F446157
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 448 | 226 | 448 | 189 |
Family's Representative Sequence
| Representative Sequence | 3300010375|Ga0105239_10032921|Ga0105239_100329213 |
| Length | 231 |
| Sequence | MATLSGKKVAIITENGFEESELTSPKKALEEAGAQVDIISPQQQKVKAWDHDHWSIELPVNVNIDMAKPEDYDALVIPGGVMNPDQMRMNTKCVEFAQRFLEEGKPIAAICHGPQLLIETGLINGRTMTSYWSLKTDLQNAGVDWVDKEVVVDNGLVTSRSPKDLPAFNKKMIEEIKEGTHAPSGVHSFAKTLAIELIPVSRSVRAGFFLVFFDFFEIIIRFYSCVKKFTG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 58 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 89 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 143 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 144 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 145 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 146 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 147 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 148 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 149 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 150 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 151 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 152 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 153 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 154 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 156 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 157 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 158 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 159 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 160 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 161 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 162 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 163 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 164 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 165 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 166 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 167 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 168 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 169 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 170 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 171 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 172 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 190 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 191 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 193 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 194 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 195 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 196 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 197 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 199 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 200 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 201 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 202 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 203 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 204 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 205 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 206 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 207 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 208 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 209 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 210 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 211 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 212 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 213 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 214 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 215 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 216 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 217 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 219 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 220 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 221 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 222 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 224 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 225 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 226 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.55 |
| Metatranscriptomes | 0.45 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.56 |
| Nodule | 0 |
| Rhizoplane | 1.79 |
| Rhizosphere | 96.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_12999027 | 2162886012 | Unclassified | 1679 |
| 2 | MBSR1b_contig_13755480 | 2162886012 | Unclassified | 1204 |
| 3 | ARcpr5yngRDRAFT_c003720 | 3300000043 | Bacteria | 1477 |
| 4 | JGI24744J21845_10014815 | 3300002077 | Bacteria | 1562 |
| 5 | rootL2_10101186 | 3300003322 | Bacteria | 5598 |
| 6 | rootH1_10239146 | 3300003323 | Bacteria | 3256 |
| 7 | Ga0065714_10016476 | 3300005288 | Unclassified | 1761 |
| 8 | Ga0065715_10009925 | 3300005293 | Bacteria | 2550 |
| 9 | Ga0070676_10000701 | 3300005328 | Bacteria | 16349 |
| 10 | Ga0070683_100000327 | 3300005329 | Bacteria | 32861 |
| 11 | Ga0070683_100025753 | 3300005329 | Bacteria | 5288 |
| 12 | Ga0070683_100170865 | 3300005329 | Bacteria | 2063 |
| 13 | Ga0070683_100424926 | 3300005329 | Bacteria | 1268 |
| 14 | Ga0070683_100989393 | 3300005329 | Bacteria | 807 |
| 15 | Ga0070690_100007060 | 3300005330 | Bacteria | 6408 |
| 16 | Ga0070690_100288837 | 3300005330 | Unclassified | 1172 |
| 17 | Ga0070670_100188351 | 3300005331 | Bacteria | 1792 |
| 18 | Ga0070670_100563728 | 3300005331 | Unclassified | 1017 |
| 19 | Ga0070670_100645097 | 3300005331 | Bacteria | 949 |
| 20 | Ga0068869_100126241 | 3300005334 | Bacteria | 1962 |
| 21 | Ga0068869_100141896 | 3300005334 | Unclassified | 1855 |
| 22 | Ga0068869_100150615 | 3300005334 | Bacteria | 1804 |
| 23 | Ga0068869_100388073 | 3300005334 | Bacteria | 1146 |
| 24 | Ga0068869_100848410 | 3300005334 | Bacteria | 788 |
| 25 | Ga0070666_10000571 | 3300005335 | Bacteria | 22346 |
| 26 | Ga0070666_10003150 | 3300005335 | Bacteria | 10017 |
| 27 | Ga0070666_10227166 | 3300005335 | Bacteria | 1318 |
| 28 | Ga0070666_10340500 | 3300005335 | Unclassified | 1072 |
| 29 | Ga0070682_100146006 | 3300005337 | Bacteria | 1618 |
| 30 | Ga0068868_100000112 | 3300005338 | Bacteria | 50817 |
| 31 | Ga0068868_100054664 | 3300005338 | Bacteria | 3147 |
| 32 | Ga0068868_100064855 | 3300005338 | Unclassified | 2900 |
| 33 | Ga0068868_100122970 | 3300005338 | Bacteria | 2117 |
| 34 | Ga0068868_100163318 | 3300005338 | Bacteria | 1841 |
| 35 | Ga0070660_100316253 | 3300005339 | Bacteria | 1282 |
| 36 | Ga0070660_100350986 | 3300005339 | Bacteria | 1215 |
| 37 | Ga0070689_100050956 | 3300005340 | Bacteria | 3198 |
| 38 | Ga0070689_100561548 | 3300005340 | Bacteria | 984 |
| 39 | Ga0070689_100819019 | 3300005340 | Bacteria | 820 |
| 40 | Ga0070661_100001786 | 3300005344 | Bacteria | 14912 |
| 41 | Ga0070661_100039375 | 3300005344 | Bacteria | 3444 |
| 42 | Ga0070661_100059364 | 3300005344 | Bacteria | 2804 |
| 43 | Ga0070661_100208146 | 3300005344 | Bacteria | 1496 |
| 44 | Ga0070661_100315772 | 3300005344 | Bacteria | 1219 |
| 45 | Ga0070668_100000110 | 3300005347 | Bacteria | 50766 |
| 46 | Ga0070668_100606509 | 3300005347 | Unclassified | 958 |
| 47 | Ga0070669_100165782 | 3300005353 | Unclassified | 1720 |
| 48 | Ga0070675_100056010 | 3300005354 | Bacteria | 3247 |
| 49 | Ga0070675_100060469 | 3300005354 | Bacteria | 3128 |
| 50 | Ga0070675_100137926 | 3300005354 | Bacteria | 2083 |
| 51 | Ga0070675_101007685 | 3300005354 | Bacteria | 765 |
| 52 | Ga0070671_100022762 | 3300005355 | Bacteria | 5119 |
| 53 | Ga0070671_100167619 | 3300005355 | Bacteria | 1857 |
| 54 | Ga0070671_100736866 | 3300005355 | Bacteria | 856 |
| 55 | Ga0070671_100896941 | 3300005355 | Bacteria | 774 |
| 56 | Ga0070674_100046613 | 3300005356 | Bacteria | 2966 |
| 57 | Ga0070674_100273104 | 3300005356 | Bacteria | 1337 |
| 58 | Ga0070674_100988157 | 3300005356 | Bacteria | 738 |
| 59 | Ga0070673_100001374 | 3300005364 | Bacteria | 14221 |
| 60 | Ga0070673_100015009 | 3300005364 | Bacteria | 5421 |
| 61 | Ga0070673_100049647 | 3300005364 | Unclassified | 3277 |
| 62 | Ga0070673_100968070 | 3300005364 | Unclassified | 791 |
| 63 | Ga0070688_100003958 | 3300005365 | Bacteria | 7681 |
| 64 | Ga0070688_100241515 | 3300005365 | Unclassified | 1282 |
| 65 | Ga0070659_100012802 | 3300005366 | Bacteria | 6228 |
| 66 | Ga0070659_100023860 | 3300005366 | Bacteria | 4685 |
| 67 | Ga0070659_100419250 | 3300005366 | Bacteria | 1132 |
| 68 | Ga0070667_100011085 | 3300005367 | Bacteria | 7457 |
| 69 | Ga0070667_100018912 | 3300005367 | Bacteria | 5712 |
| 70 | Ga0070667_100217478 | 3300005367 | Bacteria | 1700 |
| 71 | Ga0070667_100218342 | 3300005367 | Bacteria | 1696 |
| 72 | Ga0070663_100176331 | 3300005455 | Bacteria | 1655 |
| 73 | Ga0070663_100364528 | 3300005455 | Bacteria | 1173 |
| 74 | Ga0070678_100014347 | 3300005456 | Bacteria | 4997 |
| 75 | Ga0070678_100167177 | 3300005456 | Bacteria | 1788 |
| 76 | Ga0070662_100000209 | 3300005457 | Bacteria | 34168 |
| 77 | Ga0070662_100018140 | 3300005457 | Bacteria | 4757 |
| 78 | Ga0070662_100022389 | 3300005457 | Bacteria | 4327 |
| 79 | Ga0070662_100023895 | 3300005457 | Bacteria | 4205 |
| 80 | Ga0070662_100187419 | 3300005457 | Bacteria | 1634 |
| 81 | Ga0070662_100482828 | 3300005457 | Bacteria | 1032 |
| 82 | Ga0070681_11043683 | 3300005458 | Bacteria | 738 |
| 83 | Ga0068867_100000620 | 3300005459 | Bacteria | 23485 |
| 84 | Ga0068867_100320573 | 3300005459 | Bacteria | 1284 |
| 85 | Ga0068867_100981269 | 3300005459 | Bacteria | 765 |
| 86 | Ga0070685_10004060 | 3300005466 | Bacteria | 7394 |
| 87 | Ga0070685_10077042 | 3300005466 | Unclassified | 1990 |
| 88 | Ga0070685_10092852 | 3300005466 | Bacteria | 1829 |
| 89 | Ga0070679_100264055 | 3300005530 | Bacteria | 1677 |
| 90 | Ga0070684_100000290 | 3300005535 | Bacteria | 34902 |
| 91 | Ga0070684_100093509 | 3300005535 | Bacteria | 2676 |
| 92 | Ga0070684_100169563 | 3300005535 | Bacteria | 1982 |
| 93 | Ga0070684_100186628 | 3300005535 | Bacteria | 1886 |
| 94 | Ga0070684_100960463 | 3300005535 | Bacteria | 801 |
| 95 | Ga0068853_100021273 | 3300005539 | Bacteria | 5406 |
| 96 | Ga0068853_100083007 | 3300005539 | Bacteria | 2807 |
| 97 | Ga0068853_100153499 | 3300005539 | Bacteria | 2074 |
| 98 | Ga0068853_101216190 | 3300005539 | Bacteria | 727 |
| 99 | Ga0070672_100000020 | 3300005543 | Bacteria | 69277 |
| 100 | Ga0070672_100043662 | 3300005543 | Bacteria | 3458 |
| 101 | Ga0070672_100124319 | 3300005543 | Unclassified | 2115 |
| 102 | Ga0070686_100091651 | 3300005544 | Bacteria | 2034 |
| 103 | Ga0070693_100349389 | 3300005547 | Bacteria | 1012 |
| 104 | Ga0070665_100000014 | 3300005548 | Bacteria | 484881 |
| 105 | Ga0070665_100000318 | 3300005548 | Bacteria | 74326 |
| 106 | Ga0070665_100271077 | 3300005548 | Bacteria | 1699 |
| 107 | Ga0068855_100010786 | 3300005563 | Bacteria | 11030 |
| 108 | Ga0068855_100031935 | 3300005563 | Bacteria | 6286 |
| 109 | Ga0068855_100362439 | 3300005563 | Bacteria | 1595 |
| 110 | Ga0068855_101430697 | 3300005563 | Bacteria | 712 |
| 111 | Ga0070664_100012786 | 3300005564 | Bacteria | 6830 |
| 112 | Ga0070664_100134416 | 3300005564 | Bacteria | 2174 |
| 113 | Ga0070664_100197350 | 3300005564 | Bacteria | 1794 |
| 114 | Ga0070664_100231230 | 3300005564 | Bacteria | 1657 |
| 115 | Ga0070664_100388211 | 3300005564 | Bacteria | 1275 |
| 116 | Ga0070664_100495029 | 3300005564 | Unclassified | 1126 |
| 117 | Ga0068857_100004228 | 3300005577 | Bacteria | 12096 |
| 118 | Ga0068857_100008029 | 3300005577 | Bacteria | 9102 |
| 119 | Ga0068857_100056109 | 3300005577 | Bacteria | 3496 |
| 120 | Ga0068854_100053998 | 3300005578 | Bacteria | 2888 |
| 121 | Ga0068854_100486619 | 3300005578 | Unclassified | 1037 |
| 122 | Ga0068856_100009293 | 3300005614 | Bacteria | 9549 |
| 123 | Ga0068856_100061491 | 3300005614 | Bacteria | 3710 |
| 124 | Ga0070702_100259391 | 3300005615 | Bacteria | 1183 |
| 125 | Ga0068852_100003299 | 3300005616 | Bacteria | 11269 |
| 126 | Ga0068852_100084310 | 3300005616 | Bacteria | 2828 |
| 127 | Ga0068852_100442285 | 3300005616 | Bacteria | 1286 |
| 128 | Ga0068852_100872321 | 3300005616 | Bacteria | 916 |
| 129 | Ga0068859_100039445 | 3300005617 | Bacteria | 4737 |
| 130 | Ga0068859_100145631 | 3300005617 | Unclassified | 2443 |
| 131 | Ga0068859_100293037 | 3300005617 | Bacteria | 1720 |
| 132 | Ga0068859_100411300 | 3300005617 | Bacteria | 1449 |
| 133 | Ga0068859_100431885 | 3300005617 | Bacteria | 1413 |
| 134 | Ga0068864_100000934 | 3300005618 | Bacteria | 24494 |
| 135 | Ga0068864_100023861 | 3300005618 | Bacteria | 5140 |
| 136 | Ga0068866_10031831 | 3300005718 | Bacteria | 2545 |
| 137 | Ga0068861_100020234 | 3300005719 | Bacteria | 4762 |
| 138 | Ga0068861_100170740 | 3300005719 | Bacteria | 1802 |
| 139 | Ga0068851_10000510 | 3300005834 | Bacteria | 17001 |
| 140 | Ga0068851_10270415 | 3300005834 | Bacteria | 969 |
| 141 | Ga0068851_10292552 | 3300005834 | Bacteria | 934 |
| 142 | Ga0068863_100000678 | 3300005841 | Bacteria | 34425 |
| 143 | Ga0068863_100096527 | 3300005841 | Bacteria | 2806 |
| 144 | Ga0068863_100540921 | 3300005841 | Bacteria | 1149 |
| 145 | Ga0068858_100000342 | 3300005842 | Bacteria | 49465 |
| 146 | Ga0068858_100054812 | 3300005842 | Bacteria | 3687 |
| 147 | Ga0068858_100569470 | 3300005842 | Unclassified | 1097 |
| 148 | Ga0068860_100003056 | 3300005843 | Bacteria | 17285 |
| 149 | Ga0068862_100366946 | 3300005844 | Bacteria | 1339 |
| 150 | Ga0068862_100691905 | 3300005844 | Bacteria | 987 |
| 151 | Ga0081539_10010219 | 3300005985 | Bacteria | 7676 |
| 152 | Ga0075366_10028230 | 3300006195 | Bacteria | 3293 |
| 153 | Ga0097621_100052713 | 3300006237 | Bacteria | 3314 |
| 154 | Ga0097621_100064430 | 3300006237 | Bacteria | 3014 |
| 155 | Ga0097621_100218883 | 3300006237 | Bacteria | 1658 |
| 156 | Ga0068871_100007230 | 3300006358 | Bacteria | 7920 |
| 157 | Ga0068871_100121703 | 3300006358 | Unclassified | 2205 |
| 158 | Ga0068871_100123599 | 3300006358 | Bacteria | 2188 |
| 159 | Ga0068871_100149551 | 3300006358 | Bacteria | 1990 |
| 160 | Ga0068871_101157837 | 3300006358 | Bacteria | 724 |
| 161 | Ga0068865_100000289 | 3300006881 | Bacteria | 27735 |
| 162 | Ga0097620_100039443 | 3300006931 | Bacteria | 4737 |
| 163 | Ga0097620_100145632 | 3300006931 | Unclassified | 2443 |
| 164 | Ga0097620_100284907 | 3300006931 | Bacteria | 1745 |
| 165 | Ga0097620_100293056 | 3300006931 | Bacteria | 1720 |
| 166 | Ga0097620_100411277 | 3300006931 | Bacteria | 1449 |
| 167 | Ga0097620_100431876 | 3300006931 | Bacteria | 1413 |
| 168 | Ga0105240_10603071 | 3300009093 | Bacteria | 1209 |
| 169 | Ga0105240_11388710 | 3300009093 | Bacteria | 739 |
| 170 | Ga0105247_10207909 | 3300009101 | Bacteria | 1319 |
| 171 | Ga0114129_10004318 | 3300009147 | Bacteria | 20100 |
| 172 | Ga0105243_10030859 | 3300009148 | Bacteria | 4130 |
| 173 | Ga0105241_10235376 | 3300009174 | Bacteria | 1546 |
| 174 | Ga0105248_10833132 | 3300009177 | Bacteria | 1041 |
| 175 | Ga0105237_10016185 | 3300009545 | Bacteria | 7756 |
| 176 | Ga0105237_10104778 | 3300009545 | Bacteria | 2820 |
| 177 | Ga0105238_10042310 | 3300009551 | Bacteria | 4614 |
| 178 | Ga0105238_10084634 | 3300009551 | Bacteria | 3161 |
| 179 | Ga0105249_10021219 | 3300009553 | Bacteria | 5815 |
| 180 | Ga0105249_10077703 | 3300009553 | Bacteria | 3079 |
| 181 | Ga0105239_10032921 | 3300010375 | Bacteria | 5695 |
| 182 | Ga0105239_10056067 | 3300010375 | Bacteria | 4322 |
| 183 | Ga0105239_10072285 | 3300010375 | Bacteria | 3791 |
| 184 | Ga0105239_10695295 | 3300010375 | Unclassified | 1162 |
| 185 | Ga0105246_10075512 | 3300011119 | Bacteria | 2386 |
| 186 | Ga0157373_10014397 | 3300013100 | Bacteria | 5798 |
| 187 | Ga0157373_10168447 | 3300013100 | Bacteria | 1542 |
| 188 | Ga0157373_10495992 | 3300013100 | Bacteria | 882 |
| 189 | Ga0157371_10105000 | 3300013102 | Bacteria | 2004 |
| 190 | Ga0157371_10337681 | 3300013102 | Bacteria | 1095 |
| 191 | Ga0157369_10148752 | 3300013105 | Bacteria | 2475 |
| 192 | Ga0157369_10605526 | 3300013105 | Bacteria | 1131 |
| 193 | Ga0157374_10000745 | 3300013296 | Bacteria | 28347 |
| 194 | Ga0157374_10002159 | 3300013296 | Bacteria | 16586 |
| 195 | Ga0157374_10028707 | 3300013296 | Bacteria | 5028 |
| 196 | Ga0157374_10040401 | 3300013296 | Bacteria | 4296 |
| 197 | Ga0157374_10652400 | 3300013296 | Bacteria | 1064 |
| 198 | Ga0157378_10022980 | 3300013297 | Bacteria | 5489 |
| 199 | Ga0157378_10042681 | 3300013297 | Bacteria | 4025 |
| 200 | Ga0157378_10081940 | 3300013297 | Bacteria | 2917 |
| 201 | Ga0157378_10237762 | 3300013297 | Unclassified | 1739 |
| 202 | Ga0163162_10000544 | 3300013306 | Bacteria | 34854 |
| 203 | Ga0163162_10001237 | 3300013306 | Bacteria | 23878 |
| 204 | Ga0163162_10005247 | 3300013306 | Bacteria | 12489 |
| 205 | Ga0163162_10010645 | 3300013306 | Bacteria | 8945 |
| 206 | Ga0163162_10023789 | 3300013306 | Bacteria | 6046 |
| 207 | Ga0163162_10146250 | 3300013306 | Bacteria | 2480 |
| 208 | Ga0163162_10210054 | 3300013306 | Bacteria | 2076 |
| 209 | Ga0163162_10530671 | 3300013306 | Bacteria | 1306 |
| 210 | Ga0157372_10115180 | 3300013307 | Bacteria | 3082 |
| 211 | Ga0157372_10168419 | 3300013307 | Bacteria | 2534 |
| 212 | Ga0157375_10000821 | 3300013308 | Bacteria | 27183 |
| 213 | Ga0157375_10019807 | 3300013308 | Bacteria | 6131 |
| 214 | Ga0157375_10023937 | 3300013308 | Bacteria | 5643 |
| 215 | Ga0157375_10076269 | 3300013308 | Bacteria | 3379 |
| 216 | Ga0157375_10354455 | 3300013308 | Bacteria | 1633 |
| 217 | Ga0157375_10454802 | 3300013308 | Unclassified | 1446 |
| 218 | Ga0157375_10823093 | 3300013308 | Bacteria | 1076 |
| 219 | Ga0157375_11203075 | 3300013308 | Bacteria | 889 |
| 220 | Ga0163163_10000963 | 3300014325 | Bacteria | 24470 |
| 221 | Ga0163163_10001217 | 3300014325 | Bacteria | 21766 |
| 222 | Ga0163163_10240113 | 3300014325 | Bacteria | 1861 |
| 223 | Ga0157380_10029165 | 3300014326 | Bacteria | 4216 |
| 224 | Ga0157377_10025646 | 3300014745 | Bacteria | 3146 |
| 225 | Ga0157379_10000115 | 3300014968 | Bacteria | 55499 |
| 226 | Ga0157379_10028680 | 3300014968 | Bacteria | 4950 |
| 227 | Ga0157379_10044130 | 3300014968 | Bacteria | 3980 |
| 228 | Ga0157376_10001273 | 3300014969 | Bacteria | 16559 |
| 229 | Ga0157376_11106447 | 3300014969 | Bacteria | 818 |
| 230 | Ga0157376_11394480 | 3300014969 | Bacteria | 732 |
| 231 | Ga0163161_10011605 | 3300017792 | Bacteria | 6117 |
| 232 | Ga0163161_10020617 | 3300017792 | Bacteria | 4628 |
| 233 | Ga0163161_10024139 | 3300017792 | Bacteria | 4294 |
| 234 | Ga0163161_10149103 | 3300017792 | Bacteria | 1776 |
| 235 | Ga0206355_1678078 | 3300020076 | Bacteria | 621 |
| 236 | Ga0206352_10149106 | 3300020078 | Bacteria | 1070 |
| 237 | Ga0207697_10035782 | 3300025315 | Bacteria | 2033 |
| 238 | Ga0207656_10001238 | 3300025321 | Bacteria | 8444 |
| 239 | Ga0207656_10308247 | 3300025321 | Bacteria | 784 |
| 240 | Ga0207642_10253825 | 3300025899 | Bacteria | 999 |
| 241 | Ga0207710_10130731 | 3300025900 | Bacteria | 1205 |
| 242 | Ga0207688_10757733 | 3300025901 | Bacteria | 615 |
| 243 | Ga0207680_10001588 | 3300025903 | Bacteria | 10724 |
| 244 | Ga0207680_10024314 | 3300025903 | Bacteria | 3323 |
| 245 | Ga0207647_10071936 | 3300025904 | Unclassified | 2086 |
| 246 | Ga0207685_10131319 | 3300025905 | Bacteria | 1112 |
| 247 | Ga0207645_10001661 | 3300025907 | Bacteria | 18125 |
| 248 | Ga0207645_10006830 | 3300025907 | Bacteria | 8141 |
| 249 | Ga0207643_10214809 | 3300025908 | Bacteria | 1175 |
| 250 | Ga0207705_10003873 | 3300025909 | Bacteria | 11386 |
| 251 | Ga0207705_10322352 | 3300025909 | Bacteria | 1187 |
| 252 | Ga0207654_10350379 | 3300025911 | Unclassified | 1016 |
| 253 | Ga0207695_10301536 | 3300025913 | Bacteria | 1493 |
| 254 | Ga0207695_10997690 | 3300025913 | Bacteria | 717 |
| 255 | Ga0207660_10100766 | 3300025917 | Bacteria | 2157 |
| 256 | Ga0207657_10002187 | 3300025919 | Bacteria | 21179 |
| 257 | Ga0207657_10224135 | 3300025919 | Bacteria | 1505 |
| 258 | Ga0207649_10007347 | 3300025920 | Bacteria | 5996 |
| 259 | Ga0207649_10172413 | 3300025920 | Bacteria | 1508 |
| 260 | Ga0207649_10269816 | 3300025920 | Bacteria | 1233 |
| 261 | Ga0207649_10444796 | 3300025920 | Bacteria | 977 |
| 262 | Ga0207649_10948991 | 3300025920 | Bacteria | 676 |
| 263 | Ga0207652_10021029 | 3300025921 | Bacteria | 5382 |
| 264 | Ga0207681_10144216 | 3300025923 | Unclassified | 1777 |
| 265 | Ga0207650_10556579 | 3300025925 | Bacteria | 962 |
| 266 | Ga0207650_10733809 | 3300025925 | Bacteria | 835 |
| 267 | Ga0207659_10066736 | 3300025926 | Bacteria | 2612 |
| 268 | Ga0207659_10085336 | 3300025926 | Unclassified | 2346 |
| 269 | Ga0207659_10395306 | 3300025926 | Bacteria | 1155 |
| 270 | Ga0207659_10798363 | 3300025926 | Bacteria | 811 |
| 271 | Ga0207644_10168073 | 3300025931 | Bacteria | 1710 |
| 272 | Ga0207644_10186050 | 3300025931 | Bacteria | 1631 |
| 273 | Ga0207644_10857209 | 3300025931 | Bacteria | 761 |
| 274 | Ga0207690_10028866 | 3300025932 | Bacteria | 3520 |
| 275 | Ga0207690_10040164 | 3300025932 | Bacteria | 3057 |
| 276 | Ga0207706_10002357 | 3300025933 | Bacteria | 18449 |
| 277 | Ga0207706_10003474 | 3300025933 | Bacteria | 15037 |
| 278 | Ga0207706_10012403 | 3300025933 | Bacteria | 7765 |
| 279 | Ga0207706_10031091 | 3300025933 | Bacteria | 4758 |
| 280 | Ga0207706_10057463 | 3300025933 | Bacteria | 3428 |
| 281 | Ga0207706_10323498 | 3300025933 | Bacteria | 1342 |
| 282 | Ga0207709_10062070 | 3300025935 | Bacteria | 2337 |
| 283 | Ga0207670_10046308 | 3300025936 | Bacteria | 2889 |
| 284 | Ga0207670_10355752 | 3300025936 | Bacteria | 1161 |
| 285 | Ga0207669_10183411 | 3300025937 | Bacteria | 1503 |
| 286 | Ga0207704_10068755 | 3300025938 | Bacteria | 2234 |
| 287 | Ga0207691_10000322 | 3300025940 | Bacteria | 47690 |
| 288 | Ga0207691_10104485 | 3300025940 | Bacteria | 2524 |
| 289 | Ga0207689_10000843 | 3300025942 | Bacteria | 29516 |
| 290 | Ga0207689_10024937 | 3300025942 | Bacteria | 5012 |
| 291 | Ga0207689_10047264 | 3300025942 | Bacteria | 3555 |
| 292 | Ga0207661_10000411 | 3300025944 | Bacteria | 27626 |
| 293 | Ga0207661_10113795 | 3300025944 | Bacteria | 2293 |
| 294 | Ga0207661_10270276 | 3300025944 | Bacteria | 1517 |
| 295 | Ga0207679_10000297 | 3300025945 | Bacteria | 37427 |
| 296 | Ga0207679_10000800 | 3300025945 | Bacteria | 20460 |
| 297 | Ga0207679_10197769 | 3300025945 | Bacteria | 1677 |
| 298 | Ga0207679_10362139 | 3300025945 | Bacteria | 1267 |
| 299 | Ga0207667_10059429 | 3300025949 | Bacteria | 4004 |
| 300 | Ga0207667_10225165 | 3300025949 | Bacteria | 1921 |
| 301 | Ga0207667_10452703 | 3300025949 | Bacteria | 1304 |
| 302 | Ga0207667_10623450 | 3300025949 | Bacteria | 1086 |
| 303 | Ga0207651_10000542 | 3300025960 | Bacteria | 15834 |
| 304 | Ga0207651_10105635 | 3300025960 | Bacteria | 2101 |
| 305 | Ga0207651_10126978 | 3300025960 | Bacteria | 1945 |
| 306 | Ga0207712_10003158 | 3300025961 | Bacteria | 10509 |
| 307 | Ga0207712_10115036 | 3300025961 | Bacteria | 2024 |
| 308 | Ga0207712_10225069 | 3300025961 | Bacteria | 1502 |
| 309 | Ga0207668_10000344 | 3300025972 | Bacteria | 30213 |
| 310 | Ga0207640_10374820 | 3300025981 | Bacteria | 1151 |
| 311 | Ga0207658_10001922 | 3300025986 | Bacteria | 15507 |
| 312 | Ga0207658_10149441 | 3300025986 | Bacteria | 1901 |
| 313 | Ga0207658_10201360 | 3300025986 | Bacteria | 1662 |
| 314 | Ga0207677_10000816 | 3300026023 | Bacteria | 17807 |
| 315 | Ga0207677_10000848 | 3300026023 | Bacteria | 17486 |
| 316 | Ga0207703_10002680 | 3300026035 | Bacteria | 15290 |
| 317 | Ga0207639_10131486 | 3300026041 | Bacteria | 2072 |
| 318 | Ga0207678_10057790 | 3300026067 | Bacteria | 3338 |
| 319 | Ga0207708_10265347 | 3300026075 | Bacteria | 1387 |
| 320 | Ga0207702_10028070 | 3300026078 | Bacteria | 4676 |
| 321 | Ga0207702_10157602 | 3300026078 | Unclassified | 2071 |
| 322 | Ga0207702_10381288 | 3300026078 | Bacteria | 1356 |
| 323 | Ga0207641_10003266 | 3300026088 | Bacteria | 14436 |
| 324 | Ga0207641_10081272 | 3300026088 | Bacteria | 2814 |
| 325 | Ga0207648_10002849 | 3300026089 | Bacteria | 18310 |
| 326 | Ga0207648_10017663 | 3300026089 | Bacteria | 6479 |
| 327 | Ga0207648_10131586 | 3300026089 | Bacteria | 2202 |
| 328 | Ga0207648_10196939 | 3300026089 | Bacteria | 1786 |
| 329 | Ga0207648_10453554 | 3300026089 | Unclassified | 1168 |
| 330 | Ga0207676_10004554 | 3300026095 | Bacteria | 9814 |
| 331 | Ga0207676_10132493 | 3300026095 | Bacteria | 2121 |
| 332 | Ga0207676_10241621 | 3300026095 | Bacteria | 1620 |
| 333 | Ga0207674_10010469 | 3300026116 | Bacteria | 10500 |
| 334 | Ga0207674_10036670 | 3300026116 | Bacteria | 5105 |
| 335 | Ga0207674_10768469 | 3300026116 | Unclassified | 930 |
| 336 | Ga0207675_100030222 | 3300026118 | Bacteria | 5045 |
| 337 | Ga0207675_100170440 | 3300026118 | Bacteria | 2080 |
| 338 | Ga0207675_100228396 | 3300026118 | Bacteria | 1795 |
| 339 | Ga0207675_101308034 | 3300026118 | Unclassified | 745 |
| 340 | Ga0207683_10045179 | 3300026121 | Bacteria | 3851 |
| 341 | Ga0207683_10816341 | 3300026121 | Bacteria | 866 |
| 342 | Ga0207698_10042140 | 3300026142 | Bacteria | 3408 |
| 343 | Ga0207698_10405895 | 3300026142 | Bacteria | 1303 |
| 344 | Ga0207698_11004020 | 3300026142 | Bacteria | 845 |
| 345 | Ga0268266_10000068 | 3300028379 | Bacteria | 241100 |
| 346 | Ga0268266_10442499 | 3300028379 | Bacteria | 1234 |
| 347 | Ga0268264_10001597 | 3300028381 | Bacteria | 20969 |
| 348 | Ga0268264_10132515 | 3300028381 | Bacteria | 2212 |
| 349 | Ga0268264_11289523 | 3300028381 | Bacteria | 740 |
| 350 | Ga0307408_100152060 | 3300031548 | Bacteria | 1828 |
| 351 | Ga0307413_10012537 | 3300031824 | Bacteria | 4223 |
| 352 | Ga0307410_10294264 | 3300031852 | Bacteria | 1279 |
| 353 | Ga0307406_10071038 | 3300031901 | Bacteria | 2281 |
| 354 | Ga0307407_10068208 | 3300031903 | Bacteria | 2106 |
| 355 | Ga0307409_100122558 | 3300031995 | Bacteria | 2205 |
| 356 | Ga0307416_100002426 | 3300032002 | Bacteria | 10699 |
| 357 | Ga0307414_10142426 | 3300032004 | Unclassified | 1879 |
| 358 | Ga0307415_100009221 | 3300032126 | Bacteria | 5516 |
| 359 | Ga0373943_0119379 | 3300035170 | Unclassified | 1400 |
| 360 | Ga0373933_0597127 | 3300035724 | Bacteria | 725 |
| 361 | Ga0373947_0281659 | 3300035725 | Bacteria | 1105 |
| 362 | Ga0373937_0075608 | 3300036401 | Bacteria | 3110 |
| 363 | Ga0373937_0254094 | 3300036401 | Bacteria | 1657 |
| 364 | Ga0439466_0118144 | 3300041411 | Bacteria | 820 |
| 365 | Ga0451793_1613459 | 3300041452 | Bacteria | 793 |
| 366 | Ga0451807_2096905 | 3300041486 | Unclassified | 2034 |
| 367 | Ga0439431_0098794 | 3300041997 | Unclassified | 801 |
| 368 | Ga0439433_0050230 | 3300041999 | Unclassified | 982 |
| 369 | Ga0439445_0015735 | 3300042004 | Bacteria | 1856 |
| 370 | Ga0439432_024415 | 3300042006 | Bacteria | 1987 |
| 371 | Ga0439457_057114 | 3300042014 | Bacteria | 881 |
| 372 | Ga0450894_001329 | 3300042131 | Bacteria | 3586 |
| 373 | Ga0450898_015679 | 3300042134 | Bacteria | 1286 |
| 374 | Ga0466969_0000272 | 3300044656 | Bacteria | 28299 |
| 375 | Ga0466966_0003376 | 3300044684 | Bacteria | 10522 |
| 376 | Ga0466961_0067208 | 3300044693 | Bacteria | 2277 |
| 377 | Ga0466968_0138719 | 3300044735 | Bacteria | 1111 |
| 378 | Ga0466957_0000084 | 3300044842 | Bacteria | 37711 |
| 379 | Ga0466959_0000035 | 3300045049 | Bacteria | 108669 |
| 380 | Ga0466967_0351470 | 3300045976 | Bacteria | 1427 |
| 381 | Ga0495638_0073639 | 3300046460 | Unclassified | 2084 |
| 382 | Ga0495580_0081256 | 3300046472 | Bacteria | 2259 |
| 383 | Ga0495664_0512642 | 3300046477 | Unclassified | 716 |
| 384 | Ga0495630_0035066 | 3300046517 | Bacteria | 3750 |
| 385 | Ga0495648_0004762 | 3300046524 | Bacteria | 11487 |
| 386 | Ga0495652_0449950 | 3300046529 | Bacteria | 902 |
| 387 | Ga0495586_0101882 | 3300046535 | Bacteria | 1594 |
| 388 | Ga0495633_0096307 | 3300046558 | Bacteria | 1375 |
| 389 | Ga0495667_0233578 | 3300046559 | Bacteria | 1172 |
| 390 | Ga0495668_0001009 | 3300046616 | Bacteria | 30239 |
| 391 | Ga0495668_0002730 | 3300046616 | Bacteria | 14136 |
| 392 | Ga0495611_0023055 | 3300046648 | Unclassified | 2698 |
| 393 | Ga0495611_0242061 | 3300046648 | Bacteria | 837 |
| 394 | Ga0495635_0272902 | 3300046663 | Bacteria | 1137 |
| 395 | Ga0495657_0329232 | 3300046675 | Bacteria | 907 |
| 396 | Ga0495647_0166544 | 3300046681 | Bacteria | 952 |
| 397 | Ga0495670_0129687 | 3300046691 | Bacteria | 1314 |
| 398 | Ga0495684_0570236 | 3300047471 | Unclassified | 768 |
| 399 | Ga0495602_0486720 | 3300048088 | Bacteria | 865 |
| 400 | Ga0496106_0945410 | 3300048909 | Unclassified | 679 |
| 401 | Ga0496108_0068293 | 3300048911 | Bacteria | 2999 |
| 402 | Ga0496109_0020712 | 3300048912 | Bacteria | 5808 |
| 403 | Ga0496110_0041814 | 3300048913 | Bacteria | 4001 |
| 404 | Ga0496110_0470326 | 3300048913 | Bacteria | 1145 |
| 405 | Ga0496115_0316653 | 3300048918 | Bacteria | 1277 |
| 406 | Ga0501290_018791 | 3300049513 | Bacteria | 934 |
| 407 | Ga0501292_005148 | 3300049515 | Bacteria | 1813 |
| 408 | Ga0501298_004839 | 3300049521 | Bacteria | 2141 |
| 409 | Ga0501034_0000007 | 3300049571 | Bacteria | 357805 |
| 410 | Ga0501198_003948 | 3300049649 | Bacteria | 2047 |
| 411 | Ga0501201_001790 | 3300049651 | Bacteria | 1990 |
| 412 | Ga0501201_002348 | 3300049651 | Bacteria | 1732 |
| 413 | Ga0501202_000359 | 3300049652 | Bacteria | 6357 |
| 414 | Ga0501202_005281 | 3300049652 | Bacteria | 2288 |
| 415 | Ga0501206_015383 | 3300049653 | Unclassified | 1058 |
| 416 | Ga0501207_004502 | 3300049654 | Bacteria | 1898 |
| 417 | Ga0501217_000190 | 3300049661 | Bacteria | 9148 |
| 418 | Ga0501217_054965 | 3300049661 | Unclassified | 1050 |
| 419 | Ga0501222_000546 | 3300049662 | Bacteria | 5580 |
| 420 | Ga0501223_001006 | 3300049663 | Bacteria | 6666 |
| 421 | Ga0501223_011271 | 3300049663 | Bacteria | 1794 |
| 422 | Ga0501223_062350 | 3300049663 | Bacteria | 729 |
| 423 | Ga0501224_023425 | 3300049664 | Bacteria | 922 |
| 424 | Ga0501227_036874 | 3300049665 | Bacteria | 1195 |
| 425 | Ga0501233_005667 | 3300049668 | Bacteria | 2321 |
| 426 | Ga0501235_008871 | 3300049669 | Bacteria | 2193 |
| 427 | Ga0501235_009105 | 3300049669 | Bacteria | 2169 |
| 428 | Ga0501235_099344 | 3300049669 | Viruses | 709 |
| 429 | Ga0501242_003418 | 3300049674 | Unclassified | 1717 |
| 430 | Ga0501243_000818 | 3300049675 | Bacteria | 4320 |
| 431 | Ga0501250_013190 | 3300049680 | Bacteria | 988 |
| 432 | Ga0501253_046499 | 3300049683 | Unclassified | 895 |
| 433 | Ga0501261_001267 | 3300049690 | Bacteria | 3101 |
| 434 | Ga0501221_000013 | 3300049704 | Bacteria | 22152 |
| 435 | Ga0501221_040815 | 3300049704 | Unclassified | 1011 |
| 436 | Ga0501225_0001754 | 3300049705 | Bacteria | 6799 |
| 437 | Ga0501225_0003389 | 3300049705 | Bacteria | 4841 |
| 438 | Ga0501080_0371098 | 3300049742 | Bacteria | 1290 |
| 439 | Ga0501263_008395 | 3300049760 | Bacteria | 1232 |
| 440 | Ga0501273_011393 | 3300049770 | Unclassified | 1107 |
| 441 | Ga0501212_000331 | 3300049851 | Bacteria | 4411 |
| 442 | nmdc:mga0k408_191753_c1 | 3300050493 | Unclassified | 1219 |
| 443 | nmdc:mga05p37_16679_c1 | 3300050507 | Bacteria | 7131 |
| 444 | Ga0500583_0001086 | 3300053092 | Bacteria | 7766 |
| 445 | Ga0500568_0000335 | 3300053139 | Bacteria | 37064 |
| 446 | Ga0500568_0171066 | 3300053139 | Bacteria | 800 |
| 447 | Ga0500622_0000398 | 3300053156 | Bacteria | 41643 |
| 448 | Ga0500611_000003 | 3300053727 | Bacteria | 333431 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009551 | Ga0105238_10042310 | Ga0105238_100423103 | 177 |
| 2 | 3300010375 | Ga0105239_10072285 | Ga0105239_100722854 | 177 |
| 3 | 3300046524 | Ga0495648_0004762 | Ga0495648_0004762_1040_1624 | 183 |
| 4 | 3300046648 | Ga0495611_0023055 | Ga0495611_0023055_1961_2545 | 183 |
| 5 | 3300053092 | Ga0500583_0001086 | Ga0500583_0001086_3349_3933 | 183 |
| 6 | 3300053156 | Ga0500622_0000398 | Ga0500622_0000398_23338_23922 | 183 |
| 7 | 3300005334 | Ga0068869_100388073 | Ga0068869_1003880731 | 184 |
| 8 | 3300005539 | Ga0068853_101216190 | Ga0068853_1012161901 | 184 |
| 9 | 3300005577 | Ga0068857_100056109 | Ga0068857_1000561094 | 184 |
| 10 | 3300005617 | Ga0068859_100411300 | Ga0068859_1004113002 | 184 |
| 11 | 3300006931 | Ga0097620_100411277 | Ga0097620_1004112772 | 184 |
| 12 | 3300005356 | Ga0070674_100046613 | Ga0070674_1000466132 | 185 |
| 13 | 3300005457 | Ga0070662_100482828 | Ga0070662_1004828281 | 185 |
| 14 | 3300009553 | Ga0105249_10021219 | Ga0105249_100212191 | 185 |
| 15 | 3300025961 | Ga0207712_10115036 | Ga0207712_101150361 | 185 |
| 16 | 3300005329 | Ga0070683_100170865 | Ga0070683_1001708652 | 186 |
| 17 | 3300005334 | Ga0068869_100848410 | Ga0068869_1008484101 | 186 |
| 18 | 3300005338 | Ga0068868_100122970 | Ga0068868_1001229702 | 186 |
| 19 | 3300005344 | Ga0070661_100208146 | Ga0070661_1002081461 | 186 |
| 20 | 3300005347 | Ga0070668_100606509 | Ga0070668_1006065091 | 186 |
| 21 | 3300005354 | Ga0070675_100056010 | Ga0070675_1000560102 | 186 |
| 22 | 3300005354 | Ga0070675_100137926 | Ga0070675_1001379262 | 186 |
| 23 | 3300005355 | Ga0070671_100167619 | Ga0070671_1001676192 | 186 |
| 24 | 3300005366 | Ga0070659_100012802 | Ga0070659_1000128029 | 186 |
| 25 | 3300005455 | Ga0070663_100364528 | Ga0070663_1003645282 | 186 |
| 26 | 3300005458 | Ga0070681_11043683 | Ga0070681_110436831 | 186 |
| 27 | 3300005459 | Ga0068867_100981269 | Ga0068867_1009812691 | 186 |
| 28 | 3300005535 | Ga0070684_100169563 | Ga0070684_1001695632 | 186 |
| 29 | 3300005564 | Ga0070664_100197350 | Ga0070664_1001973502 | 186 |
| 30 | 3300005614 | Ga0068856_100009293 | Ga0068856_1000092935 | 186 |
| 31 | 3300005834 | Ga0068851_10270415 | Ga0068851_102704153 | 186 |
| 32 | 3300006237 | Ga0097621_100218883 | Ga0097621_1002188831 | 186 |
| 33 | 3300013100 | Ga0157373_10014397 | Ga0157373_100143974 | 186 |
| 34 | 3300013100 | Ga0157373_10168447 | Ga0157373_101684472 | 186 |
| 35 | 3300013102 | Ga0157371_10105000 | Ga0157371_101050002 | 186 |
| 36 | 3300013296 | Ga0157374_10652400 | Ga0157374_106524001 | 186 |
| 37 | 3300013297 | Ga0157378_10081940 | Ga0157378_100819407 | 186 |
| 38 | 3300013306 | Ga0163162_10005247 | Ga0163162_1000524710 | 186 |
| 39 | 3300013306 | Ga0163162_10210054 | Ga0163162_102100542 | 186 |
| 40 | 3300013308 | Ga0157375_10454802 | Ga0157375_104548021 | 186 |
| 41 | 3300020078 | Ga0206352_10149106 | Ga0206352_101491062 | 186 |
| 42 | 3300025321 | Ga0207656_10308247 | Ga0207656_103082471 | 186 |
| 43 | 3300025909 | Ga0207705_10322352 | Ga0207705_103223521 | 186 |
| 44 | 3300025917 | Ga0207660_10100766 | Ga0207660_101007662 | 186 |
| 45 | 3300025919 | Ga0207657_10002187 | Ga0207657_1000218717 | 186 |
| 46 | 3300025920 | Ga0207649_10444796 | Ga0207649_104447962 | 186 |
| 47 | 3300025921 | Ga0207652_10021029 | Ga0207652_100210298 | 186 |
| 48 | 3300025925 | Ga0207650_10556579 | Ga0207650_105565792 | 186 |
| 49 | 3300025926 | Ga0207659_10798363 | Ga0207659_107983631 | 186 |
| 50 | 3300025931 | Ga0207644_10168073 | Ga0207644_101680732 | 186 |
| 51 | 3300025932 | Ga0207690_10040164 | Ga0207690_100401643 | 186 |
| 52 | 3300025933 | Ga0207706_10002357 | Ga0207706_100023574 | 186 |
| 53 | 3300025949 | Ga0207667_10452703 | Ga0207667_104527032 | 186 |
| 54 | 3300025981 | Ga0207640_10374820 | Ga0207640_103748203 | 186 |
| 55 | 3300026041 | Ga0207639_10131486 | Ga0207639_101314863 | 186 |
| 56 | 3300026078 | Ga0207702_10028070 | Ga0207702_100280708 | 186 |
| 57 | 3300026089 | Ga0207648_10453554 | Ga0207648_104535541 | 186 |
| 58 | 3300026142 | Ga0207698_11004020 | Ga0207698_110040201 | 186 |
| 59 | 3300045976 | Ga0466967_0351470 | Ga0466967_0351470_545_1105 | 186 |
| 60 | 3300049571 | Ga0501034_0000007 | Ga0501034_0000007_97202_97762 | 186 |
| 61 | 3300053139 | Ga0500568_0171066 | Ga0500568_0171066_45_617 | 186 |
| 62 | 3300000043 | ARcpr5yngRDRAFT_c003720 | ARcpr5yngRDRAFT_0037202 | 187 |
| 63 | 3300002077 | JGI24744J21845_10014815 | JGI24744J21845_100148152 | 187 |
| 64 | 3300003322 | rootL2_10101186 | rootL2_101011863 | 187 |
| 65 | 3300003323 | rootH1_10239146 | rootH1_102391466 | 187 |
| 66 | 3300005328 | Ga0070676_10000701 | Ga0070676_100007015 | 187 |
| 67 | 3300005329 | Ga0070683_100000327 | Ga0070683_1000003274 | 187 |
| 68 | 3300005329 | Ga0070683_100025753 | Ga0070683_1000257532 | 187 |
| 69 | 3300005329 | Ga0070683_100424926 | Ga0070683_1004249262 | 187 |
| 70 | 3300005329 | Ga0070683_100989393 | Ga0070683_1009893932 | 187 |
| 71 | 3300005330 | Ga0070690_100007060 | Ga0070690_1000070603 | 187 |
| 72 | 3300005330 | Ga0070690_100288837 | Ga0070690_1002888371 | 187 |
| 73 | 3300005331 | Ga0070670_100645097 | Ga0070670_1006450972 | 187 |
| 74 | 3300005334 | Ga0068869_100126241 | Ga0068869_1001262413 | 187 |
| 75 | 3300005334 | Ga0068869_100141896 | Ga0068869_1001418963 | 187 |
| 76 | 3300005334 | Ga0068869_100150615 | Ga0068869_1001506152 | 187 |
| 77 | 3300005335 | Ga0070666_10000571 | Ga0070666_1000057111 | 187 |
| 78 | 3300005335 | Ga0070666_10003150 | Ga0070666_100031508 | 187 |
| 79 | 3300005335 | Ga0070666_10227166 | Ga0070666_102271662 | 187 |
| 80 | 3300005335 | Ga0070666_10340500 | Ga0070666_103405001 | 187 |
| 81 | 3300005337 | Ga0070682_100146006 | Ga0070682_1001460063 | 187 |
| 82 | 3300005338 | Ga0068868_100000112 | Ga0068868_10000011238 | 187 |
| 83 | 3300005338 | Ga0068868_100054664 | Ga0068868_1000546642 | 187 |
| 84 | 3300005338 | Ga0068868_100064855 | Ga0068868_1000648554 | 187 |
| 85 | 3300005338 | Ga0068868_100163318 | Ga0068868_1001633182 | 187 |
| 86 | 3300005339 | Ga0070660_100316253 | Ga0070660_1003162532 | 187 |
| 87 | 3300005339 | Ga0070660_100350986 | Ga0070660_1003509862 | 187 |
| 88 | 3300005340 | Ga0070689_100050956 | Ga0070689_1000509562 | 187 |
| 89 | 3300005340 | Ga0070689_100561548 | Ga0070689_1005615482 | 187 |
| 90 | 3300005340 | Ga0070689_100819019 | Ga0070689_1008190191 | 187 |
| 91 | 3300005344 | Ga0070661_100001786 | Ga0070661_1000017861 | 187 |
| 92 | 3300005344 | Ga0070661_100039375 | Ga0070661_1000393751 | 187 |
| 93 | 3300005344 | Ga0070661_100059364 | Ga0070661_1000593642 | 187 |
| 94 | 3300005344 | Ga0070661_100315772 | Ga0070661_1003157722 | 187 |
| 95 | 3300005347 | Ga0070668_100000110 | Ga0070668_10000011022 | 187 |
| 96 | 3300005353 | Ga0070669_100165782 | Ga0070669_1001657824 | 187 |
| 97 | 3300005354 | Ga0070675_100060469 | Ga0070675_1000604694 | 187 |
| 98 | 3300005354 | Ga0070675_101007685 | Ga0070675_1010076851 | 187 |
| 99 | 3300005355 | Ga0070671_100022762 | Ga0070671_1000227623 | 187 |
| 100 | 3300005355 | Ga0070671_100736866 | Ga0070671_1007368661 | 187 |
| 101 | 3300005355 | Ga0070671_100896941 | Ga0070671_1008969411 | 187 |
| 102 | 3300005356 | Ga0070674_100273104 | Ga0070674_1002731041 | 187 |
| 103 | 3300005364 | Ga0070673_100001374 | Ga0070673_10000137410 | 187 |
| 104 | 3300005364 | Ga0070673_100015009 | Ga0070673_1000150093 | 187 |
| 105 | 3300005364 | Ga0070673_100049647 | Ga0070673_1000496474 | 187 |
| 106 | 3300005365 | Ga0070688_100003958 | Ga0070688_1000039587 | 187 |
| 107 | 3300005365 | Ga0070688_100241515 | Ga0070688_1002415151 | 187 |
| 108 | 3300005366 | Ga0070659_100023860 | Ga0070659_1000238602 | 187 |
| 109 | 3300005366 | Ga0070659_100419250 | Ga0070659_1004192501 | 187 |
| 110 | 3300005367 | Ga0070667_100011085 | Ga0070667_1000110853 | 187 |
| 111 | 3300005367 | Ga0070667_100018912 | Ga0070667_1000189123 | 187 |
| 112 | 3300005367 | Ga0070667_100217478 | Ga0070667_1002174782 | 187 |
| 113 | 3300005367 | Ga0070667_100218342 | Ga0070667_1002183421 | 187 |
| 114 | 3300005455 | Ga0070663_100176331 | Ga0070663_1001763312 | 187 |
| 115 | 3300005456 | Ga0070678_100014347 | Ga0070678_1000143472 | 187 |
| 116 | 3300005456 | Ga0070678_100167177 | Ga0070678_1001671771 | 187 |
| 117 | 3300005457 | Ga0070662_100000209 | Ga0070662_10000020931 | 187 |
| 118 | 3300005457 | Ga0070662_100018140 | Ga0070662_1000181402 | 187 |
| 119 | 3300005457 | Ga0070662_100022389 | Ga0070662_1000223895 | 187 |
| 120 | 3300005457 | Ga0070662_100023895 | Ga0070662_1000238952 | 187 |
| 121 | 3300005457 | Ga0070662_100187419 | Ga0070662_1001874192 | 187 |
| 122 | 3300005459 | Ga0068867_100000620 | Ga0068867_1000006208 | 187 |
| 123 | 3300005459 | Ga0068867_100320573 | Ga0068867_1003205731 | 187 |
| 124 | 3300005466 | Ga0070685_10004060 | Ga0070685_100040604 | 187 |
| 125 | 3300005466 | Ga0070685_10077042 | Ga0070685_100770422 | 187 |
| 126 | 3300005466 | Ga0070685_10092852 | Ga0070685_100928522 | 187 |
| 127 | 3300005530 | Ga0070679_100264055 | Ga0070679_1002640551 | 187 |
| 128 | 3300005535 | Ga0070684_100000290 | Ga0070684_10000029028 | 187 |
| 129 | 3300005535 | Ga0070684_100093509 | Ga0070684_1000935093 | 187 |
| 130 | 3300005535 | Ga0070684_100186628 | Ga0070684_1001866282 | 187 |
| 131 | 3300005535 | Ga0070684_100960463 | Ga0070684_1009604631 | 187 |
| 132 | 3300005539 | Ga0068853_100021273 | Ga0068853_1000212733 | 187 |
| 133 | 3300005539 | Ga0068853_100083007 | Ga0068853_1000830074 | 187 |
| 134 | 3300005539 | Ga0068853_100153499 | Ga0068853_1001534992 | 187 |
| 135 | 3300005543 | Ga0070672_100000020 | Ga0070672_10000002037 | 187 |
| 136 | 3300005543 | Ga0070672_100043662 | Ga0070672_1000436622 | 187 |
| 137 | 3300005544 | Ga0070686_100091651 | Ga0070686_1000916513 | 187 |
| 138 | 3300005547 | Ga0070693_100349389 | Ga0070693_1003493891 | 187 |
| 139 | 3300005548 | Ga0070665_100000318 | Ga0070665_10000031822 | 187 |
| 140 | 3300005548 | Ga0070665_100271077 | Ga0070665_1002710772 | 187 |
| 141 | 3300005563 | Ga0068855_100010786 | Ga0068855_1000107862 | 187 |
| 142 | 3300005563 | Ga0068855_100031935 | Ga0068855_1000319352 | 187 |
| 143 | 3300005563 | Ga0068855_100362439 | Ga0068855_1003624391 | 187 |
| 144 | 3300005563 | Ga0068855_101430697 | Ga0068855_1014306972 | 187 |
| 145 | 3300005564 | Ga0070664_100012786 | Ga0070664_1000127867 | 187 |
| 146 | 3300005564 | Ga0070664_100134416 | Ga0070664_1001344163 | 187 |
| 147 | 3300005564 | Ga0070664_100231230 | Ga0070664_1002312302 | 187 |
| 148 | 3300005564 | Ga0070664_100388211 | Ga0070664_1003882111 | 187 |
| 149 | 3300005564 | Ga0070664_100495029 | Ga0070664_1004950292 | 187 |
| 150 | 3300005577 | Ga0068857_100004228 | Ga0068857_1000042282 | 187 |
| 151 | 3300005577 | Ga0068857_100008029 | Ga0068857_1000080298 | 187 |
| 152 | 3300005578 | Ga0068854_100053998 | Ga0068854_1000539983 | 187 |
| 153 | 3300005578 | Ga0068854_100486619 | Ga0068854_1004866191 | 187 |
| 154 | 3300005614 | Ga0068856_100061491 | Ga0068856_1000614913 | 187 |
| 155 | 3300005615 | Ga0070702_100259391 | Ga0070702_1002593912 | 187 |
| 156 | 3300005616 | Ga0068852_100003299 | Ga0068852_1000032995 | 187 |
| 157 | 3300005616 | Ga0068852_100084310 | Ga0068852_1000843103 | 187 |
| 158 | 3300005616 | Ga0068852_100442285 | Ga0068852_1004422852 | 187 |
| 159 | 3300005616 | Ga0068852_100872321 | Ga0068852_1008723211 | 187 |
| 160 | 3300005617 | Ga0068859_100039445 | Ga0068859_1000394453 | 187 |
| 161 | 3300005617 | Ga0068859_100145631 | Ga0068859_1001456313 | 187 |
| 162 | 3300005617 | Ga0068859_100293037 | Ga0068859_1002930372 | 187 |
| 163 | 3300005617 | Ga0068859_100431885 | Ga0068859_1004318852 | 187 |
| 164 | 3300005618 | Ga0068864_100000934 | Ga0068864_10000093421 | 187 |
| 165 | 3300005618 | Ga0068864_100023861 | Ga0068864_1000238617 | 187 |
| 166 | 3300005718 | Ga0068866_10031831 | Ga0068866_100318313 | 187 |
| 167 | 3300005719 | Ga0068861_100020234 | Ga0068861_1000202342 | 187 |
| 168 | 3300005834 | Ga0068851_10000510 | Ga0068851_100005109 | 187 |
| 169 | 3300005841 | Ga0068863_100000678 | Ga0068863_1000006787 | 187 |
| 170 | 3300005841 | Ga0068863_100096527 | Ga0068863_1000965272 | 187 |
| 171 | 3300005841 | Ga0068863_100540921 | Ga0068863_1005409211 | 187 |
| 172 | 3300005842 | Ga0068858_100000342 | Ga0068858_1000003428 | 187 |
| 173 | 3300005842 | Ga0068858_100054812 | Ga0068858_1000548122 | 187 |
| 174 | 3300005842 | Ga0068858_100569470 | Ga0068858_1005694702 | 187 |
| 175 | 3300005843 | Ga0068860_100003056 | Ga0068860_1000030568 | 187 |
| 176 | 3300005844 | Ga0068862_100366946 | Ga0068862_1003669461 | 187 |
| 177 | 3300005844 | Ga0068862_100691905 | Ga0068862_1006919051 | 187 |
| 178 | 3300005985 | Ga0081539_10010219 | Ga0081539_100102198 | 187 |
| 179 | 3300006195 | Ga0075366_10028230 | Ga0075366_100282302 | 187 |
| 180 | 3300006237 | Ga0097621_100052713 | Ga0097621_1000527132 | 187 |
| 181 | 3300006237 | Ga0097621_100064430 | Ga0097621_1000644302 | 187 |
| 182 | 3300006358 | Ga0068871_100007230 | Ga0068871_1000072306 | 187 |
| 183 | 3300006358 | Ga0068871_100121703 | Ga0068871_1001217031 | 187 |
| 184 | 3300006358 | Ga0068871_100123599 | Ga0068871_1001235991 | 187 |
| 185 | 3300006358 | Ga0068871_100149551 | Ga0068871_1001495512 | 187 |
| 186 | 3300006358 | Ga0068871_101157837 | Ga0068871_1011578372 | 187 |
| 187 | 3300006881 | Ga0068865_100000289 | Ga0068865_10000028925 | 187 |
| 188 | 3300006931 | Ga0097620_100039443 | Ga0097620_1000394433 | 187 |
| 189 | 3300006931 | Ga0097620_100145632 | Ga0097620_1001456323 | 187 |
| 190 | 3300006931 | Ga0097620_100293056 | Ga0097620_1002930562 | 187 |
| 191 | 3300006931 | Ga0097620_100431876 | Ga0097620_1004318762 | 187 |
| 192 | 3300009093 | Ga0105240_10603071 | Ga0105240_106030712 | 187 |
| 193 | 3300009101 | Ga0105247_10207909 | Ga0105247_102079092 | 187 |
| 194 | 3300009147 | Ga0114129_10004318 | Ga0114129_1000431816 | 187 |
| 195 | 3300009148 | Ga0105243_10030859 | Ga0105243_100308593 | 187 |
| 196 | 3300009174 | Ga0105241_10235376 | Ga0105241_102353763 | 187 |
| 197 | 3300009177 | Ga0105248_10833132 | Ga0105248_108331322 | 187 |
| 198 | 3300009545 | Ga0105237_10016185 | Ga0105237_1001618510 | 187 |
| 199 | 3300009545 | Ga0105237_10104778 | Ga0105237_101047782 | 187 |
| 200 | 3300009551 | Ga0105238_10084634 | Ga0105238_100846342 | 187 |
| 201 | 3300009553 | Ga0105249_10077703 | Ga0105249_100777033 | 187 |
| 202 | 3300010375 | Ga0105239_10056067 | Ga0105239_100560672 | 187 |
| 203 | 3300010375 | Ga0105239_10695295 | Ga0105239_106952952 | 187 |
| 204 | 3300011119 | Ga0105246_10075512 | Ga0105246_100755122 | 187 |
| 205 | 3300013100 | Ga0157373_10495992 | Ga0157373_104959922 | 187 |
| 206 | 3300013102 | Ga0157371_10337681 | Ga0157371_103376811 | 187 |
| 207 | 3300013105 | Ga0157369_10148752 | Ga0157369_101487522 | 187 |
| 208 | 3300013105 | Ga0157369_10605526 | Ga0157369_106055261 | 187 |
| 209 | 3300013296 | Ga0157374_10000745 | Ga0157374_1000074512 | 187 |
| 210 | 3300013296 | Ga0157374_10002159 | Ga0157374_1000215914 | 187 |
| 211 | 3300013296 | Ga0157374_10028707 | Ga0157374_100287075 | 187 |
| 212 | 3300013296 | Ga0157374_10040401 | Ga0157374_100404015 | 187 |
| 213 | 3300013297 | Ga0157378_10022980 | Ga0157378_100229806 | 187 |
| 214 | 3300013297 | Ga0157378_10042681 | Ga0157378_100426813 | 187 |
| 215 | 3300013306 | Ga0163162_10000544 | Ga0163162_1000054426 | 187 |
| 216 | 3300013306 | Ga0163162_10001237 | Ga0163162_1000123725 | 187 |
| 217 | 3300013306 | Ga0163162_10010645 | Ga0163162_100106455 | 187 |
| 218 | 3300013306 | Ga0163162_10023789 | Ga0163162_100237892 | 187 |
| 219 | 3300013306 | Ga0163162_10146250 | Ga0163162_101462502 | 187 |
| 220 | 3300013306 | Ga0163162_10530671 | Ga0163162_105306712 | 187 |
| 221 | 3300013307 | Ga0157372_10115180 | Ga0157372_101151802 | 187 |
| 222 | 3300013307 | Ga0157372_10168419 | Ga0157372_101684193 | 187 |
| 223 | 3300013308 | Ga0157375_10000821 | Ga0157375_100008219 | 187 |
| 224 | 3300013308 | Ga0157375_10019807 | Ga0157375_100198075 | 187 |
| 225 | 3300013308 | Ga0157375_10023937 | Ga0157375_100239373 | 187 |
| 226 | 3300013308 | Ga0157375_10076269 | Ga0157375_100762692 | 187 |
| 227 | 3300013308 | Ga0157375_10354455 | Ga0157375_103544553 | 187 |
| 228 | 3300013308 | Ga0157375_10823093 | Ga0157375_108230932 | 187 |
| 229 | 3300013308 | Ga0157375_11203075 | Ga0157375_112030752 | 187 |
| 230 | 3300014325 | Ga0163163_10000963 | Ga0163163_1000096320 | 187 |
| 231 | 3300014325 | Ga0163163_10001217 | Ga0163163_100012177 | 187 |
| 232 | 3300014325 | Ga0163163_10240113 | Ga0163163_102401133 | 187 |
| 233 | 3300014745 | Ga0157377_10025646 | Ga0157377_100256463 | 187 |
| 234 | 3300014968 | Ga0157379_10000115 | Ga0157379_1000011525 | 187 |
| 235 | 3300014968 | Ga0157379_10028680 | Ga0157379_100286805 | 187 |
| 236 | 3300014968 | Ga0157379_10044130 | Ga0157379_100441302 | 187 |
| 237 | 3300014969 | Ga0157376_10001273 | Ga0157376_100012732 | 187 |
| 238 | 3300014969 | Ga0157376_11106447 | Ga0157376_111064471 | 187 |
| 239 | 3300014969 | Ga0157376_11394480 | Ga0157376_113944801 | 187 |
| 240 | 3300017792 | Ga0163161_10011605 | Ga0163161_100116055 | 187 |
| 241 | 3300017792 | Ga0163161_10020617 | Ga0163161_100206171 | 187 |
| 242 | 3300017792 | Ga0163161_10024139 | Ga0163161_100241396 | 187 |
| 243 | 3300017792 | Ga0163161_10149103 | Ga0163161_101491032 | 187 |
| 244 | 3300020076 | Ga0206355_1678078 | Ga0206355_16780781 | 187 |
| 245 | 3300025315 | Ga0207697_10035782 | Ga0207697_100357822 | 187 |
| 246 | 3300025321 | Ga0207656_10001238 | Ga0207656_100012385 | 187 |
| 247 | 3300025899 | Ga0207642_10253825 | Ga0207642_102538252 | 187 |
| 248 | 3300025900 | Ga0207710_10130731 | Ga0207710_101307312 | 187 |
| 249 | 3300025901 | Ga0207688_10757733 | Ga0207688_107577331 | 187 |
| 250 | 3300025903 | Ga0207680_10001588 | Ga0207680_1000158810 | 187 |
| 251 | 3300025903 | Ga0207680_10024314 | Ga0207680_100243142 | 187 |
| 252 | 3300025904 | Ga0207647_10071936 | Ga0207647_100719361 | 187 |
| 253 | 3300025905 | Ga0207685_10131319 | Ga0207685_101313192 | 187 |
| 254 | 3300025907 | Ga0207645_10001661 | Ga0207645_100016616 | 187 |
| 255 | 3300025907 | Ga0207645_10006830 | Ga0207645_100068308 | 187 |
| 256 | 3300025908 | Ga0207643_10214809 | Ga0207643_102148091 | 187 |
| 257 | 3300025909 | Ga0207705_10003873 | Ga0207705_100038736 | 187 |
| 258 | 3300025911 | Ga0207654_10350379 | Ga0207654_103503792 | 187 |
| 259 | 3300025913 | Ga0207695_10301536 | Ga0207695_103015361 | 187 |
| 260 | 3300025913 | Ga0207695_10997690 | Ga0207695_109976902 | 187 |
| 261 | 3300025919 | Ga0207657_10224135 | Ga0207657_102241353 | 187 |
| 262 | 3300025920 | Ga0207649_10007347 | Ga0207649_100073473 | 187 |
| 263 | 3300025920 | Ga0207649_10172413 | Ga0207649_101724132 | 187 |
| 264 | 3300025920 | Ga0207649_10269816 | Ga0207649_102698161 | 187 |
| 265 | 3300025920 | Ga0207649_10948991 | Ga0207649_109489911 | 187 |
| 266 | 3300025923 | Ga0207681_10144216 | Ga0207681_101442163 | 187 |
| 267 | 3300025925 | Ga0207650_10733809 | Ga0207650_107338092 | 187 |
| 268 | 3300025926 | Ga0207659_10066736 | Ga0207659_100667363 | 187 |
| 269 | 3300025926 | Ga0207659_10395306 | Ga0207659_103953063 | 187 |
| 270 | 3300025931 | Ga0207644_10186050 | Ga0207644_101860503 | 187 |
| 271 | 3300025931 | Ga0207644_10857209 | Ga0207644_108572091 | 187 |
| 272 | 3300025932 | Ga0207690_10028866 | Ga0207690_100288663 | 187 |
| 273 | 3300025933 | Ga0207706_10003474 | Ga0207706_1000347410 | 187 |
| 274 | 3300025933 | Ga0207706_10012403 | Ga0207706_100124031 | 187 |
| 275 | 3300025933 | Ga0207706_10031091 | Ga0207706_100310912 | 187 |
| 276 | 3300025933 | Ga0207706_10057463 | Ga0207706_100574633 | 187 |
| 277 | 3300025933 | Ga0207706_10323498 | Ga0207706_103234981 | 187 |
| 278 | 3300025935 | Ga0207709_10062070 | Ga0207709_100620702 | 187 |
| 279 | 3300025936 | Ga0207670_10046308 | Ga0207670_100463081 | 187 |
| 280 | 3300025936 | Ga0207670_10355752 | Ga0207670_103557523 | 187 |
| 281 | 3300025938 | Ga0207704_10068755 | Ga0207704_100687553 | 187 |
| 282 | 3300025940 | Ga0207691_10000322 | Ga0207691_1000032238 | 187 |
| 283 | 3300025940 | Ga0207691_10104485 | Ga0207691_101044852 | 187 |
| 284 | 3300025942 | Ga0207689_10000843 | Ga0207689_1000084321 | 187 |
| 285 | 3300025942 | Ga0207689_10024937 | Ga0207689_100249372 | 187 |
| 286 | 3300025942 | Ga0207689_10047264 | Ga0207689_100472646 | 187 |
| 287 | 3300025944 | Ga0207661_10000411 | Ga0207661_100004113 | 187 |
| 288 | 3300025944 | Ga0207661_10113795 | Ga0207661_101137952 | 187 |
| 289 | 3300025944 | Ga0207661_10270276 | Ga0207661_102702762 | 187 |
| 290 | 3300025945 | Ga0207679_10000297 | Ga0207679_100002979 | 187 |
| 291 | 3300025945 | Ga0207679_10000800 | Ga0207679_1000080022 | 187 |
| 292 | 3300025945 | Ga0207679_10197769 | Ga0207679_101977692 | 187 |
| 293 | 3300025945 | Ga0207679_10362139 | Ga0207679_103621392 | 187 |
| 294 | 3300025949 | Ga0207667_10059429 | Ga0207667_100594292 | 187 |
| 295 | 3300025949 | Ga0207667_10225165 | Ga0207667_102251652 | 187 |
| 296 | 3300025949 | Ga0207667_10623450 | Ga0207667_106234501 | 187 |
| 297 | 3300025960 | Ga0207651_10000542 | Ga0207651_1000054210 | 187 |
| 298 | 3300025960 | Ga0207651_10105635 | Ga0207651_101056351 | 187 |
| 299 | 3300025960 | Ga0207651_10126978 | Ga0207651_101269781 | 187 |
| 300 | 3300025961 | Ga0207712_10003158 | Ga0207712_100031588 | 187 |
| 301 | 3300025961 | Ga0207712_10225069 | Ga0207712_102250692 | 187 |
| 302 | 3300025972 | Ga0207668_10000344 | Ga0207668_100003449 | 187 |
| 303 | 3300025986 | Ga0207658_10001922 | Ga0207658_100019226 | 187 |
| 304 | 3300025986 | Ga0207658_10149441 | Ga0207658_101494412 | 187 |
| 305 | 3300025986 | Ga0207658_10201360 | Ga0207658_102013603 | 187 |
| 306 | 3300026023 | Ga0207677_10000816 | Ga0207677_100008169 | 187 |
| 307 | 3300026023 | Ga0207677_10000848 | Ga0207677_100008489 | 187 |
| 308 | 3300026035 | Ga0207703_10002680 | Ga0207703_1000268010 | 187 |
| 309 | 3300026067 | Ga0207678_10057790 | Ga0207678_100577903 | 187 |
| 310 | 3300026075 | Ga0207708_10265347 | Ga0207708_102653472 | 187 |
| 311 | 3300026078 | Ga0207702_10157602 | Ga0207702_101576022 | 187 |
| 312 | 3300026078 | Ga0207702_10381288 | Ga0207702_103812882 | 187 |
| 313 | 3300026088 | Ga0207641_10003266 | Ga0207641_1000326611 | 187 |
| 314 | 3300026088 | Ga0207641_10081272 | Ga0207641_100812722 | 187 |
| 315 | 3300026089 | Ga0207648_10002849 | Ga0207648_100028493 | 187 |
| 316 | 3300026089 | Ga0207648_10017663 | Ga0207648_100176632 | 187 |
| 317 | 3300026089 | Ga0207648_10131586 | Ga0207648_101315862 | 187 |
| 318 | 3300026089 | Ga0207648_10196939 | Ga0207648_101969392 | 187 |
| 319 | 3300026095 | Ga0207676_10004554 | Ga0207676_100045547 | 187 |
| 320 | 3300026095 | Ga0207676_10132493 | Ga0207676_101324932 | 187 |
| 321 | 3300026095 | Ga0207676_10241621 | Ga0207676_102416213 | 187 |
| 322 | 3300026116 | Ga0207674_10010469 | Ga0207674_100104692 | 187 |
| 323 | 3300026116 | Ga0207674_10036670 | Ga0207674_100366706 | 187 |
| 324 | 3300026116 | Ga0207674_10768469 | Ga0207674_107684691 | 187 |
| 325 | 3300026118 | Ga0207675_100030222 | Ga0207675_1000302226 | 187 |
| 326 | 3300026118 | Ga0207675_100228396 | Ga0207675_1002283961 | 187 |
| 327 | 3300026118 | Ga0207675_101308034 | Ga0207675_1013080341 | 187 |
| 328 | 3300026121 | Ga0207683_10045179 | Ga0207683_100451793 | 187 |
| 329 | 3300026121 | Ga0207683_10816341 | Ga0207683_108163411 | 187 |
| 330 | 3300026142 | Ga0207698_10042140 | Ga0207698_100421403 | 187 |
| 331 | 3300026142 | Ga0207698_10405895 | Ga0207698_104058952 | 187 |
| 332 | 3300028379 | Ga0268266_10442499 | Ga0268266_104424991 | 187 |
| 333 | 3300028381 | Ga0268264_10001597 | Ga0268264_1000159710 | 187 |
| 334 | 3300028381 | Ga0268264_10132515 | Ga0268264_101325152 | 187 |
| 335 | 3300028381 | Ga0268264_11289523 | Ga0268264_112895231 | 187 |
| 336 | 3300035170 | Ga0373943_0119379 | Ga0373943_0119379_95_658 | 187 |
| 337 | 3300035724 | Ga0373933_0597127 | Ga0373933_0597127_99_662 | 187 |
| 338 | 3300035725 | Ga0373947_0281659 | Ga0373947_0281659_384_947 | 187 |
| 339 | 3300036401 | Ga0373937_0075608 | Ga0373937_0075608_858_1421 | 187 |
| 340 | 3300036401 | Ga0373937_0254094 | Ga0373937_0254094_722_1285 | 187 |
| 341 | 3300041411 | Ga0439466_0118144 | Ga0439466_0118144_197_760 | 187 |
| 342 | 3300041452 | Ga0451793_1613459 | Ga0451793_1613459_15_578 | 187 |
| 343 | 3300041486 | Ga0451807_2096905 | Ga0451807_2096905_888_1451 | 187 |
| 344 | 3300041997 | Ga0439431_0098794 | Ga0439431_0098794_109_672 | 187 |
| 345 | 3300042004 | Ga0439445_0015735 | Ga0439445_0015735_135_698 | 187 |
| 346 | 3300042006 | Ga0439432_024415 | Ga0439432_024415_1091_1654 | 187 |
| 347 | 3300042131 | Ga0450894_001329 | Ga0450894_001329_228_791 | 187 |
| 348 | 3300042134 | Ga0450898_015679 | Ga0450898_015679_407_970 | 187 |
| 349 | 3300044656 | Ga0466969_0000272 | Ga0466969_0000272_25149_25730 | 187 |
| 350 | 3300044684 | Ga0466966_0003376 | Ga0466966_0003376_3454_4035 | 187 |
| 351 | 3300044693 | Ga0466961_0067208 | Ga0466961_0067208_159_740 | 187 |
| 352 | 3300044735 | Ga0466968_0138719 | Ga0466968_0138719_408_989 | 187 |
| 353 | 3300044842 | Ga0466957_0000084 | Ga0466957_0000084_19113_19694 | 187 |
| 354 | 3300045049 | Ga0466959_0000035 | Ga0466959_0000035_82900_83481 | 187 |
| 355 | 3300046460 | Ga0495638_0073639 | Ga0495638_0073639_207_770 | 187 |
| 356 | 3300046472 | Ga0495580_0081256 | Ga0495580_0081256_871_1434 | 187 |
| 357 | 3300046477 | Ga0495664_0512642 | Ga0495664_0512642_17_580 | 187 |
| 358 | 3300046517 | Ga0495630_0035066 | Ga0495630_0035066_2849_3412 | 187 |
| 359 | 3300046529 | Ga0495652_0449950 | Ga0495652_0449950_299_862 | 187 |
| 360 | 3300046535 | Ga0495586_0101882 | Ga0495586_0101882_946_1509 | 187 |
| 361 | 3300046558 | Ga0495633_0096307 | Ga0495633_0096307_579_1142 | 187 |
| 362 | 3300046559 | Ga0495667_0233578 | Ga0495667_0233578_506_1069 | 187 |
| 363 | 3300046616 | Ga0495668_0001009 | Ga0495668_0001009_29499_30083 | 187 |
| 364 | 3300046616 | Ga0495668_0002730 | Ga0495668_0002730_3514_4155 | 187 |
| 365 | 3300046648 | Ga0495611_0242061 | Ga0495611_0242061_17_589 | 187 |
| 366 | 3300046663 | Ga0495635_0272902 | Ga0495635_0272902_307_870 | 187 |
| 367 | 3300046675 | Ga0495657_0329232 | Ga0495657_0329232_260_823 | 187 |
| 368 | 3300046681 | Ga0495647_0166544 | Ga0495647_0166544_209_772 | 187 |
| 369 | 3300046691 | Ga0495670_0129687 | Ga0495670_0129687_462_1025 | 187 |
| 370 | 3300047471 | Ga0495684_0570236 | Ga0495684_0570236_113_676 | 187 |
| 371 | 3300048088 | Ga0495602_0486720 | Ga0495602_0486720_97_699 | 187 |
| 372 | 3300048909 | Ga0496106_0945410 | Ga0496106_0945410_75_638 | 187 |
| 373 | 3300048911 | Ga0496108_0068293 | Ga0496108_0068293_401_964 | 187 |
| 374 | 3300048912 | Ga0496109_0020712 | Ga0496109_0020712_1716_2279 | 187 |
| 375 | 3300048913 | Ga0496110_0041814 | Ga0496110_0041814_1637_2311 | 187 |
| 376 | 3300048913 | Ga0496110_0470326 | Ga0496110_0470326_543_1106 | 187 |
| 377 | 3300048918 | Ga0496115_0316653 | Ga0496115_0316653_192_755 | 187 |
| 378 | 3300049742 | Ga0501080_0371098 | Ga0501080_0371098_315_878 | 187 |
| 379 | 3300050493 | nmdc:mga0k408_191753_c1 | nmdc:mga0k408_191753_c1_565_1146 | 187 |
| 380 | 3300050507 | nmdc:mga05p37_16679_c1 | nmdc:mga05p37_16679_c1_393_974 | 187 |
| 381 | 3300053139 | Ga0500568_0000335 | Ga0500568_0000335_3811_4374 | 187 |
| 382 | 3300053727 | Ga0500611_000003 | Ga0500611_000003_123131_123694 | 187 |
| 383 | 2162886012 | MBSR1b_contig_12999027 | MBSR1b_0531.00006230 | 188 |
| 384 | 2162886012 | MBSR1b_contig_13755480 | MBSR1b_0306.00002540 | 188 |
| 385 | 3300005288 | Ga0065714_10016476 | Ga0065714_100164762 | 188 |
| 386 | 3300005293 | Ga0065715_10009925 | Ga0065715_100099254 | 188 |
| 387 | 3300005331 | Ga0070670_100188351 | Ga0070670_1001883512 | 188 |
| 388 | 3300005331 | Ga0070670_100563728 | Ga0070670_1005637281 | 188 |
| 389 | 3300005356 | Ga0070674_100988157 | Ga0070674_1009881571 | 188 |
| 390 | 3300005364 | Ga0070673_100968070 | Ga0070673_1009680701 | 188 |
| 391 | 3300005543 | Ga0070672_100124319 | Ga0070672_1001243192 | 188 |
| 392 | 3300005548 | Ga0070665_100000014 | Ga0070665_100000014279 | 188 |
| 393 | 3300005719 | Ga0068861_100170740 | Ga0068861_1001707402 | 188 |
| 394 | 3300005834 | Ga0068851_10292552 | Ga0068851_102925522 | 188 |
| 395 | 3300006931 | Ga0097620_100284907 | Ga0097620_1002849073 | 188 |
| 396 | 3300009093 | Ga0105240_11388710 | Ga0105240_113887101 | 188 |
| 397 | 3300010375 | Ga0105239_10032921 | Ga0105239_100329213 | 188 |
| 398 | 3300013297 | Ga0157378_10237762 | Ga0157378_102377622 | 188 |
| 399 | 3300014326 | Ga0157380_10029165 | Ga0157380_100291655 | 188 |
| 400 | 3300025926 | Ga0207659_10085336 | Ga0207659_100853363 | 188 |
| 401 | 3300025937 | Ga0207669_10183411 | Ga0207669_101834111 | 188 |
| 402 | 3300026118 | Ga0207675_100170440 | Ga0207675_1001704402 | 188 |
| 403 | 3300028379 | Ga0268266_10000068 | Ga0268266_10000068155 | 188 |
| 404 | 3300031548 | Ga0307408_100152060 | Ga0307408_1001520602 | 188 |
| 405 | 3300031824 | Ga0307413_10012537 | Ga0307413_100125373 | 188 |
| 406 | 3300031852 | Ga0307410_10294264 | Ga0307410_102942642 | 188 |
| 407 | 3300031901 | Ga0307406_10071038 | Ga0307406_100710382 | 188 |
| 408 | 3300031903 | Ga0307407_10068208 | Ga0307407_100682082 | 188 |
| 409 | 3300031995 | Ga0307409_100122558 | Ga0307409_1001225583 | 188 |
| 410 | 3300032002 | Ga0307416_100002426 | Ga0307416_1000024264 | 188 |
| 411 | 3300032004 | Ga0307414_10142426 | Ga0307414_101424264 | 188 |
| 412 | 3300032126 | Ga0307415_100009221 | Ga0307415_1000092215 | 188 |
| 413 | 3300041999 | Ga0439433_0050230 | Ga0439433_0050230_387_968 | 188 |
| 414 | 3300042014 | Ga0439457_057114 | Ga0439457_057114_73_654 | 188 |
| 415 | 3300049513 | Ga0501290_018791 | Ga0501290_018791_21_635 | 188 |
| 416 | 3300049515 | Ga0501292_005148 | Ga0501292_005148_1028_1642 | 188 |
| 417 | 3300049521 | Ga0501298_004839 | Ga0501298_004839_154_768 | 188 |
| 418 | 3300049649 | Ga0501198_003948 | Ga0501198_003948_1416_2030 | 188 |
| 419 | 3300049651 | Ga0501201_001790 | Ga0501201_001790_1269_1883 | 188 |
| 420 | 3300049651 | Ga0501201_002348 | Ga0501201_002348_440_1021 | 188 |
| 421 | 3300049652 | Ga0501202_000359 | Ga0501202_000359_3843_4457 | 188 |
| 422 | 3300049652 | Ga0501202_005281 | Ga0501202_005281_1154_1735 | 188 |
| 423 | 3300049653 | Ga0501206_015383 | Ga0501206_015383_175_789 | 188 |
| 424 | 3300049654 | Ga0501207_004502 | Ga0501207_004502_264_878 | 188 |
| 425 | 3300049661 | Ga0501217_000190 | Ga0501217_000190_2705_3319 | 188 |
| 426 | 3300049661 | Ga0501217_054965 | Ga0501217_054965_217_798 | 188 |
| 427 | 3300049662 | Ga0501222_000546 | Ga0501222_000546_4032_4646 | 188 |
| 428 | 3300049663 | Ga0501223_001006 | Ga0501223_001006_3326_3940 | 188 |
| 429 | 3300049663 | Ga0501223_011271 | Ga0501223_011271_591_1172 | 188 |
| 430 | 3300049663 | Ga0501223_062350 | Ga0501223_062350_37_621 | 188 |
| 431 | 3300049664 | Ga0501224_023425 | Ga0501224_023425_287_871 | 188 |
| 432 | 3300049665 | Ga0501227_036874 | Ga0501227_036874_403_1017 | 188 |
| 433 | 3300049668 | Ga0501233_005667 | Ga0501233_005667_1338_1952 | 188 |
| 434 | 3300049669 | Ga0501235_008871 | Ga0501235_008871_947_1561 | 188 |
| 435 | 3300049669 | Ga0501235_009105 | Ga0501235_009105_1113_1694 | 188 |
| 436 | 3300049669 | Ga0501235_099344 | Ga0501235_099344_30_614 | 188 |
| 437 | 3300049674 | Ga0501242_003418 | Ga0501242_003418_929_1543 | 188 |
| 438 | 3300049675 | Ga0501243_000818 | Ga0501243_000818_2872_3486 | 188 |
| 439 | 3300049680 | Ga0501250_013190 | Ga0501250_013190_153_737 | 188 |
| 440 | 3300049683 | Ga0501253_046499 | Ga0501253_046499_88_669 | 188 |
| 441 | 3300049690 | Ga0501261_001267 | Ga0501261_001267_1155_1769 | 188 |
| 442 | 3300049704 | Ga0501221_000013 | Ga0501221_000013_13568_14182 | 188 |
| 443 | 3300049704 | Ga0501221_040815 | Ga0501221_040815_216_797 | 188 |
| 444 | 3300049705 | Ga0501225_0001754 | Ga0501225_0001754_712_1293 | 188 |
| 445 | 3300049705 | Ga0501225_0003389 | Ga0501225_0003389_369_983 | 188 |
| 446 | 3300049760 | Ga0501263_008395 | Ga0501263_008395_538_1119 | 188 |
| 447 | 3300049770 | Ga0501273_011393 | Ga0501273_011393_256_837 | 188 |
| 448 | 3300049851 | Ga0501212_000331 | Ga0501212_000331_52_666 | 188 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2vrn-assembly1.cif.gz_B | the structure of the stress response protein dr1199 from deinococcus radiodurans: a member of the dj-1 superfamily | 0.981 | 4 | 181 |
| 6f2f-assembly1.cif.gz_A | crystal structure of protease 1 from pyrococcus horikoshii co-cystallized in presence of 10 mm tb-xo4 and ammonium sulfate. | 0.975 | 8 | 174 |
| 6q3t-assembly1.cif.gz_A | structure of protease1 from pyrococcus horikoshii at room temperature in chipx microfluidic device | 0.9747 | 8 | 174 |
| 3l18-assembly1.cif.gz_B | ton1285, an intracellular protease from thermococcus onnurineus na1 | 0.9725 | 6 | 175 |
| 7r66-assembly1.cif.gz_A | structure of pfp1 protease from thermococcus thioreducens: large unit cell at 1.44 a resolution | 0.966 | 8 | 175 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6f2fA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.975 | 8 | 174 | 3.40.50.880 |
| 2vrnB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9737 | 4 | 181 | 3.40.50.880 |
| 1oi4B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9583 | 7 | 175 | 3.40.50.880 |
| 4y1eA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9518 | 6 | 175 | 3.40.50.880 |
| 6f2fA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9462 | 8 | 174 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3R8PL51-F1-model_v4 | deleted | 0.9998 | 60 | 182 |
|
| AF-A0A4Q1D4P3-F1-model_v4 | Type 1 glutamine amidotransferase | 0.9975 | 1 | 182 |
GO:0016740
|
| AF-A0A7V9QL38-F1-model_v4 | DJ-1/PfpI family protein | 0.9967 | 88 | 182 |
|
| AF-A0A133ZEE5-F1-model_v4 | Intracellular protease 1 domain protein | 0.9957 | 79 | 181 |
GO:0006508
GO:0008233 |
| AF-A0A3N1PQS0-F1-model_v4 | Protease I | 0.9921 | 2 | 185 |
GO:0006508
GO:0008233 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar