F446157

General Info

Members Datasets Scaffolds Average Seq Length
448 226 448 189

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10032921|Ga0105239_100329213
Length 231
Sequence MATLSGKKVAIITENGFEESELTSPKKALEEAGAQVDIISPQQQKVKAWDHDHWSIELPVNVNIDMAKPEDYDALVIPGGVMNPDQMRMNTKCVEFAQRFLEEGKPIAAICHGPQLLIETGLINGRTMTSYWSLKTDLQNAGVDWVDKEVVVDNGLVTSRSPKDLPAFNKKMIEEIKEGTHAPSGVHSFAKTLAIELIPVSRSVRAGFFLVFFDFFEIIIRFYSCVKKFTG

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
89 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
156 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
157 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
158 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
159 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
160 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
161 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
162 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
163 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
164 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
165 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
166 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
167 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
168 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
179 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
182 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
195 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
196 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
199 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
200 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
201 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
202 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
203 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
204 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
205 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
206 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
207 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
208 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
209 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
210 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
211 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
212 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
213 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
214 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
215 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
216 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
219 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
220 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
221 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
224 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
225 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
226 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.56
Nodule 0
Rhizoplane 1.79
Rhizosphere 96.21
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_12999027 2162886012 Unclassified 1679
2 MBSR1b_contig_13755480 2162886012 Unclassified 1204
3 ARcpr5yngRDRAFT_c003720 3300000043 Bacteria 1477
4 JGI24744J21845_10014815 3300002077 Bacteria 1562
5 rootL2_10101186 3300003322 Bacteria 5598
6 rootH1_10239146 3300003323 Bacteria 3256
7 Ga0065714_10016476 3300005288 Unclassified 1761
8 Ga0065715_10009925 3300005293 Bacteria 2550
9 Ga0070676_10000701 3300005328 Bacteria 16349
10 Ga0070683_100000327 3300005329 Bacteria 32861
11 Ga0070683_100025753 3300005329 Bacteria 5288
12 Ga0070683_100170865 3300005329 Bacteria 2063
13 Ga0070683_100424926 3300005329 Bacteria 1268
14 Ga0070683_100989393 3300005329 Bacteria 807
15 Ga0070690_100007060 3300005330 Bacteria 6408
16 Ga0070690_100288837 3300005330 Unclassified 1172
17 Ga0070670_100188351 3300005331 Bacteria 1792
18 Ga0070670_100563728 3300005331 Unclassified 1017
19 Ga0070670_100645097 3300005331 Bacteria 949
20 Ga0068869_100126241 3300005334 Bacteria 1962
21 Ga0068869_100141896 3300005334 Unclassified 1855
22 Ga0068869_100150615 3300005334 Bacteria 1804
23 Ga0068869_100388073 3300005334 Bacteria 1146
24 Ga0068869_100848410 3300005334 Bacteria 788
25 Ga0070666_10000571 3300005335 Bacteria 22346
26 Ga0070666_10003150 3300005335 Bacteria 10017
27 Ga0070666_10227166 3300005335 Bacteria 1318
28 Ga0070666_10340500 3300005335 Unclassified 1072
29 Ga0070682_100146006 3300005337 Bacteria 1618
30 Ga0068868_100000112 3300005338 Bacteria 50817
31 Ga0068868_100054664 3300005338 Bacteria 3147
32 Ga0068868_100064855 3300005338 Unclassified 2900
33 Ga0068868_100122970 3300005338 Bacteria 2117
34 Ga0068868_100163318 3300005338 Bacteria 1841
35 Ga0070660_100316253 3300005339 Bacteria 1282
36 Ga0070660_100350986 3300005339 Bacteria 1215
37 Ga0070689_100050956 3300005340 Bacteria 3198
38 Ga0070689_100561548 3300005340 Bacteria 984
39 Ga0070689_100819019 3300005340 Bacteria 820
40 Ga0070661_100001786 3300005344 Bacteria 14912
41 Ga0070661_100039375 3300005344 Bacteria 3444
42 Ga0070661_100059364 3300005344 Bacteria 2804
43 Ga0070661_100208146 3300005344 Bacteria 1496
44 Ga0070661_100315772 3300005344 Bacteria 1219
45 Ga0070668_100000110 3300005347 Bacteria 50766
46 Ga0070668_100606509 3300005347 Unclassified 958
47 Ga0070669_100165782 3300005353 Unclassified 1720
48 Ga0070675_100056010 3300005354 Bacteria 3247
49 Ga0070675_100060469 3300005354 Bacteria 3128
50 Ga0070675_100137926 3300005354 Bacteria 2083
51 Ga0070675_101007685 3300005354 Bacteria 765
52 Ga0070671_100022762 3300005355 Bacteria 5119
53 Ga0070671_100167619 3300005355 Bacteria 1857
54 Ga0070671_100736866 3300005355 Bacteria 856
55 Ga0070671_100896941 3300005355 Bacteria 774
56 Ga0070674_100046613 3300005356 Bacteria 2966
57 Ga0070674_100273104 3300005356 Bacteria 1337
58 Ga0070674_100988157 3300005356 Bacteria 738
59 Ga0070673_100001374 3300005364 Bacteria 14221
60 Ga0070673_100015009 3300005364 Bacteria 5421
61 Ga0070673_100049647 3300005364 Unclassified 3277
62 Ga0070673_100968070 3300005364 Unclassified 791
63 Ga0070688_100003958 3300005365 Bacteria 7681
64 Ga0070688_100241515 3300005365 Unclassified 1282
65 Ga0070659_100012802 3300005366 Bacteria 6228
66 Ga0070659_100023860 3300005366 Bacteria 4685
67 Ga0070659_100419250 3300005366 Bacteria 1132
68 Ga0070667_100011085 3300005367 Bacteria 7457
69 Ga0070667_100018912 3300005367 Bacteria 5712
70 Ga0070667_100217478 3300005367 Bacteria 1700
71 Ga0070667_100218342 3300005367 Bacteria 1696
72 Ga0070663_100176331 3300005455 Bacteria 1655
73 Ga0070663_100364528 3300005455 Bacteria 1173
74 Ga0070678_100014347 3300005456 Bacteria 4997
75 Ga0070678_100167177 3300005456 Bacteria 1788
76 Ga0070662_100000209 3300005457 Bacteria 34168
77 Ga0070662_100018140 3300005457 Bacteria 4757
78 Ga0070662_100022389 3300005457 Bacteria 4327
79 Ga0070662_100023895 3300005457 Bacteria 4205
80 Ga0070662_100187419 3300005457 Bacteria 1634
81 Ga0070662_100482828 3300005457 Bacteria 1032
82 Ga0070681_11043683 3300005458 Bacteria 738
83 Ga0068867_100000620 3300005459 Bacteria 23485
84 Ga0068867_100320573 3300005459 Bacteria 1284
85 Ga0068867_100981269 3300005459 Bacteria 765
86 Ga0070685_10004060 3300005466 Bacteria 7394
87 Ga0070685_10077042 3300005466 Unclassified 1990
88 Ga0070685_10092852 3300005466 Bacteria 1829
89 Ga0070679_100264055 3300005530 Bacteria 1677
90 Ga0070684_100000290 3300005535 Bacteria 34902
91 Ga0070684_100093509 3300005535 Bacteria 2676
92 Ga0070684_100169563 3300005535 Bacteria 1982
93 Ga0070684_100186628 3300005535 Bacteria 1886
94 Ga0070684_100960463 3300005535 Bacteria 801
95 Ga0068853_100021273 3300005539 Bacteria 5406
96 Ga0068853_100083007 3300005539 Bacteria 2807
97 Ga0068853_100153499 3300005539 Bacteria 2074
98 Ga0068853_101216190 3300005539 Bacteria 727
99 Ga0070672_100000020 3300005543 Bacteria 69277
100 Ga0070672_100043662 3300005543 Bacteria 3458
101 Ga0070672_100124319 3300005543 Unclassified 2115
102 Ga0070686_100091651 3300005544 Bacteria 2034
103 Ga0070693_100349389 3300005547 Bacteria 1012
104 Ga0070665_100000014 3300005548 Bacteria 484881
105 Ga0070665_100000318 3300005548 Bacteria 74326
106 Ga0070665_100271077 3300005548 Bacteria 1699
107 Ga0068855_100010786 3300005563 Bacteria 11030
108 Ga0068855_100031935 3300005563 Bacteria 6286
109 Ga0068855_100362439 3300005563 Bacteria 1595
110 Ga0068855_101430697 3300005563 Bacteria 712
111 Ga0070664_100012786 3300005564 Bacteria 6830
112 Ga0070664_100134416 3300005564 Bacteria 2174
113 Ga0070664_100197350 3300005564 Bacteria 1794
114 Ga0070664_100231230 3300005564 Bacteria 1657
115 Ga0070664_100388211 3300005564 Bacteria 1275
116 Ga0070664_100495029 3300005564 Unclassified 1126
117 Ga0068857_100004228 3300005577 Bacteria 12096
118 Ga0068857_100008029 3300005577 Bacteria 9102
119 Ga0068857_100056109 3300005577 Bacteria 3496
120 Ga0068854_100053998 3300005578 Bacteria 2888
121 Ga0068854_100486619 3300005578 Unclassified 1037
122 Ga0068856_100009293 3300005614 Bacteria 9549
123 Ga0068856_100061491 3300005614 Bacteria 3710
124 Ga0070702_100259391 3300005615 Bacteria 1183
125 Ga0068852_100003299 3300005616 Bacteria 11269
126 Ga0068852_100084310 3300005616 Bacteria 2828
127 Ga0068852_100442285 3300005616 Bacteria 1286
128 Ga0068852_100872321 3300005616 Bacteria 916
129 Ga0068859_100039445 3300005617 Bacteria 4737
130 Ga0068859_100145631 3300005617 Unclassified 2443
131 Ga0068859_100293037 3300005617 Bacteria 1720
132 Ga0068859_100411300 3300005617 Bacteria 1449
133 Ga0068859_100431885 3300005617 Bacteria 1413
134 Ga0068864_100000934 3300005618 Bacteria 24494
135 Ga0068864_100023861 3300005618 Bacteria 5140
136 Ga0068866_10031831 3300005718 Bacteria 2545
137 Ga0068861_100020234 3300005719 Bacteria 4762
138 Ga0068861_100170740 3300005719 Bacteria 1802
139 Ga0068851_10000510 3300005834 Bacteria 17001
140 Ga0068851_10270415 3300005834 Bacteria 969
141 Ga0068851_10292552 3300005834 Bacteria 934
142 Ga0068863_100000678 3300005841 Bacteria 34425
143 Ga0068863_100096527 3300005841 Bacteria 2806
144 Ga0068863_100540921 3300005841 Bacteria 1149
145 Ga0068858_100000342 3300005842 Bacteria 49465
146 Ga0068858_100054812 3300005842 Bacteria 3687
147 Ga0068858_100569470 3300005842 Unclassified 1097
148 Ga0068860_100003056 3300005843 Bacteria 17285
149 Ga0068862_100366946 3300005844 Bacteria 1339
150 Ga0068862_100691905 3300005844 Bacteria 987
151 Ga0081539_10010219 3300005985 Bacteria 7676
152 Ga0075366_10028230 3300006195 Bacteria 3293
153 Ga0097621_100052713 3300006237 Bacteria 3314
154 Ga0097621_100064430 3300006237 Bacteria 3014
155 Ga0097621_100218883 3300006237 Bacteria 1658
156 Ga0068871_100007230 3300006358 Bacteria 7920
157 Ga0068871_100121703 3300006358 Unclassified 2205
158 Ga0068871_100123599 3300006358 Bacteria 2188
159 Ga0068871_100149551 3300006358 Bacteria 1990
160 Ga0068871_101157837 3300006358 Bacteria 724
161 Ga0068865_100000289 3300006881 Bacteria 27735
162 Ga0097620_100039443 3300006931 Bacteria 4737
163 Ga0097620_100145632 3300006931 Unclassified 2443
164 Ga0097620_100284907 3300006931 Bacteria 1745
165 Ga0097620_100293056 3300006931 Bacteria 1720
166 Ga0097620_100411277 3300006931 Bacteria 1449
167 Ga0097620_100431876 3300006931 Bacteria 1413
168 Ga0105240_10603071 3300009093 Bacteria 1209
169 Ga0105240_11388710 3300009093 Bacteria 739
170 Ga0105247_10207909 3300009101 Bacteria 1319
171 Ga0114129_10004318 3300009147 Bacteria 20100
172 Ga0105243_10030859 3300009148 Bacteria 4130
173 Ga0105241_10235376 3300009174 Bacteria 1546
174 Ga0105248_10833132 3300009177 Bacteria 1041
175 Ga0105237_10016185 3300009545 Bacteria 7756
176 Ga0105237_10104778 3300009545 Bacteria 2820
177 Ga0105238_10042310 3300009551 Bacteria 4614
178 Ga0105238_10084634 3300009551 Bacteria 3161
179 Ga0105249_10021219 3300009553 Bacteria 5815
180 Ga0105249_10077703 3300009553 Bacteria 3079
181 Ga0105239_10032921 3300010375 Bacteria 5695
182 Ga0105239_10056067 3300010375 Bacteria 4322
183 Ga0105239_10072285 3300010375 Bacteria 3791
184 Ga0105239_10695295 3300010375 Unclassified 1162
185 Ga0105246_10075512 3300011119 Bacteria 2386
186 Ga0157373_10014397 3300013100 Bacteria 5798
187 Ga0157373_10168447 3300013100 Bacteria 1542
188 Ga0157373_10495992 3300013100 Bacteria 882
189 Ga0157371_10105000 3300013102 Bacteria 2004
190 Ga0157371_10337681 3300013102 Bacteria 1095
191 Ga0157369_10148752 3300013105 Bacteria 2475
192 Ga0157369_10605526 3300013105 Bacteria 1131
193 Ga0157374_10000745 3300013296 Bacteria 28347
194 Ga0157374_10002159 3300013296 Bacteria 16586
195 Ga0157374_10028707 3300013296 Bacteria 5028
196 Ga0157374_10040401 3300013296 Bacteria 4296
197 Ga0157374_10652400 3300013296 Bacteria 1064
198 Ga0157378_10022980 3300013297 Bacteria 5489
199 Ga0157378_10042681 3300013297 Bacteria 4025
200 Ga0157378_10081940 3300013297 Bacteria 2917
201 Ga0157378_10237762 3300013297 Unclassified 1739
202 Ga0163162_10000544 3300013306 Bacteria 34854
203 Ga0163162_10001237 3300013306 Bacteria 23878
204 Ga0163162_10005247 3300013306 Bacteria 12489
205 Ga0163162_10010645 3300013306 Bacteria 8945
206 Ga0163162_10023789 3300013306 Bacteria 6046
207 Ga0163162_10146250 3300013306 Bacteria 2480
208 Ga0163162_10210054 3300013306 Bacteria 2076
209 Ga0163162_10530671 3300013306 Bacteria 1306
210 Ga0157372_10115180 3300013307 Bacteria 3082
211 Ga0157372_10168419 3300013307 Bacteria 2534
212 Ga0157375_10000821 3300013308 Bacteria 27183
213 Ga0157375_10019807 3300013308 Bacteria 6131
214 Ga0157375_10023937 3300013308 Bacteria 5643
215 Ga0157375_10076269 3300013308 Bacteria 3379
216 Ga0157375_10354455 3300013308 Bacteria 1633
217 Ga0157375_10454802 3300013308 Unclassified 1446
218 Ga0157375_10823093 3300013308 Bacteria 1076
219 Ga0157375_11203075 3300013308 Bacteria 889
220 Ga0163163_10000963 3300014325 Bacteria 24470
221 Ga0163163_10001217 3300014325 Bacteria 21766
222 Ga0163163_10240113 3300014325 Bacteria 1861
223 Ga0157380_10029165 3300014326 Bacteria 4216
224 Ga0157377_10025646 3300014745 Bacteria 3146
225 Ga0157379_10000115 3300014968 Bacteria 55499
226 Ga0157379_10028680 3300014968 Bacteria 4950
227 Ga0157379_10044130 3300014968 Bacteria 3980
228 Ga0157376_10001273 3300014969 Bacteria 16559
229 Ga0157376_11106447 3300014969 Bacteria 818
230 Ga0157376_11394480 3300014969 Bacteria 732
231 Ga0163161_10011605 3300017792 Bacteria 6117
232 Ga0163161_10020617 3300017792 Bacteria 4628
233 Ga0163161_10024139 3300017792 Bacteria 4294
234 Ga0163161_10149103 3300017792 Bacteria 1776
235 Ga0206355_1678078 3300020076 Bacteria 621
236 Ga0206352_10149106 3300020078 Bacteria 1070
237 Ga0207697_10035782 3300025315 Bacteria 2033
238 Ga0207656_10001238 3300025321 Bacteria 8444
239 Ga0207656_10308247 3300025321 Bacteria 784
240 Ga0207642_10253825 3300025899 Bacteria 999
241 Ga0207710_10130731 3300025900 Bacteria 1205
242 Ga0207688_10757733 3300025901 Bacteria 615
243 Ga0207680_10001588 3300025903 Bacteria 10724
244 Ga0207680_10024314 3300025903 Bacteria 3323
245 Ga0207647_10071936 3300025904 Unclassified 2086
246 Ga0207685_10131319 3300025905 Bacteria 1112
247 Ga0207645_10001661 3300025907 Bacteria 18125
248 Ga0207645_10006830 3300025907 Bacteria 8141
249 Ga0207643_10214809 3300025908 Bacteria 1175
250 Ga0207705_10003873 3300025909 Bacteria 11386
251 Ga0207705_10322352 3300025909 Bacteria 1187
252 Ga0207654_10350379 3300025911 Unclassified 1016
253 Ga0207695_10301536 3300025913 Bacteria 1493
254 Ga0207695_10997690 3300025913 Bacteria 717
255 Ga0207660_10100766 3300025917 Bacteria 2157
256 Ga0207657_10002187 3300025919 Bacteria 21179
257 Ga0207657_10224135 3300025919 Bacteria 1505
258 Ga0207649_10007347 3300025920 Bacteria 5996
259 Ga0207649_10172413 3300025920 Bacteria 1508
260 Ga0207649_10269816 3300025920 Bacteria 1233
261 Ga0207649_10444796 3300025920 Bacteria 977
262 Ga0207649_10948991 3300025920 Bacteria 676
263 Ga0207652_10021029 3300025921 Bacteria 5382
264 Ga0207681_10144216 3300025923 Unclassified 1777
265 Ga0207650_10556579 3300025925 Bacteria 962
266 Ga0207650_10733809 3300025925 Bacteria 835
267 Ga0207659_10066736 3300025926 Bacteria 2612
268 Ga0207659_10085336 3300025926 Unclassified 2346
269 Ga0207659_10395306 3300025926 Bacteria 1155
270 Ga0207659_10798363 3300025926 Bacteria 811
271 Ga0207644_10168073 3300025931 Bacteria 1710
272 Ga0207644_10186050 3300025931 Bacteria 1631
273 Ga0207644_10857209 3300025931 Bacteria 761
274 Ga0207690_10028866 3300025932 Bacteria 3520
275 Ga0207690_10040164 3300025932 Bacteria 3057
276 Ga0207706_10002357 3300025933 Bacteria 18449
277 Ga0207706_10003474 3300025933 Bacteria 15037
278 Ga0207706_10012403 3300025933 Bacteria 7765
279 Ga0207706_10031091 3300025933 Bacteria 4758
280 Ga0207706_10057463 3300025933 Bacteria 3428
281 Ga0207706_10323498 3300025933 Bacteria 1342
282 Ga0207709_10062070 3300025935 Bacteria 2337
283 Ga0207670_10046308 3300025936 Bacteria 2889
284 Ga0207670_10355752 3300025936 Bacteria 1161
285 Ga0207669_10183411 3300025937 Bacteria 1503
286 Ga0207704_10068755 3300025938 Bacteria 2234
287 Ga0207691_10000322 3300025940 Bacteria 47690
288 Ga0207691_10104485 3300025940 Bacteria 2524
289 Ga0207689_10000843 3300025942 Bacteria 29516
290 Ga0207689_10024937 3300025942 Bacteria 5012
291 Ga0207689_10047264 3300025942 Bacteria 3555
292 Ga0207661_10000411 3300025944 Bacteria 27626
293 Ga0207661_10113795 3300025944 Bacteria 2293
294 Ga0207661_10270276 3300025944 Bacteria 1517
295 Ga0207679_10000297 3300025945 Bacteria 37427
296 Ga0207679_10000800 3300025945 Bacteria 20460
297 Ga0207679_10197769 3300025945 Bacteria 1677
298 Ga0207679_10362139 3300025945 Bacteria 1267
299 Ga0207667_10059429 3300025949 Bacteria 4004
300 Ga0207667_10225165 3300025949 Bacteria 1921
301 Ga0207667_10452703 3300025949 Bacteria 1304
302 Ga0207667_10623450 3300025949 Bacteria 1086
303 Ga0207651_10000542 3300025960 Bacteria 15834
304 Ga0207651_10105635 3300025960 Bacteria 2101
305 Ga0207651_10126978 3300025960 Bacteria 1945
306 Ga0207712_10003158 3300025961 Bacteria 10509
307 Ga0207712_10115036 3300025961 Bacteria 2024
308 Ga0207712_10225069 3300025961 Bacteria 1502
309 Ga0207668_10000344 3300025972 Bacteria 30213
310 Ga0207640_10374820 3300025981 Bacteria 1151
311 Ga0207658_10001922 3300025986 Bacteria 15507
312 Ga0207658_10149441 3300025986 Bacteria 1901
313 Ga0207658_10201360 3300025986 Bacteria 1662
314 Ga0207677_10000816 3300026023 Bacteria 17807
315 Ga0207677_10000848 3300026023 Bacteria 17486
316 Ga0207703_10002680 3300026035 Bacteria 15290
317 Ga0207639_10131486 3300026041 Bacteria 2072
318 Ga0207678_10057790 3300026067 Bacteria 3338
319 Ga0207708_10265347 3300026075 Bacteria 1387
320 Ga0207702_10028070 3300026078 Bacteria 4676
321 Ga0207702_10157602 3300026078 Unclassified 2071
322 Ga0207702_10381288 3300026078 Bacteria 1356
323 Ga0207641_10003266 3300026088 Bacteria 14436
324 Ga0207641_10081272 3300026088 Bacteria 2814
325 Ga0207648_10002849 3300026089 Bacteria 18310
326 Ga0207648_10017663 3300026089 Bacteria 6479
327 Ga0207648_10131586 3300026089 Bacteria 2202
328 Ga0207648_10196939 3300026089 Bacteria 1786
329 Ga0207648_10453554 3300026089 Unclassified 1168
330 Ga0207676_10004554 3300026095 Bacteria 9814
331 Ga0207676_10132493 3300026095 Bacteria 2121
332 Ga0207676_10241621 3300026095 Bacteria 1620
333 Ga0207674_10010469 3300026116 Bacteria 10500
334 Ga0207674_10036670 3300026116 Bacteria 5105
335 Ga0207674_10768469 3300026116 Unclassified 930
336 Ga0207675_100030222 3300026118 Bacteria 5045
337 Ga0207675_100170440 3300026118 Bacteria 2080
338 Ga0207675_100228396 3300026118 Bacteria 1795
339 Ga0207675_101308034 3300026118 Unclassified 745
340 Ga0207683_10045179 3300026121 Bacteria 3851
341 Ga0207683_10816341 3300026121 Bacteria 866
342 Ga0207698_10042140 3300026142 Bacteria 3408
343 Ga0207698_10405895 3300026142 Bacteria 1303
344 Ga0207698_11004020 3300026142 Bacteria 845
345 Ga0268266_10000068 3300028379 Bacteria 241100
346 Ga0268266_10442499 3300028379 Bacteria 1234
347 Ga0268264_10001597 3300028381 Bacteria 20969
348 Ga0268264_10132515 3300028381 Bacteria 2212
349 Ga0268264_11289523 3300028381 Bacteria 740
350 Ga0307408_100152060 3300031548 Bacteria 1828
351 Ga0307413_10012537 3300031824 Bacteria 4223
352 Ga0307410_10294264 3300031852 Bacteria 1279
353 Ga0307406_10071038 3300031901 Bacteria 2281
354 Ga0307407_10068208 3300031903 Bacteria 2106
355 Ga0307409_100122558 3300031995 Bacteria 2205
356 Ga0307416_100002426 3300032002 Bacteria 10699
357 Ga0307414_10142426 3300032004 Unclassified 1879
358 Ga0307415_100009221 3300032126 Bacteria 5516
359 Ga0373943_0119379 3300035170 Unclassified 1400
360 Ga0373933_0597127 3300035724 Bacteria 725
361 Ga0373947_0281659 3300035725 Bacteria 1105
362 Ga0373937_0075608 3300036401 Bacteria 3110
363 Ga0373937_0254094 3300036401 Bacteria 1657
364 Ga0439466_0118144 3300041411 Bacteria 820
365 Ga0451793_1613459 3300041452 Bacteria 793
366 Ga0451807_2096905 3300041486 Unclassified 2034
367 Ga0439431_0098794 3300041997 Unclassified 801
368 Ga0439433_0050230 3300041999 Unclassified 982
369 Ga0439445_0015735 3300042004 Bacteria 1856
370 Ga0439432_024415 3300042006 Bacteria 1987
371 Ga0439457_057114 3300042014 Bacteria 881
372 Ga0450894_001329 3300042131 Bacteria 3586
373 Ga0450898_015679 3300042134 Bacteria 1286
374 Ga0466969_0000272 3300044656 Bacteria 28299
375 Ga0466966_0003376 3300044684 Bacteria 10522
376 Ga0466961_0067208 3300044693 Bacteria 2277
377 Ga0466968_0138719 3300044735 Bacteria 1111
378 Ga0466957_0000084 3300044842 Bacteria 37711
379 Ga0466959_0000035 3300045049 Bacteria 108669
380 Ga0466967_0351470 3300045976 Bacteria 1427
381 Ga0495638_0073639 3300046460 Unclassified 2084
382 Ga0495580_0081256 3300046472 Bacteria 2259
383 Ga0495664_0512642 3300046477 Unclassified 716
384 Ga0495630_0035066 3300046517 Bacteria 3750
385 Ga0495648_0004762 3300046524 Bacteria 11487
386 Ga0495652_0449950 3300046529 Bacteria 902
387 Ga0495586_0101882 3300046535 Bacteria 1594
388 Ga0495633_0096307 3300046558 Bacteria 1375
389 Ga0495667_0233578 3300046559 Bacteria 1172
390 Ga0495668_0001009 3300046616 Bacteria 30239
391 Ga0495668_0002730 3300046616 Bacteria 14136
392 Ga0495611_0023055 3300046648 Unclassified 2698
393 Ga0495611_0242061 3300046648 Bacteria 837
394 Ga0495635_0272902 3300046663 Bacteria 1137
395 Ga0495657_0329232 3300046675 Bacteria 907
396 Ga0495647_0166544 3300046681 Bacteria 952
397 Ga0495670_0129687 3300046691 Bacteria 1314
398 Ga0495684_0570236 3300047471 Unclassified 768
399 Ga0495602_0486720 3300048088 Bacteria 865
400 Ga0496106_0945410 3300048909 Unclassified 679
401 Ga0496108_0068293 3300048911 Bacteria 2999
402 Ga0496109_0020712 3300048912 Bacteria 5808
403 Ga0496110_0041814 3300048913 Bacteria 4001
404 Ga0496110_0470326 3300048913 Bacteria 1145
405 Ga0496115_0316653 3300048918 Bacteria 1277
406 Ga0501290_018791 3300049513 Bacteria 934
407 Ga0501292_005148 3300049515 Bacteria 1813
408 Ga0501298_004839 3300049521 Bacteria 2141
409 Ga0501034_0000007 3300049571 Bacteria 357805
410 Ga0501198_003948 3300049649 Bacteria 2047
411 Ga0501201_001790 3300049651 Bacteria 1990
412 Ga0501201_002348 3300049651 Bacteria 1732
413 Ga0501202_000359 3300049652 Bacteria 6357
414 Ga0501202_005281 3300049652 Bacteria 2288
415 Ga0501206_015383 3300049653 Unclassified 1058
416 Ga0501207_004502 3300049654 Bacteria 1898
417 Ga0501217_000190 3300049661 Bacteria 9148
418 Ga0501217_054965 3300049661 Unclassified 1050
419 Ga0501222_000546 3300049662 Bacteria 5580
420 Ga0501223_001006 3300049663 Bacteria 6666
421 Ga0501223_011271 3300049663 Bacteria 1794
422 Ga0501223_062350 3300049663 Bacteria 729
423 Ga0501224_023425 3300049664 Bacteria 922
424 Ga0501227_036874 3300049665 Bacteria 1195
425 Ga0501233_005667 3300049668 Bacteria 2321
426 Ga0501235_008871 3300049669 Bacteria 2193
427 Ga0501235_009105 3300049669 Bacteria 2169
428 Ga0501235_099344 3300049669 Viruses 709
429 Ga0501242_003418 3300049674 Unclassified 1717
430 Ga0501243_000818 3300049675 Bacteria 4320
431 Ga0501250_013190 3300049680 Bacteria 988
432 Ga0501253_046499 3300049683 Unclassified 895
433 Ga0501261_001267 3300049690 Bacteria 3101
434 Ga0501221_000013 3300049704 Bacteria 22152
435 Ga0501221_040815 3300049704 Unclassified 1011
436 Ga0501225_0001754 3300049705 Bacteria 6799
437 Ga0501225_0003389 3300049705 Bacteria 4841
438 Ga0501080_0371098 3300049742 Bacteria 1290
439 Ga0501263_008395 3300049760 Bacteria 1232
440 Ga0501273_011393 3300049770 Unclassified 1107
441 Ga0501212_000331 3300049851 Bacteria 4411
442 nmdc:mga0k408_191753_c1 3300050493 Unclassified 1219
443 nmdc:mga05p37_16679_c1 3300050507 Bacteria 7131
444 Ga0500583_0001086 3300053092 Bacteria 7766
445 Ga0500568_0000335 3300053139 Bacteria 37064
446 Ga0500568_0171066 3300053139 Bacteria 800
447 Ga0500622_0000398 3300053156 Bacteria 41643
448 Ga0500611_000003 3300053727 Bacteria 333431

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009551 Ga0105238_10042310 Ga0105238_100423103 177
2 3300010375 Ga0105239_10072285 Ga0105239_100722854 177
3 3300046524 Ga0495648_0004762 Ga0495648_0004762_1040_1624 183
4 3300046648 Ga0495611_0023055 Ga0495611_0023055_1961_2545 183
5 3300053092 Ga0500583_0001086 Ga0500583_0001086_3349_3933 183
6 3300053156 Ga0500622_0000398 Ga0500622_0000398_23338_23922 183
7 3300005334 Ga0068869_100388073 Ga0068869_1003880731 184
8 3300005539 Ga0068853_101216190 Ga0068853_1012161901 184
9 3300005577 Ga0068857_100056109 Ga0068857_1000561094 184
10 3300005617 Ga0068859_100411300 Ga0068859_1004113002 184
11 3300006931 Ga0097620_100411277 Ga0097620_1004112772 184
12 3300005356 Ga0070674_100046613 Ga0070674_1000466132 185
13 3300005457 Ga0070662_100482828 Ga0070662_1004828281 185
14 3300009553 Ga0105249_10021219 Ga0105249_100212191 185
15 3300025961 Ga0207712_10115036 Ga0207712_101150361 185
16 3300005329 Ga0070683_100170865 Ga0070683_1001708652 186
17 3300005334 Ga0068869_100848410 Ga0068869_1008484101 186
18 3300005338 Ga0068868_100122970 Ga0068868_1001229702 186
19 3300005344 Ga0070661_100208146 Ga0070661_1002081461 186
20 3300005347 Ga0070668_100606509 Ga0070668_1006065091 186
21 3300005354 Ga0070675_100056010 Ga0070675_1000560102 186
22 3300005354 Ga0070675_100137926 Ga0070675_1001379262 186
23 3300005355 Ga0070671_100167619 Ga0070671_1001676192 186
24 3300005366 Ga0070659_100012802 Ga0070659_1000128029 186
25 3300005455 Ga0070663_100364528 Ga0070663_1003645282 186
26 3300005458 Ga0070681_11043683 Ga0070681_110436831 186
27 3300005459 Ga0068867_100981269 Ga0068867_1009812691 186
28 3300005535 Ga0070684_100169563 Ga0070684_1001695632 186
29 3300005564 Ga0070664_100197350 Ga0070664_1001973502 186
30 3300005614 Ga0068856_100009293 Ga0068856_1000092935 186
31 3300005834 Ga0068851_10270415 Ga0068851_102704153 186
32 3300006237 Ga0097621_100218883 Ga0097621_1002188831 186
33 3300013100 Ga0157373_10014397 Ga0157373_100143974 186
34 3300013100 Ga0157373_10168447 Ga0157373_101684472 186
35 3300013102 Ga0157371_10105000 Ga0157371_101050002 186
36 3300013296 Ga0157374_10652400 Ga0157374_106524001 186
37 3300013297 Ga0157378_10081940 Ga0157378_100819407 186
38 3300013306 Ga0163162_10005247 Ga0163162_1000524710 186
39 3300013306 Ga0163162_10210054 Ga0163162_102100542 186
40 3300013308 Ga0157375_10454802 Ga0157375_104548021 186
41 3300020078 Ga0206352_10149106 Ga0206352_101491062 186
42 3300025321 Ga0207656_10308247 Ga0207656_103082471 186
43 3300025909 Ga0207705_10322352 Ga0207705_103223521 186
44 3300025917 Ga0207660_10100766 Ga0207660_101007662 186
45 3300025919 Ga0207657_10002187 Ga0207657_1000218717 186
46 3300025920 Ga0207649_10444796 Ga0207649_104447962 186
47 3300025921 Ga0207652_10021029 Ga0207652_100210298 186
48 3300025925 Ga0207650_10556579 Ga0207650_105565792 186
49 3300025926 Ga0207659_10798363 Ga0207659_107983631 186
50 3300025931 Ga0207644_10168073 Ga0207644_101680732 186
51 3300025932 Ga0207690_10040164 Ga0207690_100401643 186
52 3300025933 Ga0207706_10002357 Ga0207706_100023574 186
53 3300025949 Ga0207667_10452703 Ga0207667_104527032 186
54 3300025981 Ga0207640_10374820 Ga0207640_103748203 186
55 3300026041 Ga0207639_10131486 Ga0207639_101314863 186
56 3300026078 Ga0207702_10028070 Ga0207702_100280708 186
57 3300026089 Ga0207648_10453554 Ga0207648_104535541 186
58 3300026142 Ga0207698_11004020 Ga0207698_110040201 186
59 3300045976 Ga0466967_0351470 Ga0466967_0351470_545_1105 186
60 3300049571 Ga0501034_0000007 Ga0501034_0000007_97202_97762 186
61 3300053139 Ga0500568_0171066 Ga0500568_0171066_45_617 186
62 3300000043 ARcpr5yngRDRAFT_c003720 ARcpr5yngRDRAFT_0037202 187
63 3300002077 JGI24744J21845_10014815 JGI24744J21845_100148152 187
64 3300003322 rootL2_10101186 rootL2_101011863 187
65 3300003323 rootH1_10239146 rootH1_102391466 187
66 3300005328 Ga0070676_10000701 Ga0070676_100007015 187
67 3300005329 Ga0070683_100000327 Ga0070683_1000003274 187
68 3300005329 Ga0070683_100025753 Ga0070683_1000257532 187
69 3300005329 Ga0070683_100424926 Ga0070683_1004249262 187
70 3300005329 Ga0070683_100989393 Ga0070683_1009893932 187
71 3300005330 Ga0070690_100007060 Ga0070690_1000070603 187
72 3300005330 Ga0070690_100288837 Ga0070690_1002888371 187
73 3300005331 Ga0070670_100645097 Ga0070670_1006450972 187
74 3300005334 Ga0068869_100126241 Ga0068869_1001262413 187
75 3300005334 Ga0068869_100141896 Ga0068869_1001418963 187
76 3300005334 Ga0068869_100150615 Ga0068869_1001506152 187
77 3300005335 Ga0070666_10000571 Ga0070666_1000057111 187
78 3300005335 Ga0070666_10003150 Ga0070666_100031508 187
79 3300005335 Ga0070666_10227166 Ga0070666_102271662 187
80 3300005335 Ga0070666_10340500 Ga0070666_103405001 187
81 3300005337 Ga0070682_100146006 Ga0070682_1001460063 187
82 3300005338 Ga0068868_100000112 Ga0068868_10000011238 187
83 3300005338 Ga0068868_100054664 Ga0068868_1000546642 187
84 3300005338 Ga0068868_100064855 Ga0068868_1000648554 187
85 3300005338 Ga0068868_100163318 Ga0068868_1001633182 187
86 3300005339 Ga0070660_100316253 Ga0070660_1003162532 187
87 3300005339 Ga0070660_100350986 Ga0070660_1003509862 187
88 3300005340 Ga0070689_100050956 Ga0070689_1000509562 187
89 3300005340 Ga0070689_100561548 Ga0070689_1005615482 187
90 3300005340 Ga0070689_100819019 Ga0070689_1008190191 187
91 3300005344 Ga0070661_100001786 Ga0070661_1000017861 187
92 3300005344 Ga0070661_100039375 Ga0070661_1000393751 187
93 3300005344 Ga0070661_100059364 Ga0070661_1000593642 187
94 3300005344 Ga0070661_100315772 Ga0070661_1003157722 187
95 3300005347 Ga0070668_100000110 Ga0070668_10000011022 187
96 3300005353 Ga0070669_100165782 Ga0070669_1001657824 187
97 3300005354 Ga0070675_100060469 Ga0070675_1000604694 187
98 3300005354 Ga0070675_101007685 Ga0070675_1010076851 187
99 3300005355 Ga0070671_100022762 Ga0070671_1000227623 187
100 3300005355 Ga0070671_100736866 Ga0070671_1007368661 187
101 3300005355 Ga0070671_100896941 Ga0070671_1008969411 187
102 3300005356 Ga0070674_100273104 Ga0070674_1002731041 187
103 3300005364 Ga0070673_100001374 Ga0070673_10000137410 187
104 3300005364 Ga0070673_100015009 Ga0070673_1000150093 187
105 3300005364 Ga0070673_100049647 Ga0070673_1000496474 187
106 3300005365 Ga0070688_100003958 Ga0070688_1000039587 187
107 3300005365 Ga0070688_100241515 Ga0070688_1002415151 187
108 3300005366 Ga0070659_100023860 Ga0070659_1000238602 187
109 3300005366 Ga0070659_100419250 Ga0070659_1004192501 187
110 3300005367 Ga0070667_100011085 Ga0070667_1000110853 187
111 3300005367 Ga0070667_100018912 Ga0070667_1000189123 187
112 3300005367 Ga0070667_100217478 Ga0070667_1002174782 187
113 3300005367 Ga0070667_100218342 Ga0070667_1002183421 187
114 3300005455 Ga0070663_100176331 Ga0070663_1001763312 187
115 3300005456 Ga0070678_100014347 Ga0070678_1000143472 187
116 3300005456 Ga0070678_100167177 Ga0070678_1001671771 187
117 3300005457 Ga0070662_100000209 Ga0070662_10000020931 187
118 3300005457 Ga0070662_100018140 Ga0070662_1000181402 187
119 3300005457 Ga0070662_100022389 Ga0070662_1000223895 187
120 3300005457 Ga0070662_100023895 Ga0070662_1000238952 187
121 3300005457 Ga0070662_100187419 Ga0070662_1001874192 187
122 3300005459 Ga0068867_100000620 Ga0068867_1000006208 187
123 3300005459 Ga0068867_100320573 Ga0068867_1003205731 187
124 3300005466 Ga0070685_10004060 Ga0070685_100040604 187
125 3300005466 Ga0070685_10077042 Ga0070685_100770422 187
126 3300005466 Ga0070685_10092852 Ga0070685_100928522 187
127 3300005530 Ga0070679_100264055 Ga0070679_1002640551 187
128 3300005535 Ga0070684_100000290 Ga0070684_10000029028 187
129 3300005535 Ga0070684_100093509 Ga0070684_1000935093 187
130 3300005535 Ga0070684_100186628 Ga0070684_1001866282 187
131 3300005535 Ga0070684_100960463 Ga0070684_1009604631 187
132 3300005539 Ga0068853_100021273 Ga0068853_1000212733 187
133 3300005539 Ga0068853_100083007 Ga0068853_1000830074 187
134 3300005539 Ga0068853_100153499 Ga0068853_1001534992 187
135 3300005543 Ga0070672_100000020 Ga0070672_10000002037 187
136 3300005543 Ga0070672_100043662 Ga0070672_1000436622 187
137 3300005544 Ga0070686_100091651 Ga0070686_1000916513 187
138 3300005547 Ga0070693_100349389 Ga0070693_1003493891 187
139 3300005548 Ga0070665_100000318 Ga0070665_10000031822 187
140 3300005548 Ga0070665_100271077 Ga0070665_1002710772 187
141 3300005563 Ga0068855_100010786 Ga0068855_1000107862 187
142 3300005563 Ga0068855_100031935 Ga0068855_1000319352 187
143 3300005563 Ga0068855_100362439 Ga0068855_1003624391 187
144 3300005563 Ga0068855_101430697 Ga0068855_1014306972 187
145 3300005564 Ga0070664_100012786 Ga0070664_1000127867 187
146 3300005564 Ga0070664_100134416 Ga0070664_1001344163 187
147 3300005564 Ga0070664_100231230 Ga0070664_1002312302 187
148 3300005564 Ga0070664_100388211 Ga0070664_1003882111 187
149 3300005564 Ga0070664_100495029 Ga0070664_1004950292 187
150 3300005577 Ga0068857_100004228 Ga0068857_1000042282 187
151 3300005577 Ga0068857_100008029 Ga0068857_1000080298 187
152 3300005578 Ga0068854_100053998 Ga0068854_1000539983 187
153 3300005578 Ga0068854_100486619 Ga0068854_1004866191 187
154 3300005614 Ga0068856_100061491 Ga0068856_1000614913 187
155 3300005615 Ga0070702_100259391 Ga0070702_1002593912 187
156 3300005616 Ga0068852_100003299 Ga0068852_1000032995 187
157 3300005616 Ga0068852_100084310 Ga0068852_1000843103 187
158 3300005616 Ga0068852_100442285 Ga0068852_1004422852 187
159 3300005616 Ga0068852_100872321 Ga0068852_1008723211 187
160 3300005617 Ga0068859_100039445 Ga0068859_1000394453 187
161 3300005617 Ga0068859_100145631 Ga0068859_1001456313 187
162 3300005617 Ga0068859_100293037 Ga0068859_1002930372 187
163 3300005617 Ga0068859_100431885 Ga0068859_1004318852 187
164 3300005618 Ga0068864_100000934 Ga0068864_10000093421 187
165 3300005618 Ga0068864_100023861 Ga0068864_1000238617 187
166 3300005718 Ga0068866_10031831 Ga0068866_100318313 187
167 3300005719 Ga0068861_100020234 Ga0068861_1000202342 187
168 3300005834 Ga0068851_10000510 Ga0068851_100005109 187
169 3300005841 Ga0068863_100000678 Ga0068863_1000006787 187
170 3300005841 Ga0068863_100096527 Ga0068863_1000965272 187
171 3300005841 Ga0068863_100540921 Ga0068863_1005409211 187
172 3300005842 Ga0068858_100000342 Ga0068858_1000003428 187
173 3300005842 Ga0068858_100054812 Ga0068858_1000548122 187
174 3300005842 Ga0068858_100569470 Ga0068858_1005694702 187
175 3300005843 Ga0068860_100003056 Ga0068860_1000030568 187
176 3300005844 Ga0068862_100366946 Ga0068862_1003669461 187
177 3300005844 Ga0068862_100691905 Ga0068862_1006919051 187
178 3300005985 Ga0081539_10010219 Ga0081539_100102198 187
179 3300006195 Ga0075366_10028230 Ga0075366_100282302 187
180 3300006237 Ga0097621_100052713 Ga0097621_1000527132 187
181 3300006237 Ga0097621_100064430 Ga0097621_1000644302 187
182 3300006358 Ga0068871_100007230 Ga0068871_1000072306 187
183 3300006358 Ga0068871_100121703 Ga0068871_1001217031 187
184 3300006358 Ga0068871_100123599 Ga0068871_1001235991 187
185 3300006358 Ga0068871_100149551 Ga0068871_1001495512 187
186 3300006358 Ga0068871_101157837 Ga0068871_1011578372 187
187 3300006881 Ga0068865_100000289 Ga0068865_10000028925 187
188 3300006931 Ga0097620_100039443 Ga0097620_1000394433 187
189 3300006931 Ga0097620_100145632 Ga0097620_1001456323 187
190 3300006931 Ga0097620_100293056 Ga0097620_1002930562 187
191 3300006931 Ga0097620_100431876 Ga0097620_1004318762 187
192 3300009093 Ga0105240_10603071 Ga0105240_106030712 187
193 3300009101 Ga0105247_10207909 Ga0105247_102079092 187
194 3300009147 Ga0114129_10004318 Ga0114129_1000431816 187
195 3300009148 Ga0105243_10030859 Ga0105243_100308593 187
196 3300009174 Ga0105241_10235376 Ga0105241_102353763 187
197 3300009177 Ga0105248_10833132 Ga0105248_108331322 187
198 3300009545 Ga0105237_10016185 Ga0105237_1001618510 187
199 3300009545 Ga0105237_10104778 Ga0105237_101047782 187
200 3300009551 Ga0105238_10084634 Ga0105238_100846342 187
201 3300009553 Ga0105249_10077703 Ga0105249_100777033 187
202 3300010375 Ga0105239_10056067 Ga0105239_100560672 187
203 3300010375 Ga0105239_10695295 Ga0105239_106952952 187
204 3300011119 Ga0105246_10075512 Ga0105246_100755122 187
205 3300013100 Ga0157373_10495992 Ga0157373_104959922 187
206 3300013102 Ga0157371_10337681 Ga0157371_103376811 187
207 3300013105 Ga0157369_10148752 Ga0157369_101487522 187
208 3300013105 Ga0157369_10605526 Ga0157369_106055261 187
209 3300013296 Ga0157374_10000745 Ga0157374_1000074512 187
210 3300013296 Ga0157374_10002159 Ga0157374_1000215914 187
211 3300013296 Ga0157374_10028707 Ga0157374_100287075 187
212 3300013296 Ga0157374_10040401 Ga0157374_100404015 187
213 3300013297 Ga0157378_10022980 Ga0157378_100229806 187
214 3300013297 Ga0157378_10042681 Ga0157378_100426813 187
215 3300013306 Ga0163162_10000544 Ga0163162_1000054426 187
216 3300013306 Ga0163162_10001237 Ga0163162_1000123725 187
217 3300013306 Ga0163162_10010645 Ga0163162_100106455 187
218 3300013306 Ga0163162_10023789 Ga0163162_100237892 187
219 3300013306 Ga0163162_10146250 Ga0163162_101462502 187
220 3300013306 Ga0163162_10530671 Ga0163162_105306712 187
221 3300013307 Ga0157372_10115180 Ga0157372_101151802 187
222 3300013307 Ga0157372_10168419 Ga0157372_101684193 187
223 3300013308 Ga0157375_10000821 Ga0157375_100008219 187
224 3300013308 Ga0157375_10019807 Ga0157375_100198075 187
225 3300013308 Ga0157375_10023937 Ga0157375_100239373 187
226 3300013308 Ga0157375_10076269 Ga0157375_100762692 187
227 3300013308 Ga0157375_10354455 Ga0157375_103544553 187
228 3300013308 Ga0157375_10823093 Ga0157375_108230932 187
229 3300013308 Ga0157375_11203075 Ga0157375_112030752 187
230 3300014325 Ga0163163_10000963 Ga0163163_1000096320 187
231 3300014325 Ga0163163_10001217 Ga0163163_100012177 187
232 3300014325 Ga0163163_10240113 Ga0163163_102401133 187
233 3300014745 Ga0157377_10025646 Ga0157377_100256463 187
234 3300014968 Ga0157379_10000115 Ga0157379_1000011525 187
235 3300014968 Ga0157379_10028680 Ga0157379_100286805 187
236 3300014968 Ga0157379_10044130 Ga0157379_100441302 187
237 3300014969 Ga0157376_10001273 Ga0157376_100012732 187
238 3300014969 Ga0157376_11106447 Ga0157376_111064471 187
239 3300014969 Ga0157376_11394480 Ga0157376_113944801 187
240 3300017792 Ga0163161_10011605 Ga0163161_100116055 187
241 3300017792 Ga0163161_10020617 Ga0163161_100206171 187
242 3300017792 Ga0163161_10024139 Ga0163161_100241396 187
243 3300017792 Ga0163161_10149103 Ga0163161_101491032 187
244 3300020076 Ga0206355_1678078 Ga0206355_16780781 187
245 3300025315 Ga0207697_10035782 Ga0207697_100357822 187
246 3300025321 Ga0207656_10001238 Ga0207656_100012385 187
247 3300025899 Ga0207642_10253825 Ga0207642_102538252 187
248 3300025900 Ga0207710_10130731 Ga0207710_101307312 187
249 3300025901 Ga0207688_10757733 Ga0207688_107577331 187
250 3300025903 Ga0207680_10001588 Ga0207680_1000158810 187
251 3300025903 Ga0207680_10024314 Ga0207680_100243142 187
252 3300025904 Ga0207647_10071936 Ga0207647_100719361 187
253 3300025905 Ga0207685_10131319 Ga0207685_101313192 187
254 3300025907 Ga0207645_10001661 Ga0207645_100016616 187
255 3300025907 Ga0207645_10006830 Ga0207645_100068308 187
256 3300025908 Ga0207643_10214809 Ga0207643_102148091 187
257 3300025909 Ga0207705_10003873 Ga0207705_100038736 187
258 3300025911 Ga0207654_10350379 Ga0207654_103503792 187
259 3300025913 Ga0207695_10301536 Ga0207695_103015361 187
260 3300025913 Ga0207695_10997690 Ga0207695_109976902 187
261 3300025919 Ga0207657_10224135 Ga0207657_102241353 187
262 3300025920 Ga0207649_10007347 Ga0207649_100073473 187
263 3300025920 Ga0207649_10172413 Ga0207649_101724132 187
264 3300025920 Ga0207649_10269816 Ga0207649_102698161 187
265 3300025920 Ga0207649_10948991 Ga0207649_109489911 187
266 3300025923 Ga0207681_10144216 Ga0207681_101442163 187
267 3300025925 Ga0207650_10733809 Ga0207650_107338092 187
268 3300025926 Ga0207659_10066736 Ga0207659_100667363 187
269 3300025926 Ga0207659_10395306 Ga0207659_103953063 187
270 3300025931 Ga0207644_10186050 Ga0207644_101860503 187
271 3300025931 Ga0207644_10857209 Ga0207644_108572091 187
272 3300025932 Ga0207690_10028866 Ga0207690_100288663 187
273 3300025933 Ga0207706_10003474 Ga0207706_1000347410 187
274 3300025933 Ga0207706_10012403 Ga0207706_100124031 187
275 3300025933 Ga0207706_10031091 Ga0207706_100310912 187
276 3300025933 Ga0207706_10057463 Ga0207706_100574633 187
277 3300025933 Ga0207706_10323498 Ga0207706_103234981 187
278 3300025935 Ga0207709_10062070 Ga0207709_100620702 187
279 3300025936 Ga0207670_10046308 Ga0207670_100463081 187
280 3300025936 Ga0207670_10355752 Ga0207670_103557523 187
281 3300025938 Ga0207704_10068755 Ga0207704_100687553 187
282 3300025940 Ga0207691_10000322 Ga0207691_1000032238 187
283 3300025940 Ga0207691_10104485 Ga0207691_101044852 187
284 3300025942 Ga0207689_10000843 Ga0207689_1000084321 187
285 3300025942 Ga0207689_10024937 Ga0207689_100249372 187
286 3300025942 Ga0207689_10047264 Ga0207689_100472646 187
287 3300025944 Ga0207661_10000411 Ga0207661_100004113 187
288 3300025944 Ga0207661_10113795 Ga0207661_101137952 187
289 3300025944 Ga0207661_10270276 Ga0207661_102702762 187
290 3300025945 Ga0207679_10000297 Ga0207679_100002979 187
291 3300025945 Ga0207679_10000800 Ga0207679_1000080022 187
292 3300025945 Ga0207679_10197769 Ga0207679_101977692 187
293 3300025945 Ga0207679_10362139 Ga0207679_103621392 187
294 3300025949 Ga0207667_10059429 Ga0207667_100594292 187
295 3300025949 Ga0207667_10225165 Ga0207667_102251652 187
296 3300025949 Ga0207667_10623450 Ga0207667_106234501 187
297 3300025960 Ga0207651_10000542 Ga0207651_1000054210 187
298 3300025960 Ga0207651_10105635 Ga0207651_101056351 187
299 3300025960 Ga0207651_10126978 Ga0207651_101269781 187
300 3300025961 Ga0207712_10003158 Ga0207712_100031588 187
301 3300025961 Ga0207712_10225069 Ga0207712_102250692 187
302 3300025972 Ga0207668_10000344 Ga0207668_100003449 187
303 3300025986 Ga0207658_10001922 Ga0207658_100019226 187
304 3300025986 Ga0207658_10149441 Ga0207658_101494412 187
305 3300025986 Ga0207658_10201360 Ga0207658_102013603 187
306 3300026023 Ga0207677_10000816 Ga0207677_100008169 187
307 3300026023 Ga0207677_10000848 Ga0207677_100008489 187
308 3300026035 Ga0207703_10002680 Ga0207703_1000268010 187
309 3300026067 Ga0207678_10057790 Ga0207678_100577903 187
310 3300026075 Ga0207708_10265347 Ga0207708_102653472 187
311 3300026078 Ga0207702_10157602 Ga0207702_101576022 187
312 3300026078 Ga0207702_10381288 Ga0207702_103812882 187
313 3300026088 Ga0207641_10003266 Ga0207641_1000326611 187
314 3300026088 Ga0207641_10081272 Ga0207641_100812722 187
315 3300026089 Ga0207648_10002849 Ga0207648_100028493 187
316 3300026089 Ga0207648_10017663 Ga0207648_100176632 187
317 3300026089 Ga0207648_10131586 Ga0207648_101315862 187
318 3300026089 Ga0207648_10196939 Ga0207648_101969392 187
319 3300026095 Ga0207676_10004554 Ga0207676_100045547 187
320 3300026095 Ga0207676_10132493 Ga0207676_101324932 187
321 3300026095 Ga0207676_10241621 Ga0207676_102416213 187
322 3300026116 Ga0207674_10010469 Ga0207674_100104692 187
323 3300026116 Ga0207674_10036670 Ga0207674_100366706 187
324 3300026116 Ga0207674_10768469 Ga0207674_107684691 187
325 3300026118 Ga0207675_100030222 Ga0207675_1000302226 187
326 3300026118 Ga0207675_100228396 Ga0207675_1002283961 187
327 3300026118 Ga0207675_101308034 Ga0207675_1013080341 187
328 3300026121 Ga0207683_10045179 Ga0207683_100451793 187
329 3300026121 Ga0207683_10816341 Ga0207683_108163411 187
330 3300026142 Ga0207698_10042140 Ga0207698_100421403 187
331 3300026142 Ga0207698_10405895 Ga0207698_104058952 187
332 3300028379 Ga0268266_10442499 Ga0268266_104424991 187
333 3300028381 Ga0268264_10001597 Ga0268264_1000159710 187
334 3300028381 Ga0268264_10132515 Ga0268264_101325152 187
335 3300028381 Ga0268264_11289523 Ga0268264_112895231 187
336 3300035170 Ga0373943_0119379 Ga0373943_0119379_95_658 187
337 3300035724 Ga0373933_0597127 Ga0373933_0597127_99_662 187
338 3300035725 Ga0373947_0281659 Ga0373947_0281659_384_947 187
339 3300036401 Ga0373937_0075608 Ga0373937_0075608_858_1421 187
340 3300036401 Ga0373937_0254094 Ga0373937_0254094_722_1285 187
341 3300041411 Ga0439466_0118144 Ga0439466_0118144_197_760 187
342 3300041452 Ga0451793_1613459 Ga0451793_1613459_15_578 187
343 3300041486 Ga0451807_2096905 Ga0451807_2096905_888_1451 187
344 3300041997 Ga0439431_0098794 Ga0439431_0098794_109_672 187
345 3300042004 Ga0439445_0015735 Ga0439445_0015735_135_698 187
346 3300042006 Ga0439432_024415 Ga0439432_024415_1091_1654 187
347 3300042131 Ga0450894_001329 Ga0450894_001329_228_791 187
348 3300042134 Ga0450898_015679 Ga0450898_015679_407_970 187
349 3300044656 Ga0466969_0000272 Ga0466969_0000272_25149_25730 187
350 3300044684 Ga0466966_0003376 Ga0466966_0003376_3454_4035 187
351 3300044693 Ga0466961_0067208 Ga0466961_0067208_159_740 187
352 3300044735 Ga0466968_0138719 Ga0466968_0138719_408_989 187
353 3300044842 Ga0466957_0000084 Ga0466957_0000084_19113_19694 187
354 3300045049 Ga0466959_0000035 Ga0466959_0000035_82900_83481 187
355 3300046460 Ga0495638_0073639 Ga0495638_0073639_207_770 187
356 3300046472 Ga0495580_0081256 Ga0495580_0081256_871_1434 187
357 3300046477 Ga0495664_0512642 Ga0495664_0512642_17_580 187
358 3300046517 Ga0495630_0035066 Ga0495630_0035066_2849_3412 187
359 3300046529 Ga0495652_0449950 Ga0495652_0449950_299_862 187
360 3300046535 Ga0495586_0101882 Ga0495586_0101882_946_1509 187
361 3300046558 Ga0495633_0096307 Ga0495633_0096307_579_1142 187
362 3300046559 Ga0495667_0233578 Ga0495667_0233578_506_1069 187
363 3300046616 Ga0495668_0001009 Ga0495668_0001009_29499_30083 187
364 3300046616 Ga0495668_0002730 Ga0495668_0002730_3514_4155 187
365 3300046648 Ga0495611_0242061 Ga0495611_0242061_17_589 187
366 3300046663 Ga0495635_0272902 Ga0495635_0272902_307_870 187
367 3300046675 Ga0495657_0329232 Ga0495657_0329232_260_823 187
368 3300046681 Ga0495647_0166544 Ga0495647_0166544_209_772 187
369 3300046691 Ga0495670_0129687 Ga0495670_0129687_462_1025 187
370 3300047471 Ga0495684_0570236 Ga0495684_0570236_113_676 187
371 3300048088 Ga0495602_0486720 Ga0495602_0486720_97_699 187
372 3300048909 Ga0496106_0945410 Ga0496106_0945410_75_638 187
373 3300048911 Ga0496108_0068293 Ga0496108_0068293_401_964 187
374 3300048912 Ga0496109_0020712 Ga0496109_0020712_1716_2279 187
375 3300048913 Ga0496110_0041814 Ga0496110_0041814_1637_2311 187
376 3300048913 Ga0496110_0470326 Ga0496110_0470326_543_1106 187
377 3300048918 Ga0496115_0316653 Ga0496115_0316653_192_755 187
378 3300049742 Ga0501080_0371098 Ga0501080_0371098_315_878 187
379 3300050493 nmdc:mga0k408_191753_c1 nmdc:mga0k408_191753_c1_565_1146 187
380 3300050507 nmdc:mga05p37_16679_c1 nmdc:mga05p37_16679_c1_393_974 187
381 3300053139 Ga0500568_0000335 Ga0500568_0000335_3811_4374 187
382 3300053727 Ga0500611_000003 Ga0500611_000003_123131_123694 187
383 2162886012 MBSR1b_contig_12999027 MBSR1b_0531.00006230 188
384 2162886012 MBSR1b_contig_13755480 MBSR1b_0306.00002540 188
385 3300005288 Ga0065714_10016476 Ga0065714_100164762 188
386 3300005293 Ga0065715_10009925 Ga0065715_100099254 188
387 3300005331 Ga0070670_100188351 Ga0070670_1001883512 188
388 3300005331 Ga0070670_100563728 Ga0070670_1005637281 188
389 3300005356 Ga0070674_100988157 Ga0070674_1009881571 188
390 3300005364 Ga0070673_100968070 Ga0070673_1009680701 188
391 3300005543 Ga0070672_100124319 Ga0070672_1001243192 188
392 3300005548 Ga0070665_100000014 Ga0070665_100000014279 188
393 3300005719 Ga0068861_100170740 Ga0068861_1001707402 188
394 3300005834 Ga0068851_10292552 Ga0068851_102925522 188
395 3300006931 Ga0097620_100284907 Ga0097620_1002849073 188
396 3300009093 Ga0105240_11388710 Ga0105240_113887101 188
397 3300010375 Ga0105239_10032921 Ga0105239_100329213 188
398 3300013297 Ga0157378_10237762 Ga0157378_102377622 188
399 3300014326 Ga0157380_10029165 Ga0157380_100291655 188
400 3300025926 Ga0207659_10085336 Ga0207659_100853363 188
401 3300025937 Ga0207669_10183411 Ga0207669_101834111 188
402 3300026118 Ga0207675_100170440 Ga0207675_1001704402 188
403 3300028379 Ga0268266_10000068 Ga0268266_10000068155 188
404 3300031548 Ga0307408_100152060 Ga0307408_1001520602 188
405 3300031824 Ga0307413_10012537 Ga0307413_100125373 188
406 3300031852 Ga0307410_10294264 Ga0307410_102942642 188
407 3300031901 Ga0307406_10071038 Ga0307406_100710382 188
408 3300031903 Ga0307407_10068208 Ga0307407_100682082 188
409 3300031995 Ga0307409_100122558 Ga0307409_1001225583 188
410 3300032002 Ga0307416_100002426 Ga0307416_1000024264 188
411 3300032004 Ga0307414_10142426 Ga0307414_101424264 188
412 3300032126 Ga0307415_100009221 Ga0307415_1000092215 188
413 3300041999 Ga0439433_0050230 Ga0439433_0050230_387_968 188
414 3300042014 Ga0439457_057114 Ga0439457_057114_73_654 188
415 3300049513 Ga0501290_018791 Ga0501290_018791_21_635 188
416 3300049515 Ga0501292_005148 Ga0501292_005148_1028_1642 188
417 3300049521 Ga0501298_004839 Ga0501298_004839_154_768 188
418 3300049649 Ga0501198_003948 Ga0501198_003948_1416_2030 188
419 3300049651 Ga0501201_001790 Ga0501201_001790_1269_1883 188
420 3300049651 Ga0501201_002348 Ga0501201_002348_440_1021 188
421 3300049652 Ga0501202_000359 Ga0501202_000359_3843_4457 188
422 3300049652 Ga0501202_005281 Ga0501202_005281_1154_1735 188
423 3300049653 Ga0501206_015383 Ga0501206_015383_175_789 188
424 3300049654 Ga0501207_004502 Ga0501207_004502_264_878 188
425 3300049661 Ga0501217_000190 Ga0501217_000190_2705_3319 188
426 3300049661 Ga0501217_054965 Ga0501217_054965_217_798 188
427 3300049662 Ga0501222_000546 Ga0501222_000546_4032_4646 188
428 3300049663 Ga0501223_001006 Ga0501223_001006_3326_3940 188
429 3300049663 Ga0501223_011271 Ga0501223_011271_591_1172 188
430 3300049663 Ga0501223_062350 Ga0501223_062350_37_621 188
431 3300049664 Ga0501224_023425 Ga0501224_023425_287_871 188
432 3300049665 Ga0501227_036874 Ga0501227_036874_403_1017 188
433 3300049668 Ga0501233_005667 Ga0501233_005667_1338_1952 188
434 3300049669 Ga0501235_008871 Ga0501235_008871_947_1561 188
435 3300049669 Ga0501235_009105 Ga0501235_009105_1113_1694 188
436 3300049669 Ga0501235_099344 Ga0501235_099344_30_614 188
437 3300049674 Ga0501242_003418 Ga0501242_003418_929_1543 188
438 3300049675 Ga0501243_000818 Ga0501243_000818_2872_3486 188
439 3300049680 Ga0501250_013190 Ga0501250_013190_153_737 188
440 3300049683 Ga0501253_046499 Ga0501253_046499_88_669 188
441 3300049690 Ga0501261_001267 Ga0501261_001267_1155_1769 188
442 3300049704 Ga0501221_000013 Ga0501221_000013_13568_14182 188
443 3300049704 Ga0501221_040815 Ga0501221_040815_216_797 188
444 3300049705 Ga0501225_0001754 Ga0501225_0001754_712_1293 188
445 3300049705 Ga0501225_0003389 Ga0501225_0003389_369_983 188
446 3300049760 Ga0501263_008395 Ga0501263_008395_538_1119 188
447 3300049770 Ga0501273_011393 Ga0501273_011393_256_837 188
448 3300049851 Ga0501212_000331 Ga0501212_000331_52_666 188

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

7

175

0.98

PF00117

GATase

Glutamine amidotransferase class-I

17

178

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vrn-assembly1.cif.gz_B the structure of the stress response protein dr1199 from deinococcus radiodurans: a member of the dj-1 superfamily 0.981 4 181
6f2f-assembly1.cif.gz_A crystal structure of protease 1 from pyrococcus horikoshii co-cystallized in presence of 10 mm tb-xo4 and ammonium sulfate. 0.975 8 174
6q3t-assembly1.cif.gz_A structure of protease1 from pyrococcus horikoshii at room temperature in chipx microfluidic device 0.9747 8 174
3l18-assembly1.cif.gz_B ton1285, an intracellular protease from thermococcus onnurineus na1 0.9725 6 175
7r66-assembly1.cif.gz_A structure of pfp1 protease from thermococcus thioreducens: large unit cell at 1.44 a resolution 0.966 8 175
ID Description Score Start End Superfamily
6f2fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.975 8 174 3.40.50.880
2vrnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9737 4 181 3.40.50.880
1oi4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9583 7 175 3.40.50.880
4y1eA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9518 6 175 3.40.50.880
6f2fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9462 8 174 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A3R8PL51-F1-model_v4 deleted 0.9998 60 182
AF-A0A4Q1D4P3-F1-model_v4 Type 1 glutamine amidotransferase 0.9975 1 182 GO:0016740
AF-A0A7V9QL38-F1-model_v4 DJ-1/PfpI family protein 0.9967 88 182
AF-A0A133ZEE5-F1-model_v4 Intracellular protease 1 domain protein 0.9957 79 181 GO:0006508
GO:0008233
AF-A0A3N1PQS0-F1-model_v4 Protease I 0.9921 2 185 GO:0006508
GO:0008233

Feature Viewer

pLDDT pTM Quality
93.26 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map