535_1000010 Ga0055535_100001016 131
27 3300003762 Ga0055542_1000016 Ga0055542_100001616 131
28 3300003763 Ga0055529_1000012 Ga0055529_100001216 131
29 3300009011 Ga0105251_10063544 Ga0105251_100635442 131
30 3300009148 Ga0105243_10844565 Ga0105243_108445651 131
31 3300013105 Ga0157369_10088179 Ga0157369_100881793 131
32 3300025226 Ga0209674_100011 Ga0209674_100011348 131
33 3300025228 Ga0209672_100002 Ga0209672_100002347 131
34 3300025229 Ga0209147_100003 Ga0209147_100003347 131
35 3300025231 Ga0207427_100761 Ga0207427_1007618 131
36 3300025242 Ga0209258_100042 Ga0209258_10004213 131
37 3300025253 Ga0209677_113628 Ga0209677_1136282 131
38 3300025254 Ga0209148_1000006 Ga0209148_1000006347 131
39 3300025256 Ga0209759_1000009 Ga0209759_1000009370 131
40 3300025261 Ga0209233_1000033 Ga0209233_1000033198 131
41 3300025272 Ga0209455_1000003 Ga0209455_1000003347 131
42 3300025735 Ga0207713_1077801 Ga0207713_10778012 131
43 3300025904 Ga0207647_10141032 Ga0207647_101410322 131
44 3300046459 Ga0495629_0152421 Ga0495629_0152421_15_410 131
45 3300046472 Ga0495580_0825645 Ga0495580_0825645_109_504 131
46 3300046473 Ga0495582_0255843 Ga0495582_0255843_534_929 131
47 3300046477 Ga0495664_0165086 Ga0495664_0165086_876_1271 131
48 3300046491 Ga0495584_0001526 Ga0495584_0001526_8468_8866 131
49 3300046492 Ga0495585_0003402 Ga0495585_0003402_5104_5502 131
50 3300046500 Ga0495596_0007169 Ga0495596_0007169_2729_3127 131
51 3300046500 Ga0495596_0357858 Ga0495596_0357858_58_453 131
52 3300046507 Ga0495606_0009661 Ga0495606_0009661_1833_2231 131
53 3300046511 Ga0495608_0031768 Ga0495608_0031768_642_1037 131
54 3300046514 Ga0495618_0003750 Ga0495618_0003750_1058_1453 131
55 3300046516 Ga0495628_0065020 Ga0495628_0065020_1633_2028 131
56 3300046516 Ga0495628_0172698 Ga0495628_0172698_285_680 131
57 3300046517 Ga0495630_0016031 Ga0495630_0016031_3037_3432 131
58 3300046524 Ga0495648_0050343 Ga0495648_0050343_855_1262 131
59 3300046526 Ga0495666_0025462 Ga0495666_0025462_1330_1725 131
60 3300046529 Ga0495652_0007621 Ga0495652_0007621_1705_2100 131
61 3300046531 Ga0495665_0072488 Ga0495665_0072488_1329_1724 131
62 3300046533 Ga0495640_0018703 Ga0495640_0018703_4048_4443 131
63 3300046535 Ga0495586_0316456 Ga0495586_0316456_206_601 131
64 3300046538 Ga0495609_0023773 Ga0495609_0023773_1874_2272 131
65 3300046539 Ga0495621_0019911 Ga0495621_0019911_144_539 131
66 3300046558 Ga0495633_0004074 Ga0495633_0004074_8317_8715 131
67 3300046616 Ga0495668_0003908 Ga0495668_0003908_1413_1811 131
68 3300046642 Ga0495634_0019024 Ga0495634_0019024_3162_3557 131
69 3300046663 Ga0495635_0038035 Ga0495635_0038035_614_1009 131
70 3300046675 Ga0495657_0031869 Ga0495657_0031869_447_842 131
71 3300046679 Ga0495623_0065705 Ga0495623_0065705_841_1236 131
72 3300046680 Ga0495646_0063598 Ga0495646_0063598_637_1032 131
73 3300046690 Ga0495624_0028438 Ga0495624_0028438_590_985 131
74 3300046809 Ga0495600_0082861 Ga0495600_0082861_454_849 131
75 3300047315 Ga0495581_0051693 Ga0495581_0051693_641_1036 131
76 3300047317 Ga0495604_0017031 Ga0495604_0017031_4791_5186 131
77 3300047317 Ga0495604_0093930 Ga0495604_0093930_497_892 131
78 3300047319 Ga0495674_0328017 Ga0495674_0328017_778_1173 131
79 3300047321 Ga0495676_0048088 Ga0495676_0048088_2879_3274 131
80 3300047322 Ga0495680_0013730 Ga0495680_0013730_3081_3476 131
81 3300047323 Ga0495683_0001282 Ga0495683_0001282_4975_5373 131
82 3300047323 Ga0495683_0064384 Ga0495683_0064384_802_1197 131
83 3300047444 Ga0495675_0085560 Ga0495675_0085560_453_848 131
84 3300047444 Ga0495675_0142694 Ga0495675_0142694_624_1019 131
85 3300047470 Ga0495681_0102792 Ga0495681_0102792_213_611 131
86 3300047673 Ga0495593_0124667 Ga0495593_0124667_137_532 131
87 3300048088 Ga0495602_0061753 Ga0495602_0061753_2440_2835 131
88 3300048088 Ga0495602_0327807 Ga0495602_0327807_564_959 131
89 3300048089 Ga0495614_0209102 Ga0495614_0209102_28_423 131
90 3300048089 Ga0495614_0296497 Ga0495614_0296497_243_638 131
91 3300048913 Ga0496110_1067291 Ga0496110_1067291_284_691 131
92 3300048925 Ga0496122_0222981 Ga0496122_0222981_12_407 131
93 3300053118 Ga0500594_0211994 Ga0500594_0211994_211_618 131
94 iso_pu_bacteria 2593339238 2595446472 131
95 iso_pu_bacteria 2818991446 2819598747 131
96 iso_pu_bacteria 2945909444 2945910860 131
97 iso_pu_bacteria 2945972063 2945976435 131
98 iso_pu_bacteria 2945984333 2945986902 131
99 3300003794 Ga0055531_10000170 Ga0055531_1000017056 132
100 3300005327 Ga0070658_11112635 Ga0070658_111126352 132
101 3300025273 Ga0209673_1033618 Ga0209673_10336182 132
102 3300025302 Ga0207426_1064237 Ga0207426_10642372 132
103 3300025304 Ga0209257_1000341 Ga0209257_100034133 132
104 3300046507 Ga0495606_0022610 Ga0495606_0022610_2461_2871 132
105 3300046530 Ga0495654_0008539 Ga0495654_0008539_4408_4806 132
106 3300046538 Ga0495609_0008463 Ga0495609_0008463_1153_1563 132
107 3300046542 Ga0495597_0079076 Ga0495597_0079076_64_462 132
108 3300046616 Ga0495668_0315507 Ga0495668_0315507_416_814 132
109 3300046660 Ga0495625_0006335 Ga0495625_0006335_3834_4232 132
110 3300046660 Ga0495625_0106184 Ga0495625_0106184_1148_1558 132
111 3300046664 Ga0495659_0000087 Ga0495659_0000087_14314_14712 132
112 3300046665 Ga0495661_0191432 Ga0495661_0191432_173_571 132
113 3300046692 Ga0495671_0001581 Ga0495671_0001581_333_731 132
114 3300046810 Ga0495660_0001071 Ga0495660_0001071_4762_5172 132
115 3300047318 Ga0495636_0071941 Ga0495636_0071941_13_423 132
116 3300047318 Ga0495636_0220876 Ga0495636_0220876_355_753 132
117 3300047472 Ga0495686_0010987 Ga0495686_0010987_2506_2916 132
118 3300049573 Ga0501037_0076405 Ga0501037_0076405_261_668 132
119 3300049575 Ga0501039_0290940 Ga0501039_0290940_538_945 132
120 3300049579 Ga0501043_0071930 Ga0501043_0071930_1117_1524 132
121 3300049669 Ga0501235_069670 Ga0501235_069670_159_557 132
122 3300049823 Ga0501044_0116503 Ga0501044_0116503_1023_1430 132
123 iso_pu_bacteria 2599185214 2599622867 132
124 iso_pu_bacteria 2599185226 2599671346 132
125 iso_pu_bacteria 2599185227 2599679617 132
126 iso_pu_bacteria 2599185229 2599691633 132
127 iso_pu_bacteria 2885192300 2885195058 132
128 iso_pu_bacteria 2919462493 2919467380 132
129 iso_pu_bacteria 2928070936 2928074657 132
130 iso_pu_bacteria 2928084124 2928089864 132
131 3300002774 JGI25150J39212_1007397 JGI25150J39212_10073972 133
132 3300003187 JGI25151J46595_10003556 JGI25151J46595_100035565 133
133 3300003187 JGI25151J46595_10123165 JGI25151J46595_101231652 133
134 3300003215 JGI25153J46596_10045260 JGI25153J46596_100452603 133
135 3300003773 Ga0055537_1015552 Ga0055537_10155522 133
136 3300003775 Ga0055524_1022435 Ga0055524_10224352 133
137 3300003784 Ga0055534_1006093 Ga0055534_10060932 133
138 3300005327 Ga0070658_10010028 Ga0070658_100100283 133
139 3300005335 Ga0070666_10000007 Ga0070666_1000000732 133
140 3300005335 Ga0070666_10772319 Ga0070666_107723191 133
141 3300005344 Ga0070661_100023840 Ga0070661_1000238405 133
142 3300005347 Ga0070668_100061213 Ga0070668_1000612134 133
143 3300005353 Ga0070669_100224760 Ga0070669_1002247602 133
144 3300005367 Ga0070667_100046910 Ga0070667_1000469102 133
145 3300005456 Ga0070678_101419528 Ga0070678_1014195282 133
146 3300005548 Ga0070665_100005351 Ga0070665_10000535110 133
147 3300005842 Ga0068858_100425431 Ga0068858_1004254312 133
148 3300005843 Ga0068860_100210915 Ga0068860_1002109152 133
149 3300006237 Ga0097621_101098702 Ga0097621_1010987022 133
150 3300009093 Ga0105240_10000115 Ga0105240_10000115143 133
151 3300009551 Ga0105238_10000173 Ga0105238_1000017333 133
152 3300010375 Ga0105239_11094224 Ga0105239_110942242 133
153 3300013296 Ga0157374_10222149 Ga0157374_102221492 133
154 3300013306 Ga0163162_10005255 Ga0163162_100052557 133
155 3300015687 Ga0183368_1004 Ga0183368_1004644 133
156 3300025226 Ga0209674_107699 Ga0209674_1076992 133
157 3300025245 Ga0207425_1000455 Ga0207425_100045518 133
158 3300025256 Ga0209759_1005296 Ga0209759_10052964 133
159 3300025263 Ga0209565_1000139 Ga0209565_100013927 133
160 3300025263 Ga0209565_1002678 Ga0209565_10026784 133
161 3300025273 Ga0209673_1030162 Ga0209673_10301622 133
162 3300025291 Ga0209675_1001058 Ga0209675_10010589 133
163 3300025291 Ga0209675_1003355 Ga0209675_10033557 133
164 3300025294 Ga0209025_1002046 Ga0209025_100204617 133
165 3300025294 Ga0209025_1002209 Ga0209025_10022096 133
166 3300025294 Ga0209025_1004415 Ga0209025_10044155 133
167 3300025294 Ga0209025_1074423 Ga0209025_10744232 133
168 3300025295 Ga0209564_1000293 Ga0209564_100029365 133
169 3300025297 Ga0209758_1000286 Ga0209758_100028673 133
170 3300025297 Ga0209758_1004075 Ga0209758_10040751 133
171 3300025299 Ga0209256_1000254 Ga0209256_100025427 133
172 3300025299 Ga0209256_1000340 Ga0209256_10003409 133
173 3300025303 Ga0209051_1006832 Ga0209051_10068322 133
174 3300025903 Ga0207680_10000002 Ga0207680_10000002799 133
175 3300025903 Ga0207680_10004903 Ga0207680_100049031 133
176 3300025904 Ga0207647_10036168 Ga0207647_100361683 133
177 3300025909 Ga0207705_10013199 Ga0207705_100131998 133
178 3300025913 Ga0207695_10000116 Ga0207695_1000011689 133
179 3300025920 Ga0207649_10035326 Ga0207649_100353262 133
180 3300025923 Ga0207681_10333300 Ga0207681_103333002 133
181 3300025924 Ga0207694_10000237 Ga0207694_1000023731 133
182 3300025972 Ga0207668_10453907 Ga0207668_104539072 133
183 3300026035 Ga0207703_10206725 Ga0207703_102067252 133
184 3300028379 Ga0268266_10000004 Ga0268266_10000004793 133
185 3300028381 Ga0268264_10417074 Ga0268264_104170743 133
186 3300033180 Ga0307510_10037353 Ga0307510_100373536 133
187 3300046471 Ga0495650_0041535 Ga0495650_0041535_293_697 133
188 3300046476 Ga0495662_0037605 Ga0495662_0037605_1880_2287 133
189 3300046522 Ga0495643_0127005 Ga0495643_0127005_684_1085 133
190 3300046536 Ga0495587_0077691 Ga0495587_0077691_106_513 133
191 3300046660 Ga0495625_0019875 Ga0495625_0019875_1125_1526 133
192 3300046679 Ga0495623_0345103 Ga0495623_0345103_231_638 133
193 3300046689 Ga0495613_0081526 Ga0495613_0081526_1450_1857 133
194 3300046809 Ga0495600_0009583 Ga0495600_0009583_425_832 133
195 3300048922 Ga0496119_0347121 Ga0496119_0347121_68_469 133
196 3300048924 Ga0496121_0077024 Ga0496121_0077024_735_1136 133
197 3300048928 Ga0496125_0069554 Ga0496125_0069554_508_909 133
198 3300048929 Ga0496126_0165987 Ga0496126_0165987_258_659 133
199 3300053090 Ga0500646_0015820 Ga0500646_0015820_1272_1673 133
200 3300053119 Ga0500595_000798 Ga0500595_000798_6226_6633 133
201 3300053130 Ga0500642_0235031 Ga0500642_0235031_196_600 133
202 3300053154 Ga0500619_011169 Ga0500619_011169_1429_1836 133
203 3300053177 Ga0500636_0001274 Ga0500636_0001274_1469_1876 133
204 3300001990 JGI24737J22298_10103228 JGI24737J22298_101032281 134
205 3300003316 rootH1_10068183 rootH1_100681834 134
206 3300003320 rootH2_10008583 rootH2_100085832 134
207 3300003320 rootH2_10026308 rootH2_1002630818 134
208 3300005455 Ga0070663_100113497 Ga0070663_1001134971 134
209 3300005457 Ga0070662_100080930 Ga0070662_1000809303 134
210 3300005457 Ga0070662_100164774 Ga0070662_1001647742 134
211 3300005614 Ga0068856_100003215 Ga0068856_1000032152 134
212 3300005616 Ga0068852_100000770 Ga0068852_10000077016 134
213 3300005616 Ga0068852_100135843 Ga0068852_1001358432 134
214 3300009093 Ga0105240_10166503 Ga0105240_101665034 134
215 3300009545 Ga0105237_10000529 Ga0105237_1000052916 134
216 3300009551 Ga0105238_10012785 Ga0105238_100127858 134
217 3300010375 Ga0105239_10000802 Ga0105239_1000080218 134
218 3300025904 Ga0207647_10027670 Ga0207647_100276702 134
219 3300025913 Ga0207695_10140913 Ga0207695_101409133 134
220 3300025914 Ga0207671_10004445 Ga0207671_100044454 134
221 3300025924 Ga0207694_10016057 Ga0207694_100160574 134
222 3300025933 Ga0207706_10024457 Ga0207706_100244576 134
223 3300025933 Ga0207706_10199100 Ga0207706_101991002 134
224 3300026041 Ga0207639_10124468 Ga0207639_101244683 134
225 3300026067 Ga0207678_11502801 Ga0207678_115028011 134
226 3300026078 Ga0207702_10002246 Ga0207702_100022462 134
227 3300026121 Ga0207683_10889809 Ga0207683_108898092 134
228 3300026142 Ga0207698_10000286 Ga0207698_100002863 134
229 3300026142 Ga0207698_10409029 Ga0207698_104090292 134
230 3300028379 Ga0268266_10783907 Ga0268266_107839071 134
231 3300037312 Ga0395899_0149436 Ga0395899_0149436_181_657 134
232 3300042157 Ga0439458_0003420 Ga0439458_0003420_1925_2332 134
233 3300045049 Ga0466959_0003304 Ga0466959_0003304_5915_6319 134
234 3300046794 Ga0495589_0000460 Ga0495589_0000460_27560_27967 134
235 3300048924 Ga0496121_0000738 Ga0496121_0000738_55876_56283 134
236 3300048924 Ga0496121_0049562 Ga0496121_0049562_578_985 134
237 3300002987 JGI25159J45721_1013549 JGI25159J45721_10135492 135
238 3300003187 JGI25151J46595_10000259 JGI25151J46595_1000025948 135
239 3300003215 JGI25153J46596_10000895 JGI25153J46596_1000089515 135
240 3300003316 rootH1_10003435 rootH1_1000343510 135
241 3300003320 rootH2_10058159 rootH2_100581595 135
242 3300003323 rootH1_10011523 rootH1_100115239 135
243 3300003323 rootH1_10178442 rootH1_101784422 135
244 3300003354 JGI25160J50197_1024980 JGI25160J50197_10249802 135
245 3300003374 JGI25161J50226_1001652 JGI25161J50226_10016523 135
246 3300003758 Ga0055532_1020356 Ga0055532_10203561 135
247 3300003760 Ga0055527_1005637 Ga0055527_10056372 135
248 3300003761 Ga0055535_1000236 Ga0055535_100023627 135
249 3300003762 Ga0055542_1000028 Ga0055542_1000028206 135
250 3300003771 Ga0055526_1000109 Ga0055526_100010949 135
251 3300003771 Ga0055526_1000696 Ga0055526_100069628 135
252 3300003773 Ga0055537_1000112 Ga0055537_100011248 135
253 3300003773 Ga0055537_1000239 Ga0055537_10002393 135
254 3300003775 Ga0055524_1000235 Ga0055524_100023537 135
255 3300003775 Ga0055524_1009742 Ga0055524_10097425 135
256 3300003781 Ga0055536_1015687 Ga0055536_10156873 135
257 3300003784 Ga0055534_1000194 Ga0055534_100019440 135
258 3300003784 Ga0055534_1000835 Ga0055534_100083514 135
259 3300003790 Ga0055528_1000253 Ga0055528_10002539 135
260 3300003790 Ga0055528_1000279 Ga0055528_100027937 135
261 3300003790 Ga0055528_1000683 Ga0055528_100068320 135
262 3300003792 Ga0055540_1005426 Ga0055540_10054263 135
263 3300003792 Ga0055540_1006459 Ga0055540_10064593 135
264 3300004625 Ga0055543_1000234 Ga0055543_100023440 135
265 3300005262 Ga0065165_1009764 Ga0065165_10097643 135
266 3300005328 Ga0070676_10463353 Ga0070676_104633532 135
267 3300005331 Ga0070670_100066079 Ga0070670_1000660793 135
268 3300005335 Ga0070666_10247219 Ga0070666_102472192 135
269 3300005353 Ga0070669_100191380 Ga0070669_1001913801 135
270 3300005354 Ga0070675_100166669 Ga0070675_1001666692 135
271 3300005364 Ga0070673_100096063 Ga0070673_1000960632 135
272 3300005367 Ga0070667_102139695 Ga0070667_1021396951 135
273 3300005457 Ga0070662_100583419 Ga0070662_1005834191 135
274 3300005543 Ga0070672_100450370 Ga0070672_1004503702 135
275 3300005834 Ga0068851_10055115 Ga0068851_100551152 135
276 3300005844 Ga0068862_101443969 Ga0068862_1014439691 135
277 3300006186 Ga0075369_10578618 Ga0075369_105786181 135
278 3300006195 Ga0075366_10745225 Ga0075366_107452251 135
279 3300006353 Ga0075370_10122278 Ga0075370_101222783 135
280 3300006353 Ga0075370_10275477 Ga0075370_102754772 135
281 3300006931 Ga0097620_100113178 Ga0097620_1001131784 135
282 3300012512 Ga0157327_1009159 Ga0157327_10091592 135
283 3300013104 Ga0157370_10005852 Ga0157370_1000585210 135
284 3300013104 Ga0157370_10175219 Ga0157370_101752192 135
285 3300013307 Ga0157372_10373436 Ga0157372_103734363 135
286 3300025208 Ga0209436_103999 Ga0209436_1039993 135
287 3300025228 Ga0209672_100140 Ga0209672_10014021 135
288 3300025229 Ga0209147_102171 Ga0209147_1021714 135
289 3300025242 Ga0209258_100067 Ga0209258_10006747 135
290 3300025245 Ga0207425_1011315 Ga0207425_10113153 135
291 3300025254 Ga0209148_1000067 Ga0209148_100006790 135
292 3300025254 Ga0209148_1001138 Ga0209148_10011388 135
293 3300025258 Ga0209129_1000230 Ga0209129_100023021 135
294 3300025263 Ga0209565_1000032 Ga0209565_100003272 135
295 3300025263 Ga0209565_1000218 Ga0209565_100021823 135
296 3300025273 Ga0209673_1000029 Ga0209673_100002997 135
297 3300025273 Ga0209673_1000121 Ga0209673_100012198 135
298 3300025284 Ga0209130_1000119 Ga0209130_100011912 135
299 3300025291 Ga0209675_1000019 Ga0209675_1000019246 135
300 3300025291 Ga0209675_1001139 Ga0209675_100113911 135
301 3300025291 Ga0209675_1002240 Ga0209675_10022407 135
302 3300025292 Ga0209676_1003437 Ga0209676_10034378 135
303 3300025292 Ga0209676_1003799 Ga0209676_10037991 135
304 3300025292 Ga0209676_1055253 Ga0209676_10552532 135
305 3300025294 Ga0209025_1000556 Ga0209025_100055628 135
306 3300025294 Ga0209025_1112120 Ga0209025_11121201 135
307 3300025295 Ga0209564_1000261 Ga0209564_100026160 135
308 3300025295 Ga0209564_1000291 Ga0209564_100029140 135
309 3300025297 Ga0209758_1000518 Ga0209758_100051821 135
310 3300025298 Ga0209050_1003223 Ga0209050_10032239 135
311 3300025299 Ga0209256_1000058 Ga0209256_100005845 135
312 3300025299 Ga0209256_1000171 Ga0209256_100017149 135
313 3300025299 Ga0209256_1000490 Ga0209256_100049048 135
314 3300025302 Ga0207426_1000068 Ga0207426_100006877 135
315 3300025303 Ga0209051_1001193 Ga0209051_100119311 135
316 3300025321 Ga0207656_10136578 Ga0207656_101365782 135
317 3300025893 Ga0207682_10201025 Ga0207682_102010252 135
318 3300025923 Ga0207681_10351643 Ga0207681_103516431 135
319 3300025925 Ga0207650_10941085 Ga0207650_109410851 135
320 3300025926 Ga0207659_10173507 Ga0207659_101735071 135
321 3300025933 Ga0207706_10426362 Ga0207706_104263622 135
322 3300025940 Ga0207691_10118668 Ga0207691_101186683 135
323 3300028380 Ga0268265_11738154 Ga0268265_117381541 135
324 3300031649 Ga0307514_10044494 Ga0307514_100444945 135
325 3300046454 Ga0495592_0051661 Ga0495592_0051661_1375_1782 135
326 3300046457 Ga0495590_0025286 Ga0495590_0025286_986_1393 135
327 3300046457 Ga0495590_0051655 Ga0495590_0051655_881_1309 135
328 3300046459 Ga0495629_0067961 Ga0495629_0067961_703_1110 135
329 3300046460 Ga0495638_0027543 Ga0495638_0027543_2086_2514 135
330 3300046461 Ga0495641_0014001 Ga0495641_0014001_1056_1463 135
331 3300046463 Ga0495653_0030921 Ga0495653_0030921_2093_2500 135
332 3300046472 Ga0495580_0023680 Ga0495580_0023680_1505_1912 135
333 3300046473 Ga0495582_0002002 Ga0495582_0002002_2519_2926 135
334 3300046477 Ga0495664_0001108 Ga0495664_0001108_12617_13024 135
335 3300046491 Ga0495584_0010529 Ga0495584_0010529_238_666 135
336 3300046501 Ga0495607_0016359 Ga0495607_0016359_1406_1834 135
337 3300046506 Ga0495583_0003908 Ga0495583_0003908_7527_7955 135
338 3300046512 Ga0495610_0013721 Ga0495610_0013721_1504_1914 135
339 3300046512 Ga0495610_0034394 Ga0495610_0034394_509_916 135
340 3300046513 Ga0495616_0020832 Ga0495616_0020832_2823_3251 135
341 3300046516 Ga0495628_0024280 Ga0495628_0024280_1965_2372 135
342 3300046517 Ga0495630_0013150 Ga0495630_0013150_3393_3800 135
343 3300046522 Ga0495643_0181563 Ga0495643_0181563_107_535 135
344 3300046524 Ga0495648_0014137 Ga0495648_0014137_2821_3228 135
345 3300046526 Ga0495666_0000778 Ga0495666_0000778_3217_3624 135
346 3300046529 Ga0495652_0136311 Ga0495652_0136311_1303_1710 135
347 3300046533 Ga0495640_0030692 Ga0495640_0030692_859_1266 135
348 3300046535 Ga0495586_0052574 Ga0495586_0052574_1119_1526 135
349 3300046536 Ga0495587_0001001 Ga0495587_0001001_12536_12943 135
350 3300046538 Ga0495609_0000128 Ga0495609_0000128_19977_20405 135
351 3300046542 Ga0495597_0168176 Ga0495597_0168176_304_732 135
352 3300046543 Ga0495645_0011970 Ga0495645_0011970_3131_3538 135
353 3300046557 Ga0495622_0248722 Ga0495622_0248722_243_650 135
354 3300046616 Ga0495668_0011540 Ga0495668_0011540_2266_2694 135
355 3300046642 Ga0495634_0010602 Ga0495634_0010602_3217_3624 135
356 3300046660 Ga0495625_0288108 Ga0495625_0288108_517_945 135
357 3300046664 Ga0495659_0005897 Ga0495659_0005897_1327_1755 135
358 3300046665 Ga0495661_0004101 Ga0495661_0004101_1473_1880 135
359 3300046665 Ga0495661_0033985 Ga0495661_0033985_1550_1978 135
360 3300046678 Ga0495599_0005104 Ga0495599_0005104_558_965 135
361 3300046679 Ga0495623_0044549 Ga0495623_0044549_1093_1500 135
362 3300046680 Ga0495646_0003343 Ga0495646_0003343_804_1211 135
363 3300046684 Ga0495669_0000193 Ga0495669_0000193_19978_20406 135
364 3300046689 Ga0495613_0060220 Ga0495613_0060220_1672_2079 135
365 3300046690 Ga0495624_0029293 Ga0495624_0029293_2634_3041 135
366 3300046690 Ga0495624_0052807 Ga0495624_0052807_1292_1699 135
367 3300046692 Ga0495671_0062620 Ga0495671_0062620_940_1368 135
368 3300046694 Ga0495649_0013459 Ga0495649_0013459_766_1194 135
369 3300046694 Ga0495649_0464517 Ga0495649_0464517_152_562 135
370 3300046809 Ga0495600_0213088 Ga0495600_0213088_262_669 135
371 3300046810 Ga0495660_0033578 Ga0495660_0033578_353_760 135
372 3300047315 Ga0495581_0002933 Ga0495581_0002933_922_1329 135
373 3300047317 Ga0495604_0023468 Ga0495604_0023468_3137_3544 135
374 3300047318 Ga0495636_0005133 Ga0495636_0005133_4245_4673 135
375 3300047318 Ga0495636_0387136 Ga0495636_0387136_230_643 135
376 3300047321 Ga0495676_0066278 Ga0495676_0066278_703_1110 135
377 3300047322 Ga0495680_0003934 Ga0495680_0003934_1119_1526 135
378 3300047323 Ga0495683_0071214 Ga0495683_0071214_624_1031 135
379 3300047443 Ga0495687_113001 Ga0495687_113001_95_523 135
380 3300047444 Ga0495675_0005193 Ga0495675_0005193_1458_1865 135
381 3300047445 Ga0495677_0045638 Ga0495677_0045638_878_1306 135
382 3300047446 Ga0495679_001011 Ga0495679_001011_4327_4734 135
383 3300047447 Ga0495685_001940 Ga0495685_001940_1566_1994 135
384 3300047470 Ga0495681_0003830 Ga0495681_0003830_2625_3053 135
385 3300047470 Ga0495681_0124926 Ga0495681_0124926_22_429 135
386 3300047471 Ga0495684_0025796 Ga0495684_0025796_1877_2284 135
387 3300047673 Ga0495593_0017899 Ga0495593_0017899_2720_3127 135
388 3300048088 Ga0495602_0034166 Ga0495602_0034166_3236_3643 135
389 3300048089 Ga0495614_0030147 Ga0495614_0030147_680_1087 135
390 3300048914 Ga0496111_0631417 Ga0496111_0631417_343_756 135
391 3300048919 Ga0496116_0097495 Ga0496116_0097495_1000_1407 135
392 3300048920 Ga0496117_0027873 Ga0496117_0027873_284_691 135
393 3300048924 Ga0496121_0021809 Ga0496121_0021809_3364_3771 135
394 3300048925 Ga0496122_0105321 Ga0496122_0105321_550_957 135
395 3300048926 Ga0496123_0027460 Ga0496123_0027460_3773_4180 135
396 3300049571 Ga0501034_0000067 Ga0501034_0000067_49655_50065 135
397 3300049580 Ga0501046_0378783 Ga0501046_0378783_480_899 135
398 3300049581 Ga0501047_0226035 Ga0501047_0226035_1240_1659 135
399 3300049822 Ga0501035_0023214 Ga0501035_0023214_1898_2317 135
400 3300049823 Ga0501044_0029297 Ga0501044_0029297_3440_3859 135
401 3300050493 nmdc:mga0k408_782798_c1 nmdc:mga0k408_782798_c1_34_441 135
402 3300050496 nmdc:mga07m45_216849_c1 nmdc:mga07m45_216849_c1_301_708 135
403 3300050516 nmdc:mga0sz30_455412_c1 nmdc:mga0sz30_455412_c1_137_544 135
404 3300001979 JGI24740J21852_10128070 JGI24740J21852_101280701 136
405 3300005539 Ga0068853_100330486 Ga0068853_1003304862 136
406 3300006195 Ga0075366_10055096 Ga0075366_100550962 136
407 3300006353 Ga0075370_10000123 Ga0075370_1000012315 136
408 3300010375 Ga0105239_11190980 Ga0105239_111909801 136
409 3300011119 Ga0105246_10574037 Ga0105246_105740371 136
410 3300013104 Ga0157370_10458730 Ga0157370_104587302 136
411 3300031456 Ga0307513_10119987 Ga0307513_101199872 136
412 3300031731 Ga0307405_10898999 Ga0307405_108989991 136
413 3300032005 Ga0307411_10101766 Ga0307411_101017663 136
414 3300041404 Ga0439436_0000235 Ga0439436_0000235_288_698 136
415 3300041405 Ga0439438_045422 Ga0439438_045422_50_460 136
416 3300041406 Ga0439439_0025110 Ga0439439_0025110_594_1004 136
417 3300041407 Ga0439447_016789 Ga0439447_016789_19_429 136
418 3300041411 Ga0439466_0001084 Ga0439466_0001084_5971_6381 136
419 3300041413 Ga0439465_0000894 Ga0439465_0000894_4284_4694 136
420 3300041997 Ga0439431_0001667 Ga0439431_0001667_4199_4609 136
421 3300041997 Ga0439431_0219655 Ga0439431_0219655_115_534 136
422 3300041999 Ga0439433_0000395 Ga0439433_0000395_4979_5389 136
423 3300042002 Ga0439442_016869 Ga0439442_016869_143_553 136
424 3300042004 Ga0439445_0000211 Ga0439445_0000211_5862_6272 136
425 3300042006 Ga0439432_012865 Ga0439432_012865_1377_1787 136
426 3300042007 Ga0439449_0000653 Ga0439449_0000653_12198_12608 136
427 3300042008 Ga0439450_083305 Ga0439450_083305_187_669 136
428 3300042010 Ga0439452_007644 Ga0439452_007644_1623_2033 136
429 3300042014 Ga0439457_002407 Ga0439457_002407_4741_5151 136
430 3300042015 Ga0439462_0005061 Ga0439462_0005061_1747_2157 136
431 3300042156 Ga0439446_0048890 Ga0439446_0048890_328_738 136
432 3300042185 Ga0450909_026215 Ga0450909_026215_411_821 136
433 3300042435 Ga0439434_0012196 Ga0439434_0012196_2001_2411 136
434 3300046660 Ga0495625_0002228 Ga0495625_0002228_1350_1769 136
435 3300048904 Ga0496101_1592913 Ga0496101_1592913_14_442 136
436 3300048920 Ga0496117_0118559 Ga0496117_0118559_998_1408 136
437 3300048925 Ga0496122_0182908 Ga0496122_0182908_509_991 136
438 3300048927 Ga0496124_0145288 Ga0496124_0145288_329_739 136
439 3300048928 Ga0496125_0231328 Ga0496125_0231328_375_794 136
440 3300050493 nmdc:mga0k408_43730_c1 nmdc:mga0k408_43730_c1_1773_2192 136
441 3300050496 nmdc:mga07m45_2829_c1 nmdc:mga07m45_2829_c1_370_789 136
442 3300050496 nmdc:mga07m45_97175_c1 nmdc:mga07m45_97175_c1_798_1244 136
443 3300050516 nmdc:mga0sz30_207565_c1 nmdc:mga0sz30_207565_c1_53_472 136
444 3300053088 Ga0500644_0010285 Ga0500644_0010285_1094_1510 136
445 3300053121 Ga0500607_033532 Ga0500607_033532_2121_2531 136
446 3300053134 Ga0500658_0000038 Ga0500658_0000038_19657_20076 136
447 3300053142 Ga0500577_0193796 Ga0500577_0193796_122_538 136
448 3300053153 Ga0500616_0087362 Ga0500616_0087362_120_536 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

73

145

0.96

PF00190

Cupin_1

Cupin

40

157

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cu1-assembly1.cif.gz_A crystal structure of dmsp lyase dddq from ruegeria pomeroyi dss-3 0.9236 48 130
5jsp-assembly1.cif.gz_A new mechanistic insight from substrate and product bound structures of the metal-dependent dimethylsulfoniopropionate lyase dddq 0.9022 48 135
3rns-assembly1.cif.gz_A cupin 2 conserved barrel domain protein from leptotrichia buccalis 0.8958 30 125
4b29-assembly1.cif.gz_A crystal structures of dmsp lyases rddddp and rndddqii 0.8918 48 136
8e8w-assembly1.cif.gz_A crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 mononuclear fe(ii) structure on the hdo cofactor assembly pathway 0.8895 48 126
ID Description Score Start End Superfamily
5cu1A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9236 48 130 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9073 48 123 2.60.120.10
af_Q5A3Z5_62_265_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8996 48 123 2.60.120.10
4b29A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8918 48 136 2.60.120.10
3bu7B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8818 48 123 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A5C8A1E0-F1-model_v4 deleted 1 30 136
AF-A0A1G9SW51-F1-model_v4 Cupin domain-containing protein 0.9984 52 136
AF-A0A5B7R8R5-F1-model_v4 deleted 0.9978 36 136
AF-A0A849RR98-F1-model_v4 Cupin domain-containing protein 0.9953 30 136
AF-A0A7G8BR79-F1-model_v4 Cupin domain-containing protein 0.9946 27 136

Feature Viewer

pLDDT pTM Quality
89.17 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map