F446205

General Info

Members Datasets Scaffolds Average Seq Length
448 240 896 186

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0140475|Ga0395899_0140475_620_1294
Length 224
Sequence VEHAKPRSTGAANFDARSESYSPASTVRVTFDGAGVRAVVLVEGISDQCALEALAERRGRNLSAAGISVVPIGGAQAIGRFLNLFGPHGLDVTLAGMCDAAEEDEFRRGLERAGFGSHLTRSDMEALGFYVCVADLEEELIRALGAASVEQVVDSQGDLGSFRTLQKQPAWRGRPREEQLRRFMGSGGSRKVRYARLLVDALDLTRVPRPLDRVLAHVAQDPPG

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
74 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
125 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
137 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
138 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
139 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
140 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
154 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
159 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
160 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
161 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
166 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
167 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
233 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
234 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
238 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
239 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
240 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.11
Metatranscriptomes 0.22
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 8.71
Rhizosphere 89.73
Stem 0
Stem Tuber 0
Unclassified 8.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0140475 3300037312 Unclassified 1719
2 JGI25407J50210_10002673 3300003373 Bacteria 4230
3 Ga0070683_100050302 3300005329 Bacteria 3858
4 Ga0070683_100054979 3300005329 Bacteria 3692
5 Ga0070683_100160573 3300005329 Bacteria 2132
6 Ga0070683_101433114 3300005329 Bacteria 664
7 Ga0070680_100066970 3300005336 Bacteria 2946
8 Ga0070680_100437426 3300005336 Bacteria 1116
9 Ga0070680_100441716 3300005336 Bacteria 1111
10 Ga0070682_100117607 3300005337 Bacteria 1780
11 Ga0068868_100060979 3300005338 Bacteria 2987
12 Ga0068868_100201604 3300005338 Bacteria 1659
13 Ga0070660_100117071 3300005339 Bacteria 2125
14 Ga0070660_100293903 3300005339 Bacteria 1331
15 Ga0070689_100590191 3300005340 Bacteria 961
16 Ga0070691_10042415 3300005341 Bacteria 2153
17 Ga0070687_100233801 3300005343 Bacteria 1132
18 Ga0070692_10029193 3300005345 Bacteria 2747
19 Ga0070669_100133168 3300005353 Bacteria 1909
20 Ga0070674_100262397 3300005356 Bacteria 1361
21 Ga0070659_100040043 3300005366 Bacteria 3661
22 Ga0070659_100052964 3300005366 Bacteria 3193
23 Ga0070714_100077212 3300005435 Bacteria 2893
24 Ga0070713_100947252 3300005436 Bacteria 829
25 Ga0070700_100016125 3300005441 Bacteria 4251
26 Ga0070700_100230503 3300005441 Bacteria 1318
27 Ga0070694_100065435 3300005444 Bacteria 2490
28 Ga0070708_100167637 3300005445 Bacteria 2049
29 Ga0070708_100504806 3300005445 Bacteria 1141
30 Ga0070678_100171025 3300005456 Bacteria 1770
31 Ga0070662_100194831 3300005457 Bacteria 1605
32 Ga0070681_10006548 3300005458 Bacteria 11338
33 Ga0070681_10061828 3300005458 Bacteria 3719
34 Ga0070681_10116186 3300005458 Bacteria 2613
35 Ga0070681_10570968 3300005458 Bacteria 1045
36 Ga0068867_100076205 3300005459 Bacteria 2518
37 Ga0068867_100512864 3300005459 Bacteria 1032
38 Ga0070685_10145545 3300005466 Bacteria 1496
39 Ga0070685_10380874 3300005466 Bacteria 972
40 Ga0070706_100033573 3300005467 Bacteria 4737
41 Ga0070707_100176414 3300005468 Bacteria 2083
42 Ga0070698_100013593 3300005471 Bacteria 8618
43 Ga0070679_100067971 3300005530 Bacteria 3555
44 Ga0070679_100158161 3300005530 Bacteria 2240
45 Ga0070684_100008254 3300005535 Bacteria 8140
46 Ga0070684_100012916 3300005535 Bacteria 6713
47 Ga0070684_100053100 3300005535 Bacteria 3526
48 Ga0070684_100133218 3300005535 Bacteria 2243
49 Ga0068853_100049585 3300005539 Bacteria 3609
50 Ga0070686_100039159 3300005544 Bacteria 2952
51 Ga0070695_100099285 3300005545 Bacteria 1958
52 Ga0070695_100210073 3300005545 Bacteria 1397
53 Ga0070696_100208281 3300005546 Bacteria 1463
54 Ga0070696_100903147 3300005546 Bacteria 733
55 Ga0070693_100027128 3300005547 Bacteria 3099
56 Ga0068855_100047055 3300005563 Bacteria 5097
57 Ga0068855_100327911 3300005563 Bacteria 1690
58 Ga0068855_100646618 3300005563 Bacteria 1136
59 Ga0070664_100523234 3300005564 Bacteria 1095
60 Ga0068857_100032613 3300005577 Bacteria 4605
61 Ga0068854_100039624 3300005578 Bacteria 3321
62 Ga0068854_100070214 3300005578 Bacteria 2560
63 Ga0068854_100101874 3300005578 Bacteria 2154
64 Ga0068856_100019175 3300005614 Bacteria 6640
65 Ga0068856_100100706 3300005614 Bacteria 2882
66 Ga0068856_100125067 3300005614 Bacteria 2574
67 Ga0070702_100001591 3300005615 Bacteria 9364
68 Ga0070702_100577418 3300005615 Bacteria 839
69 Ga0070702_100646849 3300005615 Bacteria 799
70 Ga0068852_100143865 3300005616 Bacteria 2209
71 Ga0068859_100747266 3300005617 Unclassified 1067
72 Ga0068864_100638690 3300005618 Bacteria 1036
73 Ga0068864_100727860 3300005618 Bacteria 971
74 Ga0068864_100771998 3300005618 Unclassified 943
75 Ga0068866_10039868 3300005718 Bacteria 2321
76 Ga0068866_10148927 3300005718 Bacteria 1353
77 Ga0068861_100039555 3300005719 Bacteria 3520
78 Ga0068861_100167961 3300005719 Bacteria 1816
79 Ga0068861_100763459 3300005719 Bacteria 904
80 Ga0068851_10415939 3300005834 Unclassified 793
81 Ga0068860_100212858 3300005843 Bacteria 1875
82 Ga0068862_100141243 3300005844 Bacteria 2138
83 Ga0081455_10021556 3300005937 Bacteria 6040
84 Ga0081455_10259577 3300005937 Bacteria 1266
85 Ga0081538_10000842 3300005981 Bacteria 33275
86 Ga0081538_10000912 3300005981 Bacteria 31842
87 Ga0081538_10022572 3300005981 Bacteria 4557
88 Ga0081540_1004743 3300005983 Bacteria 10280
89 Ga0070712_100189389 3300006175 Bacteria 1609
90 Ga0075428_100000754 3300006844 Bacteria 33635
91 Ga0075430_100016256 3300006846 Bacteria 6337
92 Ga0075431_100013396 3300006847 Bacteria 8285
93 Ga0075434_100006528 3300006871 Bacteria 10696
94 Ga0075434_100238023 3300006871 Bacteria 1840
95 Ga0075434_100926701 3300006871 Bacteria 886
96 Ga0075429_100019670 3300006880 Bacteria 5853
97 Ga0068865_100034914 3300006881 Bacteria 3378
98 Ga0075436_100105624 3300006914 Unclassified 1964
99 Ga0097620_100747283 3300006931 Unclassified 1067
100 Ga0075435_100096509 3300007076 Unclassified 2445
101 Ga0075435_100294599 3300007076 Bacteria 1387
102 Ga0105240_10042480 3300009093 Bacteria 5792
103 Ga0105240_11348619 3300009093 Bacteria 751
104 Ga0105245_10035684 3300009098 Bacteria 4414
105 Ga0105245_10082284 3300009098 Bacteria 2945
106 Ga0105245_10108832 3300009098 Bacteria 2574
107 Ga0105245_10167961 3300009098 Unclassified 2087
108 Ga0105245_10508052 3300009098 Bacteria 1222
109 Ga0114129_10050614 3300009147 Bacteria 5835
110 Ga0114129_10138464 3300009147 Bacteria 3339
111 Ga0105243_10353671 3300009148 Bacteria 1350
112 Ga0105243_10416690 3300009148 Bacteria 1251
113 Ga0105241_10848921 3300009174 Unclassified 844
114 Ga0105242_10034276 3300009176 Bacteria 4070
115 Ga0105242_10043996 3300009176 Bacteria 3614
116 Ga0105242_10193562 3300009176 Bacteria 1802
117 Ga0105248_10746523 3300009177 Bacteria 1104
118 Ga0105248_10945363 3300009177 Bacteria 973
119 Ga0105237_10057355 3300009545 Bacteria 3898
120 Ga0105238_10056443 3300009551 Bacteria 3940
121 Ga0105249_11360561 3300009553 Bacteria 782
122 Ga0105239_10309767 3300010375 Bacteria 1779
123 Ga0105239_10603569 3300010375 Bacteria 1252
124 Ga0105239_10666544 3300010375 Bacteria 1188
125 Ga0105239_10702044 3300010375 Bacteria 1157
126 Ga0105239_10716035 3300010375 Bacteria 1145
127 Ga0157344_1000488 3300012476 Bacteria 1557
128 Ga0157315_1015019 3300012508 Bacteria 749
129 Ga0157371_10072788 3300013102 Bacteria 2434
130 Ga0157371_10225757 3300013102 Bacteria 1345
131 Ga0157370_10322639 3300013104 Bacteria 1424
132 Ga0157370_10861636 3300013104 Bacteria 823
133 Ga0157369_10005749 3300013105 Bacteria 14415
134 Ga0157369_10017959 3300013105 Bacteria 7940
135 Ga0157369_10151210 3300013105 Bacteria 2453
136 Ga0157374_10613184 3300013296 Bacteria 1099
137 Ga0157378_10671695 3300013297 Bacteria 1053
138 Ga0163162_10075008 3300013306 Bacteria 3442
139 Ga0163162_10091657 3300013306 Bacteria 3122
140 Ga0157372_10051947 3300013307 Bacteria 4563
141 Ga0157372_10128222 3300013307 Bacteria 2918
142 Ga0157372_10221240 3300013307 Bacteria 2194
143 Ga0157372_10448485 3300013307 Bacteria 1504
144 Ga0157372_10464528 3300013307 Bacteria 1475
145 Ga0157375_10079143 3300013308 Bacteria 3321
146 Ga0157380_10098384 3300014326 Bacteria 2431
147 Ga0157377_10051284 3300014745 Bacteria 2326
148 Ga0157376_10359712 3300014969 Bacteria 1395
149 Ga0206356_11192362 3300020070 Bacteria 1612
150 Ga0207653_10058814 3300025885 Bacteria 1292
151 Ga0207642_10187442 3300025899 Bacteria 1132
152 Ga0207645_10114866 3300025907 Bacteria 1745
153 Ga0207707_10017499 3300025912 Bacteria 6248
154 Ga0207707_10065786 3300025912 Bacteria 3156
155 Ga0207707_10473759 3300025912 Bacteria 1070
156 Ga0207671_10477009 3300025914 Unclassified 994
157 Ga0207663_10247425 3300025916 Bacteria 1310
158 Ga0207660_10113726 3300025917 Bacteria 2040
159 Ga0207660_10166092 3300025917 Bacteria 1706
160 Ga0207662_10083233 3300025918 Bacteria 1956
161 Ga0207657_10041487 3300025919 Bacteria 4069
162 Ga0207657_10118765 3300025919 Bacteria 2176
163 Ga0207649_10411755 3300025920 Bacteria 1014
164 Ga0207652_10103271 3300025921 Bacteria 2520
165 Ga0207652_10217256 3300025921 Bacteria 1722
166 Ga0207652_10250782 3300025921 Bacteria 1596
167 Ga0207646_10094197 3300025922 Bacteria 2682
168 Ga0207646_10321920 3300025922 Bacteria 1397
169 Ga0207681_10108549 3300025923 Bacteria 2015
170 Ga0207694_10164085 3300025924 Unclassified 1796
171 Ga0207687_10009719 3300025927 Bacteria 6292
172 Ga0207687_10012398 3300025927 Bacteria 5570
173 Ga0207687_10283715 3300025927 Bacteria 1328
174 Ga0207687_10309657 3300025927 Bacteria 1275
175 Ga0207687_10463213 3300025927 Bacteria 1053
176 Ga0207664_10357390 3300025929 Bacteria 1294
177 Ga0207644_10380596 3300025931 Bacteria 1151
178 Ga0207706_10006276 3300025933 Bacteria 11046
179 Ga0207706_10035051 3300025933 Bacteria 4464
180 Ga0207686_10043111 3300025934 Bacteria 2763
181 Ga0207686_10466783 3300025934 Unclassified 974
182 Ga0207709_10007173 3300025935 Bacteria 6218
183 Ga0207709_10049040 3300025935 Bacteria 2575
184 Ga0207709_10146791 3300025935 Bacteria 1628
185 Ga0207709_10614988 3300025935 Bacteria 862
186 Ga0207704_10240309 3300025938 Bacteria 1353
187 Ga0207691_10251964 3300025940 Bacteria 1524
188 Ga0207661_10000361 3300025944 Bacteria 29168
189 Ga0207661_10024586 3300025944 Bacteria 4566
190 Ga0207661_10091905 3300025944 Bacteria 2529
191 Ga0207679_10055427 3300025945 Bacteria 2922
192 Ga0207712_10110794 3300025961 Bacteria 2059
193 Ga0207712_10544975 3300025961 Bacteria 997
194 Ga0207677_10087791 3300026023 Bacteria 2253
195 Ga0207703_10662213 3300026035 Bacteria 991
196 Ga0207639_10941044 3300026041 Bacteria 808
197 Ga0207702_10094461 3300026078 Bacteria 2625
198 Ga0207702_10104969 3300026078 Bacteria 2502
199 Ga0207702_10107491 3300026078 Unclassified 2474
200 Ga0207641_10757301 3300026088 Bacteria 959
201 Ga0207648_10120268 3300026089 Bacteria 2309
202 Ga0207648_10406010 3300026089 Bacteria 1235
203 Ga0207675_100033818 3300026118 Bacteria 4763
204 Ga0207675_100073140 3300026118 Bacteria 3207
205 Ga0207683_10073787 3300026121 Bacteria 3019
206 Ga0207683_10185093 3300026121 Bacteria 1889
207 Ga0207683_10269914 3300026121 Bacteria 1554
208 Ga0307408_100138123 3300031548 Unclassified 1910
209 Ga0307412_10372698 3300031911 Bacteria 1153
210 Ga0307416_100154509 3300032002 Bacteria 2110
211 Ga0307416_100720368 3300032002 Bacteria 1088
212 Ga0307415_100000667 3300032126 Bacteria 15183
213 Ga0373944_0177809 3300035089 Bacteria 762
214 Ga0373936_0168174 3300035113 Bacteria 958
215 Ga0373956_0317239 3300035119 Bacteria 743
216 Ga0373943_0002150 3300035170 Bacteria 8962
217 Ga0373933_0599218 3300035724 Bacteria 723
218 Ga0373947_0015588 3300035725 Bacteria 4365
219 Ga0373937_0022732 3300036401 Bacteria 5641
220 Ga0373925_0887198 3300037068 Unclassified 735
221 Ga0395899_0008819 3300037312 Bacteria 7761
222 Ga0395899_0011929 3300037312 Bacteria 6657
223 Ga0395899_0014087 3300037312 Bacteria 6104
224 Ga0395899_0035521 3300037312 Bacteria 3741
225 Ga0395899_0064180 3300037312 Bacteria 2700
226 Ga0395899_0119502 3300037312 Bacteria 1889
227 Ga0395899_0267275 3300037312 Unclassified 1167
228 Ga0395899_0397648 3300037312 Bacteria 912
229 Ga0395899_0425306 3300037312 Bacteria 874
230 Ga0395900_0020318 3300037418 Bacteria 6778
231 Ga0395900_0034341 3300037418 Bacteria 5221
232 Ga0395900_0035185 3300037418 Bacteria 5159
233 Ga0395900_0038647 3300037418 Bacteria 4919
234 Ga0395900_0055654 3300037418 Bacteria 4073
235 Ga0395900_0120965 3300037418 Bacteria 2686
236 Ga0395900_0153398 3300037418 Bacteria 2353
237 Ga0395900_0182677 3300037418 Bacteria 2130
238 Ga0395900_0228708 3300037418 Unclassified 1871
239 Ga0395900_0261910 3300037418 Unclassified 1726
240 Ga0395900_0742271 3300037418 Unclassified 912
241 Ga0395900_0790667 3300037418 Bacteria 877
242 Ga0395900_1004124 3300037418 Bacteria 754
243 Ga0395898_0013489 3300037466 Bacteria 8414
244 Ga0395898_0034212 3300037466 Bacteria 5066
245 Ga0395898_0045029 3300037466 Bacteria 4338
246 Ga0395898_0055159 3300037466 Bacteria 3876
247 Ga0395898_0071587 3300037466 Bacteria 3350
248 Ga0395898_0078689 3300037466 Bacteria 3181
249 Ga0395898_0083171 3300037466 Unclassified 3085
250 Ga0395898_0095534 3300037466 Bacteria 2855
251 Ga0395898_0153162 3300037466 Bacteria 2205
252 Ga0395898_0193268 3300037466 Unclassified 1944
253 Ga0395898_0346669 3300037466 Bacteria 1416
254 Ga0395898_0786333 3300037466 Bacteria 892
255 Ga0395905_0007407 3300037471 Bacteria 10910
256 Ga0395905_0011693 3300037471 Bacteria 8474
257 Ga0395905_0017612 3300037471 Bacteria 6780
258 Ga0395905_0020867 3300037471 Bacteria 6203
259 Ga0395905_0087679 3300037471 Bacteria 2917
260 Ga0395905_0170354 3300037471 Bacteria 2045
261 Ga0395905_0201783 3300037471 Unclassified 1864
262 Ga0395905_0585743 3300037471 Unclassified 1017
263 Ga0395905_0813187 3300037471 Bacteria 837
264 Ga0395901_0010444 3300038443 Bacteria 9407
265 Ga0395901_0016389 3300038443 Bacteria 7546
266 Ga0395901_0016630 3300038443 Bacteria 7494
267 Ga0395901_0018829 3300038443 Bacteria 7057
268 Ga0395901_0029210 3300038443 Bacteria 5674
269 Ga0395901_0035908 3300038443 Bacteria 5121
270 Ga0395901_0055611 3300038443 Bacteria 4115
271 Ga0395901_0062187 3300038443 Bacteria 3885
272 Ga0395901_0191260 3300038443 Bacteria 2146
273 Ga0395901_0227269 3300038443 Bacteria 1949
274 Ga0395901_0236264 3300038443 Bacteria 1907
275 Ga0395901_0237897 3300038443 Unclassified 1900
276 Ga0395901_0300395 3300038443 Bacteria 1665
277 Ga0395901_0336997 3300038443 Bacteria 1558
278 Ga0395901_0501093 3300038443 Bacteria 1236
279 Ga0395901_0941112 3300038443 Unclassified 843
280 Ga0451839_1001600 3300041496 Unclassified 646
281 Ga0451853_3350646 3300041512 Bacteria 1429
282 Ga0439446_0050674 3300042156 Bacteria 1239
283 Ga0439434_0026429 3300042435 Bacteria 1753
284 Ga0439435_0129257 3300042436 Bacteria 797
285 Ga0466963_0219830 3300044694 Bacteria 1330
286 Ga0466960_0024792 3300044901 Bacteria 2709
287 Ga0466960_0102083 3300044901 Bacteria 1478
288 Ga0466967_0033586 3300045976 Bacteria 4344
289 Ga0466967_0035317 3300045976 Bacteria 4253
290 Ga0466967_0925051 3300045976 Bacteria 867
291 Ga0495592_0031557 3300046454 Bacteria 4004
292 Ga0495603_0050791 3300046455 Bacteria 2465
293 Ga0495603_0312218 3300046455 Bacteria 903
294 Ga0495603_0476043 3300046455 Bacteria 715
295 Ga0495651_0226303 3300046462 Bacteria 1291
296 Ga0495653_0025784 3300046463 Bacteria 4717
297 Ga0495582_0403147 3300046473 Bacteria 789
298 Ga0495605_0338316 3300046474 Bacteria 633
299 Ga0495639_0288477 3300046475 Unclassified 817
300 Ga0495584_0069060 3300046491 Bacteria 1775
301 Ga0495584_0281104 3300046491 Bacteria 846
302 Ga0495594_0000927 3300046499 Bacteria 15176
303 Ga0495596_0041222 3300046500 Bacteria 1821
304 Ga0495607_0105535 3300046501 Bacteria 1502
305 Ga0495608_0061669 3300046511 Bacteria 2465
306 Ga0495618_0218892 3300046514 Bacteria 1202
307 Ga0495618_0260550 3300046514 Bacteria 1086
308 Ga0495630_1275426 3300046517 Unclassified 554
309 Ga0495631_0191352 3300046518 Bacteria 876
310 Ga0495637_0037035 3300046520 Bacteria 2121
311 Ga0495644_0062516 3300046523 Bacteria 1399
312 Ga0495666_0113732 3300046526 Bacteria 1270
313 Ga0495652_0085904 3300046529 Bacteria 2584
314 Ga0495652_0485715 3300046529 Bacteria 859
315 Ga0495665_0155493 3300046531 Bacteria 1193
316 Ga0495667_0106696 3300046559 Bacteria 1810
317 Ga0495656_0114849 3300046615 Bacteria 1264
318 Ga0495656_0147831 3300046615 Bacteria 1132
319 Ga0495656_0208394 3300046615 Bacteria 973
320 Ga0495659_0029079 3300046664 Bacteria 1917
321 Ga0495659_0094276 3300046664 Bacteria 1153
322 Ga0495588_0019728 3300046674 Bacteria 3306
323 Ga0495657_0018170 3300046675 Bacteria 5094
324 Ga0495647_0023071 3300046681 Bacteria 2254
325 Ga0495613_0248790 3300046689 Unclassified 1241
326 Ga0495613_0287584 3300046689 Bacteria 1140
327 Ga0495600_0121735 3300046809 Bacteria 1697
328 Ga0495600_0251816 3300046809 Bacteria 1123
329 Ga0495581_0004011 3300047315 Bacteria 8479
330 Ga0495674_0087692 3300047319 Bacteria 2663
331 Ga0495674_0263936 3300047319 Bacteria 1414
332 Ga0495676_0082824 3300047321 Bacteria 2427
333 Ga0495676_0286918 3300047321 Bacteria 1113
334 Ga0495676_0437179 3300047321 Unclassified 864
335 Ga0495684_0008103 3300047471 Bacteria 8123
336 Ga0495684_0290445 3300047471 Bacteria 1177
337 Ga0495626_0142226 3300048091 Bacteria 1017
338 Ga0496100_0680922 3300048903 Bacteria 802
339 Ga0496100_0937503 3300048903 Bacteria 680
340 Ga0496101_0610271 3300048904 Bacteria 862
341 Ga0496101_0619297 3300048904 Bacteria 856
342 Ga0496102_0124751 3300048905 Bacteria 2406
343 Ga0496102_0130686 3300048905 Bacteria 2350
344 Ga0496103_0100890 3300048906 Bacteria 1827
345 Ga0496103_0651406 3300048906 Unclassified 669
346 Ga0496104_0076252 3300048907 Bacteria 3193
347 Ga0496105_0508587 3300048908 Bacteria 945
348 Ga0496106_0011147 3300048909 Bacteria 6651
349 Ga0496106_0013301 3300048909 Bacteria 6075
350 Ga0496106_0158494 3300048909 Bacteria 1789
351 Ga0496107_0170758 3300048910 Bacteria 1614
352 Ga0496107_0535773 3300048910 Bacteria 868
353 Ga0496108_0003773 3300048911 Bacteria 12129
354 Ga0496108_0012795 3300048911 Bacteria 6832
355 Ga0496108_0070063 3300048911 Bacteria 2959
356 Ga0496109_0060697 3300048912 Unclassified 3455
357 Ga0496109_0137873 3300048912 Bacteria 2281
358 Ga0496109_0165112 3300048912 Bacteria 2075
359 Ga0496109_0673415 3300048912 Bacteria 972
360 Ga0496109_0849059 3300048912 Bacteria 851
361 Ga0496110_0005488 3300048913 Bacteria 9946
362 Ga0496110_0088409 3300048913 Bacteria 2767
363 Ga0496111_0002525 3300048914 Bacteria 11038
364 Ga0496111_0007076 3300048914 Bacteria 7330
365 Ga0496111_0010655 3300048914 Bacteria 6180
366 Ga0496112_0318372 3300048915 Bacteria 1500
367 Ga0496112_0371942 3300048915 Bacteria 1371
368 Ga0496112_0992723 3300048915 Bacteria 759
369 Ga0496113_0007206 3300048916 Bacteria 7126
370 Ga0496113_0164987 3300048916 Bacteria 1752
371 Ga0496114_0149115 3300048917 Bacteria 2029
372 Ga0496114_0309163 3300048917 Bacteria 1396
373 Ga0496115_0026906 3300048918 Bacteria 4494
374 Ga0496115_0162898 3300048918 Bacteria 1844
375 Ga0496115_0215902 3300048918 Bacteria 1584
376 Ga0496115_0228474 3300048918 Bacteria 1535
377 Ga0501031_0198475 3300049568 Bacteria 1309
378 Ga0501032_0008451 3300049569 Bacteria 7504
379 Ga0501033_0005974 3300049570 Bacteria 9556
380 Ga0501036_0524996 3300049572 Bacteria 984
381 Ga0501037_0004521 3300049573 Bacteria 10110
382 Ga0501038_0002653 3300049574 Bacteria 16720
383 Ga0501038_0216734 3300049574 Bacteria 1529
384 Ga0501039_0038314 3300049575 Bacteria 3702
385 Ga0501039_0077225 3300049575 Bacteria 2590
386 Ga0501040_0155347 3300049576 Bacteria 1616
387 Ga0501041_0006321 3300049577 Bacteria 6931
388 Ga0501042_0029873 3300049578 Bacteria 3844
389 Ga0501042_0063594 3300049578 Bacteria 2637
390 Ga0501043_0005177 3300049579 Bacteria 10554
391 Ga0501046_0007204 3300049580 Bacteria 9777
392 Ga0501046_0200153 3300049580 Bacteria 1486
393 Ga0501048_0091279 3300049582 Bacteria 2149
394 Ga0501067_0049532 3300049583 Unclassified 2327
395 Ga0501068_0028621 3300049584 Bacteria 3296
396 Ga0501069_0011207 3300049585 Bacteria 4756
397 Ga0501069_0661720 3300049585 Unclassified 629
398 Ga0501070_0015303 3300049586 Bacteria 6454
399 Ga0501071_0123201 3300049587 Bacteria 1922
400 Ga0501071_0126979 3300049587 Bacteria 1893
401 Ga0501071_0184523 3300049587 Bacteria 1563
402 Ga0501072_0015278 3300049588 Bacteria 5885
403 Ga0501072_0116040 3300049588 Bacteria 2132
404 Ga0501073_0105614 3300049589 Bacteria 1954
405 Ga0501074_0000617 3300049590 Bacteria 22153
406 Ga0501075_0066289 3300049591 Bacteria 2724
407 Ga0501075_0105766 3300049591 Bacteria 2139
408 Ga0501076_0077049 3300049592 Bacteria 2674
409 Ga0501076_0154777 3300049592 Bacteria 1865
410 Ga0501077_0019159 3300049593 Bacteria 4327
411 Ga0501077_0055676 3300049593 Bacteria 2511
412 Ga0501079_0016263 3300049741 Bacteria 5685
413 Ga0501079_0499245 3300049741 Bacteria 956
414 Ga0501080_0002778 3300049742 Bacteria 15384
415 Ga0501080_0538983 3300049742 Bacteria 1040
416 Ga0501081_0015693 3300049743 Bacteria 4999
417 Ga0501083_0018883 3300049744 Bacteria 4800
418 Ga0501045_0025477 3300049824 Bacteria 4252
419 Ga0501045_0440601 3300049824 Archaea 969
420 nmdc:mga05p37_127560_c1 3300050507 Bacteria 3123
421 nmdc:mga05p37_456035_c1 3300050507 Bacteria 1478
422 nmdc:mga09592_52878_c1 3300050508 Bacteria 3428
423 nmdc:mga09592_620272_c1 3300050508 Unclassified 925
424 nmdc:mga0qj67_41238_c1 3300050509 Bacteria 3630
425 nmdc:mga08y16_491173_c1 3300050511 Bacteria 1248
426 nmdc:mga0n895_131403_c1 3300050512 Bacteria 2529
427 nmdc:mga0n895_346962_c1 3300050512 Bacteria 1503
428 nmdc:mga0n895_509467_c1 3300050512 Bacteria 1212
429 nmdc:mga0rr50_12096_c1 3300050513 Bacteria 5560
430 nmdc:mga08x19_207360_c1 3300050514 Bacteria 1345
431 nmdc:mga08x19_509361_c1 3300050514 Bacteria 850
432 nmdc:mga0a205_252834_c1 3300050515 Bacteria 1641
433 Ga0495601_0003255 3300053077 Bacteria 9276
434 Ga0495655_0160433 3300053083 Unclassified 713
435 Ga0495619_0074031 3300053085 Bacteria 2283
436 Ga0495619_0337008 3300053085 Unclassified 1044
437 Ga0500644_0028692 3300053088 Bacteria 1743
438 Ga0500583_0111780 3300053092 Bacteria 1346
439 Ga0501084_0117141 3300054114 Bacteria 2240
440 Ga0501084_0557482 3300054114 Bacteria 968
441 Ga0501082_0102863 3300060353 Bacteria 2471
442 Ga0501082_0302222 3300060353 Bacteria 1393
443 Ga0530510_0050061 3300061734 Bacteria 3017
444 Ga0530510_0077255 3300061734 Bacteria 2420
445 Ga0530510_0759352 3300061734 Bacteria 739
446 8008491076 8008485437 Bacteria 7198341
447 8025530405 8025524527 Bacteria 7197316
448 8055180865 8055172936 Bacteria 9305943
449 Ga0395899_0140475
450 JGI25407J50210_10002673
451 Ga0070683_100050302
452 Ga0070683_100054979
453 Ga0070683_100160573
454 Ga0070683_101433114
455 Ga0070680_100066970
456 Ga0070680_100437426
457 Ga0070680_100441716
458 Ga0070682_100117607
459 Ga0068868_100060979
460 Ga0068868_100201604
461 Ga0070660_100117071
462 Ga0070660_100293903
463 Ga0070689_100590191
464 Ga0070691_10042415
465 Ga0070687_100233801
466 Ga0070692_10029193
467 Ga0070669_100133168
468 Ga0070674_100262397
469 Ga0070659_100040043
470 Ga0070659_100052964
471 Ga0070714_100077212
472 Ga0070713_100947252
473 Ga0070700_100016125
474 Ga0070700_100230503
475 Ga0070694_100065435
476 Ga0070708_100167637
477 Ga0070708_100504806
478 Ga0070678_100171025
479 Ga0070662_100194831
480 Ga0070681_10006548
481 Ga0070681_10061828
482 Ga0070681_10116186
483 Ga0070681_10570968
484 Ga0068867_100076205
485 Ga0068867_100512864
486 Ga0070685_10145545
487 Ga0070685_10380874
488 Ga0070706_100033573
489 Ga0070707_100176414
490 Ga0070698_100013593
491 Ga0070679_100067971
492 Ga0070679_100158161
493 Ga0070684_100008254
494 Ga0070684_100012916
495 Ga0070684_100053100
496 Ga0070684_100133218
497 Ga0068853_100049585
498 Ga0070686_100039159
499 Ga0070695_100099285
500 Ga0070695_100210073
501 Ga0070696_100208281
502 Ga0070696_100903147
503 Ga0070693_100027128
504 Ga0068855_100047055
505 Ga0068855_100327911
506 Ga0068855_100646618
507 Ga0070664_100523234
508 Ga0068857_100032613
509 Ga0068854_100039624
510 Ga0068854_100070214
511 Ga0068854_100101874
512 Ga0068856_100019175
513 Ga0068856_100100706
514 Ga0068856_100125067
515 Ga0070702_100001591
516 Ga0070702_100577418
517 Ga0070702_100646849
518 Ga0068852_100143865
519 Ga0068859_100747266
520 Ga0068864_100638690
521 Ga0068864_100727860
522 Ga0068864_100771998
523 Ga0068866_10039868
524 Ga0068866_10148927
525 Ga0068861_100039555
526 Ga0068861_100167961
527 Ga0068861_100763459
528 Ga0068851_10415939
529 Ga0068860_100212858
530 Ga0068862_100141243
531 Ga0081455_10021556
532 Ga0081455_10259577
533 Ga0081538_10000842
534 Ga0081538_10000912
535 Ga0081538_10022572
536 Ga0081540_1004743
537 Ga0070712_100189389
538 Ga0075428_100000754
539 Ga0075430_100016256
540 Ga0075431_100013396
541 Ga0075434_100006528
542 Ga0075434_100238023
543 Ga0075434_100926701
544 Ga0075429_100019670
545 Ga0068865_100034914
546 Ga0075436_100105624
547 Ga0097620_100747283
548 Ga0075435_100096509
549 Ga0075435_100294599
550 Ga0105240_10042480
551 Ga0105240_11348619
552 Ga0105245_10035684
553 Ga0105245_10082284
554 Ga0105245_10108832
555 Ga0105245_10167961
556 Ga0105245_10508052
557 Ga0114129_10050614
558 Ga0114129_10138464
559 Ga0105243_10353671
560 Ga0105243_10416690
561 Ga0105241_10848921
562 Ga0105242_10034276
563 Ga0105242_10043996
564 Ga0105242_10193562
565 Ga0105248_10746523
566 Ga0105248_10945363
567 Ga0105237_10057355
568 Ga0105238_10056443
569 Ga0105249_11360561
570 Ga0105239_10309767
571 Ga0105239_10603569
572 Ga0105239_10666544
573 Ga0105239_10702044
574 Ga0105239_10716035
575 Ga0157344_1000488
576 Ga0157315_1015019
577 Ga0157371_10072788
578 Ga0157371_10225757
579 Ga0157370_10322639
580 Ga0157370_10861636
581 Ga0157369_10005749
582 Ga0157369_10017959
583 Ga0157369_10151210
584 Ga0157374_10613184
585 Ga0157378_10671695
586 Ga0163162_10075008
587 Ga0163162_10091657
588 Ga0157372_10051947
589 Ga0157372_10128222
590 Ga0157372_10221240
591 Ga0157372_10448485
592 Ga0157372_10464528
593 Ga0157375_10079143
594 Ga0157380_10098384
595 Ga0157377_10051284
596 Ga0157376_10359712
597 Ga0206356_11192362
598 Ga0207653_10058814
599 Ga0207642_10187442
600 Ga0207645_10114866
601 Ga0207707_10017499
602 Ga0207707_10065786
603 Ga0207707_10473759
604 Ga0207671_10477009
605 Ga0207663_10247425
606 Ga0207660_10113726
607 Ga0207660_10166092
608 Ga0207662_10083233
609 Ga0207657_10041487
610 Ga0207657_10118765
611 Ga0207649_10411755
612 Ga0207652_10103271
613 Ga0207652_10217256
614 Ga0207652_10250782
615 Ga0207646_10094197
616 Ga0207646_10321920
617 Ga0207681_10108549
618 Ga0207694_10164085
619 Ga0207687_10009719
620 Ga0207687_10012398
621 Ga0207687_10283715
622 Ga0207687_10309657
623 Ga0207687_10463213
624 Ga0207664_10357390
625 Ga0207644_10380596
626 Ga0207706_10006276
627 Ga0207706_10035051
628 Ga0207686_10043111
629 Ga0207686_10466783
630 Ga0207709_10007173
631 Ga0207709_10049040
632 Ga0207709_10146791
633 Ga0207709_10614988
634 Ga0207704_10240309
635 Ga0207691_10251964
636 Ga0207661_10000361
637 Ga0207661_10024586
638 Ga0207661_10091905
639 Ga0207679_10055427
640 Ga0207712_10110794
641 Ga0207712_10544975
642 Ga0207677_10087791
643 Ga0207703_10662213
644 Ga0207639_10941044
645 Ga0207702_10094461
646 Ga0207702_10104969
647 Ga0207702_10107491
648 Ga0207641_10757301
649 Ga0207648_10120268
650 Ga0207648_10406010
651 Ga0207675_100033818
652 Ga0207675_100073140
653 Ga0207683_10073787
654 Ga0207683_10185093
655 Ga0207683_10269914
656 Ga0307408_100138123
657 Ga0307412_10372698
658 Ga0307416_100154509
659 Ga0307416_100720368
660 Ga0307415_100000667
661 Ga0373944_0177809
662 Ga0373936_0168174
663 Ga0373956_0317239
664 Ga0373943_0002150
665 Ga0373933_0599218
666 Ga0373947_0015588
667 Ga0373937_0022732
668 Ga0373925_0887198
669 Ga0395899_0008819
670 Ga0395899_0011929
671 Ga0395899_0014087
672 Ga0395899_0035521
673 Ga0395899_0064180
674 Ga0395899_0119502
675 Ga0395899_0267275
676 Ga0395899_0397648
677 Ga0395899_0425306
678 Ga0395900_0020318
679 Ga0395900_0034341
680 Ga0395900_0035185
681 Ga0395900_0038647
682 Ga0395900_0055654
683 Ga0395900_0120965
684 Ga0395900_0153398
685 Ga0395900_0182677
686 Ga0395900_0228708
687 Ga0395900_0261910
688 Ga0395900_0742271
689 Ga0395900_0790667
690 Ga0395900_1004124
691 Ga0395898_0013489
692 Ga0395898_0034212
693 Ga0395898_0045029
694 Ga0395898_0055159
695 Ga0395898_0071587
696 Ga0395898_0078689
697 Ga0395898_0083171
698 Ga0395898_0095534
699 Ga0395898_0153162
700 Ga0395898_0193268
701 Ga0395898_0346669
702 Ga0395898_0786333
703 Ga0395905_0007407
704 Ga0395905_0011693
705 Ga0395905_0017612
706 Ga0395905_0020867
707 Ga0395905_0087679
708 Ga0395905_0170354
709 Ga0395905_0201783
710 Ga0395905_0585743
711 Ga0395905_0813187
712 Ga0395901_0010444
713 Ga0395901_0016389
714 Ga0395901_0016630
715 Ga0395901_0018829
716 Ga0395901_0029210
717 Ga0395901_0035908
718 Ga0395901_0055611
719 Ga0395901_0062187
720 Ga0395901_0191260
721 Ga0395901_0227269
722 Ga0395901_0236264
723 Ga0395901_0237897
724 Ga0395901_0300395
725 Ga0395901_0336997
726 Ga0395901_0501093
727 Ga0395901_0941112
728 Ga0451839_1001600
729 Ga0451853_3350646
730 Ga0439446_0050674
731 Ga0439434_0026429
732 Ga0439435_0129257
733 Ga0466963_0219830
734 Ga0466960_0024792
735 Ga0466960_0102083
736 Ga0466967_0033586
737 Ga0466967_0035317
738 Ga0466967_0925051
739 Ga0495592_0031557
740 Ga0495603_0050791
741 Ga0495603_0312218
742 Ga0495603_0476043
743 Ga0495651_0226303
744 Ga0495653_0025784
745 Ga0495582_0403147
746 Ga0495605_0338316
747 Ga0495639_0288477
748 Ga0495584_0069060
749 Ga0495584_0281104
750 Ga0495594_0000927
751 Ga0495596_0041222
752 Ga0495607_0105535
753 Ga0495608_0061669
754 Ga0495618_0218892
755 Ga0495618_0260550
756 Ga0495630_1275426
757 Ga0495631_0191352
758 Ga0495637_0037035
759 Ga0495644_0062516
760 Ga0495666_0113732
761 Ga0495652_0085904
762 Ga0495652_0485715
763 Ga0495665_0155493
764 Ga0495667_0106696
765 Ga0495656_0114849
766 Ga0495656_0147831
767 Ga0495656_0208394
768 Ga0495659_0029079
769 Ga0495659_0094276
770 Ga0495588_0019728
771 Ga0495657_0018170
772 Ga0495647_0023071
773 Ga0495613_0248790
774 Ga0495613_0287584
775 Ga0495600_0121735
776 Ga0495600_0251816
777 Ga0495581_0004011
778 Ga0495674_0087692
779 Ga0495674_0263936
780 Ga0495676_0082824
781 Ga0495676_0286918
782 Ga0495676_0437179
783 Ga0495684_0008103
784 Ga0495684_0290445
785 Ga0495626_0142226
786 Ga0496100_0680922
787 Ga0496100_0937503
788 Ga0496101_0610271
789 Ga0496101_0619297
790 Ga0496102_0124751
791 Ga0496102_0130686
792 Ga0496103_0100890
793 Ga0496103_0651406
794 Ga0496104_0076252
795 Ga0496105_0508587
796 Ga0496106_0011147
797 Ga0496106_0013301
798 Ga0496106_0158494
799 Ga0496107_0170758
800 Ga0496107_0535773
801 Ga0496108_0003773
802 Ga0496108_0012795
803 Ga0496108_0070063
804 Ga0496109_0060697
805 Ga0496109_0137873
806 Ga0496109_0165112
807 Ga0496109_0673415
808 Ga0496109_0849059
809 Ga0496110_0005488
810 Ga0496110_0088409
811 Ga0496111_0002525
812 Ga0496111_0007076
813 Ga0496111_0010655
814 Ga0496112_0318372
815 Ga0496112_0371942
816 Ga0496112_0992723
817 Ga0496113_0007206
818 Ga0496113_0164987
819 Ga0496114_0149115
820 Ga0496114_0309163
821 Ga0496115_0026906
822 Ga0496115_0162898
823 Ga0496115_0215902
824 Ga0496115_0228474
825 Ga0501031_0198475
826 Ga0501032_0008451
827 Ga0501033_0005974
828 Ga0501036_0524996
829 Ga0501037_0004521
830 Ga0501038_0002653
831 Ga0501038_0216734
832 Ga0501039_0038314
833 Ga0501039_0077225
834 Ga0501040_0155347
835 Ga0501041_0006321
836 Ga0501042_0029873
837 Ga0501042_0063594
838 Ga0501043_0005177
839 Ga0501046_0007204
840 Ga0501046_0200153
841 Ga0501048_0091279
842 Ga0501067_0049532
843 Ga0501068_0028621
844 Ga0501069_0011207
845 Ga0501069_0661720
846 Ga0501070_0015303
847 Ga0501071_0123201
848 Ga0501071_0126979
849 Ga0501071_0184523
850 Ga0501072_0015278
851 Ga0501072_0116040
852 Ga0501073_0105614
853 Ga0501074_0000617
854 Ga0501075_0066289
855 Ga0501075_0105766
856 Ga0501076_0077049
857 Ga0501076_0154777
858 Ga0501077_0019159
859 Ga0501077_0055676
860 Ga0501079_0016263
861 Ga0501079_0499245
862 Ga0501080_0002778
863 Ga0501080_0538983
864 Ga0501081_0015693
865 Ga0501083_0018883
866 Ga0501045_0025477
867 Ga0501045_0440601
868 nmdc:mga05p37_127560_c1
869 nmdc:mga05p37_456035_c1
870 nmdc:mga09592_52878_c1
871 nmdc:mga09592_620272_c1
872 nmdc:mga0qj67_41238_c1
873 nmdc:mga08y16_491173_c1
874 nmdc:mga0n895_131403_c1
875 nmdc:mga0n895_346962_c1
876 nmdc:mga0n895_509467_c1
877 nmdc:mga0rr50_12096_c1
878 nmdc:mga08x19_207360_c1
879 nmdc:mga08x19_509361_c1
880 nmdc:mga0a205_252834_c1
881 Ga0495601_0003255
882 Ga0495655_0160433
883 Ga0495619_0074031
884 Ga0495619_0337008
885 Ga0500644_0028692
886 Ga0500583_0111780
887 Ga0501084_0117141
888 Ga0501084_0557482
889 Ga0501082_0102863
890 Ga0501082_0302222
891 Ga0530510_0050061
892 Ga0530510_0077255
893 Ga0530510_0759352
894 8008491076
895 8025530405
896 8055180865

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20469

OLD-like_TOPRIM

Overcoming lysogenization defect protein-like, TOPRIM domain

36

100

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6njx-assembly1.cif.gz_A c-terminal region of the xanthomonas campestris pv. campestris old protein phased with mercury 0.7734 8 189
6njw-assembly1.cif.gz_A c-terminal region of the xanthomonas campestris pv. campestris old protein phased with platinum 0.7463 4 190
6njx-assembly1.cif.gz_A c-terminal region of the xanthomonas campestris pv. campestris old protein phased with mercury 0.7402 8 189
6njw-assembly1.cif.gz_A c-terminal region of the xanthomonas campestris pv. campestris old protein phased with platinum 0.732 4 190
6njv-assembly1.cif.gz_A c-terminal region of the xanthomonas campestris pv. campestris old protein phased with iodine 0.7302 8 189
ID Description Score Start End Superfamily
3h6hA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.6437 8 87 3.40.50.2300
af_Q2G084_1_135_3.40.50.10330 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.6392 5 87 3.40.50.10330
af_A0A0R0G7T5_250_359_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.5802 9 104 3.40.50.150
4rkrB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.5792 6 86 3.40.50.2300
2lv8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.5766 8 106 3.40.50.11230
ID Description Score Start End GO Terms
AF-W2F3F6-F1-model_v4 OLD protein-like TOPRIM domain-containing protein 0.9927 6 189
AF-A0A840W577-F1-model_v4 OLD protein-like TOPRIM domain-containing protein 0.9883 5 187
AF-A0A2A4KML3-F1-model_v4 OLD protein-like TOPRIM domain-containing protein 0.9875 7 190
AF-A0A3N4ZGB3-F1-model_v4 OLD protein-like TOPRIM domain-containing protein 0.9838 3 190
AF-A0A3N6I707-F1-model_v4 OLD protein-like TOPRIM domain-containing protein 0.9826 5 190

Map