F446108

General Info

Members Datasets Scaffolds Average Seq Length
448 271 896 166

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100342116|Ga0070713_1003421162
Length 193
Sequence MSKDPAPPAGPAVGGKSEDLAGQSRVLRIEPLQPTDWPAVAAIYGEGIATGNATFETGLPSWEHWDQSHLSEHRLVARTGCGHRDGDVLAWAALAPVSDRCVYAGVAENSIYVAERARGRGVGRWLLGELVGRAEQAGIWTLQTGIFPENTASLALHRCCGFRVVGVRERIGQLDGRWRDVLLLERRSTLAGR

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
157 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
158 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
174 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
189 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
190 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
191 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
194 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
195 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
198 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
199 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
204 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
205 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
243 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
244 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
245 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
246 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
247 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
248 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
252 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
253 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
254 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
255 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
256 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
267 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
268 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
271 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.24
Nodule 0
Rhizoplane 11.16
Rhizosphere 83.26
Stem 0
Stem Tuber 0
Unclassified 8.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100342116 3300005436 Bacteria 1386
2 Ga0070676_10070314 3300005328 Bacteria 2099
3 Ga0070690_100001773 3300005330 Bacteria 11405
4 Ga0070690_100929888 3300005330 Bacteria 682
5 Ga0070670_100066363 3300005331 Bacteria 3096
6 Ga0070670_100190527 3300005331 Unclassified 1781
7 Ga0070677_10174657 3300005333 Bacteria 1018
8 Ga0068869_100089326 3300005334 Bacteria 2314
9 Ga0070666_10002142 3300005335 Bacteria 12003
10 Ga0070680_100116064 3300005336 Bacteria 2231
11 Ga0070682_100006996 3300005337 Bacteria 6345
12 Ga0068868_100009919 3300005338 Bacteria 6879
13 Ga0068868_100415045 3300005338 Unclassified 1164
14 Ga0070660_100024507 3300005339 Bacteria 4476
15 Ga0070687_100145024 3300005343 Bacteria 1387
16 Ga0070692_10564545 3300005345 Bacteria 748
17 Ga0070668_100086754 3300005347 Bacteria 2461
18 Ga0070669_100097849 3300005353 Unclassified 2209
19 Ga0070675_100171649 3300005354 Unclassified 1870
20 Ga0070674_100037448 3300005356 Bacteria 3262
21 Ga0070674_100053169 3300005356 Bacteria 2795
22 Ga0070673_100472842 3300005364 Bacteria 1130
23 Ga0070688_100046603 3300005365 Bacteria 2685
24 Ga0070688_100079685 3300005365 Bacteria 2117
25 Ga0070659_100057329 3300005366 Bacteria 3071
26 Ga0070667_100003624 3300005367 Bacteria 13143
27 Ga0070667_100471429 3300005367 Bacteria 1149
28 Ga0070667_100493469 3300005367 Bacteria 1122
29 Ga0070709_10478812 3300005434 Bacteria 942
30 Ga0070709_10498624 3300005434 Bacteria 924
31 Ga0070714_100162579 3300005435 Bacteria 2021
32 Ga0070710_10511347 3300005437 Bacteria 824
33 Ga0070711_100272731 3300005439 Bacteria 1335
34 Ga0070705_100081628 3300005440 Bacteria 1987
35 Ga0070700_100427436 3300005441 Bacteria 1002
36 Ga0070700_100625996 3300005441 Unclassified 846
37 Ga0070708_100314647 3300005445 Bacteria 1475
38 Ga0070663_100006548 3300005455 Bacteria 7018
39 Ga0070678_100539728 3300005456 Bacteria 1034
40 Ga0070662_100018944 3300005457 Bacteria 4664
41 Ga0070681_10300157 3300005458 Bacteria 1516
42 Ga0068867_100027649 3300005459 Bacteria 4079
43 Ga0068867_100183128 3300005459 Bacteria 1666
44 Ga0070685_10478915 3300005466 Bacteria 877
45 Ga0070706_100030398 3300005467 Bacteria 4976
46 Ga0070707_100000332 3300005468 Bacteria 46360
47 Ga0070707_100216437 3300005468 Bacteria 1866
48 Ga0070707_100318675 3300005468 Bacteria 1511
49 Ga0070698_100007739 3300005471 Bacteria 11626
50 Ga0070698_100035201 3300005471 Bacteria 5179
51 Ga0070699_100087822 3300005518 Bacteria 2715
52 Ga0070699_100399465 3300005518 Bacteria 1242
53 Ga0070699_100478675 3300005518 Bacteria 1130
54 Ga0070699_100751132 3300005518 Bacteria 892
55 Ga0070672_100004328 3300005543 Bacteria 9293
56 Ga0070686_100074053 3300005544 Bacteria 2237
57 Ga0070693_100008144 3300005547 Bacteria 5152
58 Ga0070665_100027937 3300005548 Bacteria 5682
59 Ga0070704_100029320 3300005549 Bacteria 3672
60 Ga0070704_101137738 3300005549 Unclassified 710
61 Ga0068855_100086560 3300005563 Bacteria 3623
62 Ga0070664_100000621 3300005564 Bacteria 27119
63 Ga0070664_100102699 3300005564 Bacteria 2488
64 Ga0070664_100532355 3300005564 Bacteria 1085
65 Ga0068857_100747989 3300005577 Unclassified 931
66 Ga0068857_100835663 3300005577 Bacteria 881
67 Ga0068856_100007601 3300005614 Bacteria 10579
68 Ga0068856_100008798 3300005614 Bacteria 9824
69 Ga0070702_100029329 3300005615 Bacteria 2991
70 Ga0070702_100065254 3300005615 Bacteria 2132
71 Ga0068852_100266448 3300005616 Bacteria 1647
72 Ga0068852_100868514 3300005616 Bacteria 918
73 Ga0068859_100003430 3300005617 Bacteria 16121
74 Ga0068859_100054757 3300005617 Bacteria 4013
75 Ga0068859_100436119 3300005617 Unclassified 1406
76 Ga0068864_100384777 3300005618 Bacteria 1330
77 Ga0068864_100396558 3300005618 Bacteria 1311
78 Ga0068864_100806541 3300005618 Unclassified 923
79 Ga0068866_10008311 3300005718 Bacteria 4368
80 Ga0068861_100161275 3300005719 Bacteria 1850
81 Ga0068861_100287850 3300005719 Bacteria 1417
82 Ga0068870_10221567 3300005840 Bacteria 1158
83 Ga0068870_10331243 3300005840 Bacteria 971
84 Ga0068863_100017445 3300005841 Bacteria 6883
85 Ga0068863_100306414 3300005841 Bacteria 1541
86 Ga0068863_100540493 3300005841 Bacteria 1150
87 Ga0068863_101641598 3300005841 Bacteria 652
88 Ga0068858_100016587 3300005842 Bacteria 6918
89 Ga0068858_100367352 3300005842 Bacteria 1379
90 Ga0068860_100076622 3300005843 Bacteria 3181
91 Ga0068860_100173269 3300005843 Unclassified 2085
92 Ga0068860_100977077 3300005843 Unclassified 864
93 Ga0068862_100310846 3300005844 Unclassified 1452
94 Ga0075365_10057570 3300006038 Bacteria 2586
95 Ga0075365_10158690 3300006038 Bacteria 1575
96 Ga0075365_10251944 3300006038 Bacteria 1241
97 Ga0075368_10084106 3300006042 Bacteria 1297
98 Ga0075368_10177403 3300006042 Bacteria 897
99 Ga0075363_100023106 3300006048 Bacteria 3148
100 Ga0075364_10145837 3300006051 Bacteria 1594
101 Ga0070716_100293939 3300006173 Bacteria 1127
102 Ga0070712_100936880 3300006175 Bacteria 748
103 Ga0075367_10076311 3300006178 Bacteria 2022
104 Ga0097621_100003502 3300006237 Bacteria 10838
105 Ga0097621_100139799 3300006237 Bacteria 2068
106 Ga0097621_100372475 3300006237 Bacteria 1274
107 Ga0068871_100043055 3300006358 Bacteria 3626
108 Ga0068871_100092474 3300006358 Bacteria 2522
109 Ga0075428_100008819 3300006844 Bacteria 11192
110 Ga0075428_100865982 3300006844 Bacteria 959
111 Ga0075430_100006823 3300006846 Bacteria 9622
112 Ga0075430_100901889 3300006846 Bacteria 728
113 Ga0075431_100427642 3300006847 Unclassified 1323
114 Ga0075431_101211682 3300006847 Bacteria 717
115 Ga0075433_10057131 3300006852 Unclassified 3410
116 Ga0075433_10317229 3300006852 Bacteria 1379
117 Ga0075434_100002203 3300006871 Bacteria 16985
118 Ga0075434_100004292 3300006871 Bacteria 12805
119 Ga0075434_100055587 3300006871 Bacteria 3933
120 Ga0075429_100000518 3300006880 Bacteria 29269
121 Ga0068865_100109324 3300006881 Bacteria 2037
122 Ga0068865_100264608 3300006881 Bacteria 1363
123 Ga0075436_100017160 3300006914 Bacteria 4954
124 Ga0075436_100377057 3300006914 Bacteria 1025
125 Ga0097620_100003430 3300006931 Bacteria 16121
126 Ga0097620_100054759 3300006931 Bacteria 4013
127 Ga0097620_100436132 3300006931 Unclassified 1406
128 Ga0075435_100000783 3300007076 Bacteria 19758
129 Ga0075435_100033163 3300007076 Bacteria 4081
130 Ga0075435_100346005 3300007076 Bacteria 1274
131 Ga0105245_10009770 3300009098 Bacteria 8360
132 Ga0105245_10158198 3300009098 Bacteria 2148
133 Ga0105245_10641725 3300009098 Unclassified 1091
134 Ga0105245_11274874 3300009098 Bacteria 783
135 Ga0105247_10043592 3300009101 Bacteria 2749
136 Ga0105247_10088430 3300009101 Bacteria 1963
137 Ga0114129_10000440 3300009147 Bacteria 49341
138 Ga0114129_10001932 3300009147 Bacteria 28345
139 Ga0105243_10051333 3300009148 Unclassified 3262
140 Ga0105243_10174626 3300009148 Bacteria 1864
141 Ga0105241_10054774 3300009174 Bacteria 3054
142 Ga0105241_10408205 3300009174 Bacteria 1193
143 Ga0105242_10093329 3300009176 Bacteria 2537
144 Ga0105242_10234742 3300009176 Bacteria 1645
145 Ga0105248_10049390 3300009177 Bacteria 4718
146 Ga0105248_10163265 3300009177 Bacteria 2512
147 Ga0105248_10416849 3300009177 Bacteria 1512
148 Ga0105248_10926065 3300009177 Bacteria 984
149 Ga0105248_12468573 3300009177 Bacteria 592
150 Ga0105237_10114356 3300009545 Bacteria 2691
151 Ga0105237_10644549 3300009545 Bacteria 1066
152 Ga0105237_11162292 3300009545 Bacteria 778
153 Ga0105238_10019520 3300009551 Bacteria 6903
154 Ga0105249_10705617 3300009553 Bacteria 1069
155 Ga0105249_12196290 3300009553 Bacteria 625
156 Ga0105239_10280273 3300010375 Bacteria 1876
157 Ga0105246_10022018 3300011119 Bacteria 4110
158 Ga0105246_10334641 3300011119 Bacteria 1235
159 Ga0157370_10240873 3300013104 Bacteria 1673
160 Ga0157369_10984131 3300013105 Bacteria 864
161 Ga0157374_10043384 3300013296 Bacteria 4155
162 Ga0157378_10019831 3300013297 Bacteria 5911
163 Ga0157378_10026668 3300013297 Bacteria 5093
164 Ga0157378_11095179 3300013297 Bacteria 833
165 Ga0157378_12175971 3300013297 Bacteria 606
166 Ga0163162_10136012 3300013306 Bacteria 2568
167 Ga0163162_10297420 3300013306 Bacteria 1746
168 Ga0157372_10045078 3300013307 Bacteria 4890
169 Ga0157375_10004178 3300013308 Bacteria 12531
170 Ga0157375_10066837 3300013308 Bacteria 3590
171 Ga0157375_10466947 3300013308 Bacteria 1427
172 Ga0163163_10017274 3300014325 Bacteria 6727
173 Ga0163163_10934565 3300014325 Bacteria 931
174 Ga0157377_10032302 3300014745 Bacteria 2850
175 Ga0157377_10146897 3300014745 Bacteria 1454
176 Ga0157379_10000370 3300014968 Bacteria 36162
177 Ga0157376_10010169 3300014969 Bacteria 6869
178 Ga0157376_10033534 3300014969 Bacteria 4134
179 Ga0157376_10365262 3300014969 Bacteria 1385
180 Ga0157376_11015602 3300014969 Unclassified 852
181 Ga0207697_10106468 3300025315 Bacteria 1198
182 Ga0207682_10068860 3300025893 Bacteria 1496
183 Ga0207642_10276440 3300025899 Bacteria 964
184 Ga0207710_10070049 3300025900 Bacteria 1606
185 Ga0207688_10007286 3300025901 Bacteria 6019
186 Ga0207688_10200568 3300025901 Bacteria 1196
187 Ga0207680_10013079 3300025903 Bacteria 4249
188 Ga0207647_10172519 3300025904 Unclassified 1259
189 Ga0207699_10738444 3300025906 Bacteria 722
190 Ga0207645_10018624 3300025907 Bacteria 4562
191 Ga0207643_10008329 3300025908 Bacteria 5564
192 Ga0207684_10007138 3300025910 Bacteria 10096
193 Ga0207684_10970717 3300025910 Bacteria 712
194 Ga0207654_10529939 3300025911 Bacteria 835
195 Ga0207707_10376931 3300025912 Bacteria 1220
196 Ga0207671_10519064 3300025914 Bacteria 950
197 Ga0207671_11058305 3300025914 Bacteria 638
198 Ga0207657_10017661 3300025919 Bacteria 6836
199 Ga0207646_10000095 3300025922 Bacteria 117382
200 Ga0207646_10891601 3300025922 Bacteria 789
201 Ga0207681_10073692 3300025923 Unclassified 2389
202 Ga0207694_10077897 3300025924 Bacteria 2598
203 Ga0207650_10274825 3300025925 Unclassified 1370
204 Ga0207650_10496563 3300025925 Unclassified 1019
205 Ga0207659_10188340 3300025926 Bacteria 1640
206 Ga0207687_10006136 3300025927 Bacteria 7952
207 Ga0207687_10470040 3300025927 Bacteria 1045
208 Ga0207687_10494360 3300025927 Unclassified 1020
209 Ga0207700_10291715 3300025928 Bacteria 1406
210 Ga0207690_10028466 3300025932 Bacteria 3542
211 Ga0207690_10653839 3300025932 Unclassified 861
212 Ga0207706_10015264 3300025933 Bacteria 6947
213 Ga0207706_10744928 3300025933 Bacteria 835
214 Ga0207686_10022369 3300025934 Bacteria 3641
215 Ga0207686_10096303 3300025934 Bacteria 1966
216 Ga0207686_10614492 3300025934 Bacteria 857
217 Ga0207709_10123367 3300025935 Bacteria 1753
218 Ga0207669_10018115 3300025937 Bacteria 3631
219 Ga0207704_10061286 3300025938 Bacteria 2333
220 Ga0207704_10212207 3300025938 Bacteria 1426
221 Ga0207665_10024992 3300025939 Bacteria 3938
222 Ga0207691_10002400 3300025940 Bacteria 18334
223 Ga0207691_10006267 3300025940 Bacteria 11483
224 Ga0207711_10000328 3300025941 Bacteria 50666
225 Ga0207711_10265880 3300025941 Bacteria 1577
226 Ga0207711_10609971 3300025941 Unclassified 1018
227 Ga0207689_10051417 3300025942 Bacteria 3397
228 Ga0207689_10106668 3300025942 Unclassified 2302
229 Ga0207679_10157112 3300025945 Bacteria 1858
230 Ga0207667_10067416 3300025949 Bacteria 3728
231 Ga0207651_10423527 3300025960 Bacteria 1137
232 Ga0207712_10155570 3300025961 Bacteria 1771
233 Ga0207668_10306470 3300025972 Bacteria 1312
234 Ga0207668_10344853 3300025972 Bacteria 1243
235 Ga0207658_10002902 3300025986 Bacteria 12280
236 Ga0207677_10019928 3300026023 Bacteria 4061
237 Ga0207703_10010625 3300026035 Bacteria 7192
238 Ga0207678_10056216 3300026067 Bacteria 3388
239 Ga0207708_10146895 3300026075 Unclassified 1853
240 Ga0207708_10236901 3300026075 Bacteria 1467
241 Ga0207708_10459238 3300026075 Bacteria 1062
242 Ga0207708_10519164 3300026075 Bacteria 1001
243 Ga0207702_10006781 3300026078 Bacteria 9820
244 Ga0207702_10024844 3300026078 Bacteria 4971
245 Ga0207641_10032129 3300026088 Bacteria 4358
246 Ga0207641_10325791 3300026088 Bacteria 1458
247 Ga0207641_11428867 3300026088 Bacteria 693
248 Ga0207641_11625093 3300026088 Unclassified 648
249 Ga0207648_10006781 3300026089 Bacteria 11355
250 Ga0207648_10008484 3300026089 Bacteria 9943
251 Ga0207648_10009475 3300026089 Bacteria 9323
252 Ga0207676_10020487 3300026095 Bacteria 4840
253 Ga0207676_10329371 3300026095 Bacteria 1405
254 Ga0207674_10137124 3300026116 Bacteria 2408
255 Ga0207683_10008671 3300026121 Bacteria 8693
256 Ga0207683_10889572 3300026121 Bacteria 827
257 Ga0207698_10125812 3300026142 Bacteria 2179
258 Ga0209813_10086673 3300027866 Bacteria 1044
259 Ga0268266_10916803 3300028379 Bacteria 847
260 Ga0268265_10097220 3300028380 Bacteria 2368
261 Ga0268264_10007217 3300028381 Bacteria 9306
262 Ga0268264_10062841 3300028381 Bacteria 3119
263 Ga0268264_11166892 3300028381 Unclassified 779
264 Ga0265319_1005876 3300028563 Bacteria 5782
265 Ga0265338_10004161 3300028800 Bacteria 19766
266 Ga0265320_10001434 3300031240 Bacteria 17350
267 Ga0265331_10003536 3300031250 Bacteria 10028
268 Ga0265327_10001411 3300031251 Bacteria 30623
269 Ga0307405_10771742 3300031731 Bacteria 803
270 Ga0307406_10129473 3300031901 Bacteria 1769
271 Ga0307412_10166981 3300031911 Bacteria 1642
272 Ga0307416_100047267 3300032002 Bacteria 3405
273 Ga0307415_100231254 3300032126 Bacteria 1489
274 Ga0373960_0104489 3300035121 Bacteria 922
275 Ga0373933_0389289 3300035724 Bacteria 908
276 Ga0373937_0050195 3300036401 Bacteria 3821
277 Ga0395900_0012486 3300037418 Bacteria 8686
278 Ga0395898_0010320 3300037466 Bacteria 9771
279 Ga0395905_0798891 3300037471 Bacteria 846
280 Ga0395901_0238090 3300038443 Bacteria 1899
281 Ga0395901_1760759 3300038443 Bacteria 569
282 Ga0400489_75970 3300039093 Bacteria 60900
283 Ga0400489_85121 3300039093 Bacteria 3795
284 Ga0436365_0772313 3300039437 Bacteria 1128
285 Ga0436363_1687670 3300039450 Bacteria 761
286 Ga0451845_0030699 3300041501 Bacteria 746
287 Ga0466966_0034871 3300044684 Bacteria 3253
288 Ga0466961_0101179 3300044693 Bacteria 1815
289 Ga0466963_0155033 3300044694 Bacteria 1592
290 Ga0453684_0921162 3300044712 Unclassified 935
291 Ga0451576_0304568 3300045051 Bacteria 1667
292 Ga0466958_0199055 3300045836 Bacteria 1275
293 Ga0495590_0040238 3300046457 Bacteria 1631
294 Ga0495629_0330020 3300046459 Bacteria 1042
295 Ga0495629_0532145 3300046459 Bacteria 790
296 Ga0495641_0137893 3300046461 Bacteria 1089
297 Ga0495651_0051939 3300046462 Bacteria 3159
298 Ga0495653_0016250 3300046463 Bacteria 6064
299 Ga0495580_0046911 3300046472 Bacteria 3064
300 Ga0495664_0503643 3300046477 Bacteria 723
301 Ga0495607_0079712 3300046501 Bacteria 1803
302 Ga0495606_0000036 3300046507 Bacteria 234596
303 Ga0495608_0006238 3300046511 Bacteria 8463
304 Ga0495620_0091913 3300046515 Bacteria 1217
305 Ga0495628_0188387 3300046516 Bacteria 1558
306 Ga0495640_0018959 3300046533 Bacteria 5089
307 Ga0495609_0178427 3300046538 Bacteria 895
308 Ga0495621_0218638 3300046539 Bacteria 771
309 Ga0495645_0286126 3300046543 Bacteria 1082
310 Ga0495633_0217171 3300046558 Bacteria 876
311 Ga0495667_0115779 3300046559 Bacteria 1732
312 Ga0495668_0203190 3300046616 Bacteria 1085
313 Ga0495635_0088789 3300046663 Bacteria 2115
314 Ga0495659_0096412 3300046664 Bacteria 1141
315 Ga0495657_0022867 3300046675 Bacteria 4473
316 Ga0495624_0393755 3300046690 Bacteria 832
317 Ga0495671_0059163 3300046692 Bacteria 1895
318 Ga0495589_0061407 3300046794 Bacteria 1845
319 Ga0495600_0237909 3300046809 Bacteria 1161
320 Ga0495604_0108566 3300047317 Bacteria 2027
321 Ga0495674_0009375 3300047319 Bacteria 9306
322 Ga0495680_0005451 3300047322 Bacteria 11972
323 Ga0495684_0104011 3300047471 Bacteria 2146
324 Ga0495602_0895449 3300048088 Unclassified 591
325 Ga0496100_0012318 3300048903 Bacteria 4898
326 Ga0496100_0326098 3300048903 Bacteria 1154
327 Ga0496100_0670386 3300048903 Bacteria 808
328 Ga0496100_0705871 3300048903 Bacteria 787
329 Ga0496101_0000608 3300048904 Bacteria 21856
330 Ga0496101_0001601 3300048904 Bacteria 13610
331 Ga0496101_0039305 3300048904 Bacteria 3364
332 Ga0496101_0073147 3300048904 Bacteria 2517
333 Ga0496101_0453526 3300048904 Unclassified 1012
334 Ga0496102_0003601 3300048905 Bacteria 13118
335 Ga0496102_0023595 3300048905 Bacteria 5465
336 Ga0496102_0087377 3300048905 Bacteria 2880
337 Ga0496103_0072779 3300048906 Bacteria 2153
338 Ga0496104_0162039 3300048907 Bacteria 2145
339 Ga0496104_1088970 3300048907 Bacteria 703
340 Ga0496105_0039230 3300048908 Bacteria 3903
341 Ga0496105_0325859 3300048908 Bacteria 1230
342 Ga0496105_0337452 3300048908 Bacteria 1206
343 Ga0496106_0000669 3300048909 Bacteria 24543
344 Ga0496106_0003966 3300048909 Bacteria 11057
345 Ga0496106_0015414 3300048909 Bacteria 5656
346 Ga0496106_0168532 3300048909 Bacteria 1735
347 Ga0496107_0000354 3300048910 Bacteria 25040
348 Ga0496107_0012759 3300048910 Bacteria 5872
349 Ga0496107_0032693 3300048910 Bacteria 3718
350 Ga0496107_0244414 3300048910 Bacteria 1335
351 Ga0496108_0023016 3300048911 Bacteria 5126
352 Ga0496108_0086360 3300048911 Bacteria 2664
353 Ga0496109_0048627 3300048912 Bacteria 3858
354 Ga0496109_0054608 3300048912 Bacteria 3644
355 Ga0496109_0240179 3300048912 Bacteria 1705
356 Ga0496109_0265452 3300048912 Bacteria 1617
357 Ga0496110_0014322 3300048913 Bacteria 6580
358 Ga0496110_0117551 3300048913 Bacteria 2394
359 Ga0496110_1484301 3300048913 Bacteria 588
360 Ga0496111_0013852 3300048914 Bacteria 5500
361 Ga0496111_0082131 3300048914 Bacteria 2353
362 Ga0496112_0017257 3300048915 Bacteria 6777
363 Ga0496113_0092271 3300048916 Bacteria 2335
364 Ga0496113_0389718 3300048916 Bacteria 1118
365 Ga0496113_0430661 3300048916 Unclassified 1060
366 Ga0496114_0003964 3300048917 Bacteria 11428
367 Ga0496114_0228742 3300048917 Bacteria 1633
368 Ga0496114_0418058 3300048917 Bacteria 1187
369 Ga0496114_0428152 3300048917 Bacteria 1172
370 Ga0496114_0963948 3300048917 Bacteria 735
371 Ga0496115_0019099 3300048918 Bacteria 5270
372 Ga0496115_0032410 3300048918 Bacteria 4122
373 Ga0496115_0178281 3300048918 Bacteria 1757
374 Ga0496115_0392813 3300048918 Bacteria 1126
375 Ga0501031_0024185 3300049568 Bacteria 3960
376 Ga0501033_0138106 3300049570 Bacteria 1763
377 Ga0501036_0011171 3300049572 Bacteria 7430
378 Ga0501036_0037172 3300049572 Bacteria 4119
379 Ga0501037_0683707 3300049573 Bacteria 684
380 Ga0501038_0005612 3300049574 Bacteria 11643
381 Ga0501039_0059895 3300049575 Bacteria 2948
382 Ga0501039_0134889 3300049575 Bacteria 1938
383 Ga0501039_0752265 3300049575 Bacteria 761
384 Ga0501040_0001937 3300049576 Bacteria 13308
385 Ga0501040_1073360 3300049576 Bacteria 584
386 Ga0501041_0003505 3300049577 Bacteria 9031
387 Ga0501041_0017844 3300049577 Bacteria 4223
388 Ga0501041_0465866 3300049577 Bacteria 803
389 Ga0501042_0027909 3300049578 Bacteria 3972
390 Ga0501042_0068609 3300049578 Bacteria 2535
391 Ga0501043_0225119 3300049579 Bacteria 1450
392 Ga0501043_0250071 3300049579 Bacteria 1366
393 Ga0501048_0016989 3300049582 Bacteria 5363
394 Ga0501048_0090662 3300049582 Unclassified 2156
395 Ga0501071_0000876 3300049587 Bacteria 16259
396 Ga0501071_0036033 3300049587 Bacteria 3527
397 Ga0501072_0008046 3300049588 Bacteria 8002
398 Ga0501072_0078480 3300049588 Bacteria 2614
399 Ga0501074_0001994 3300049590 Bacteria 14060
400 Ga0501074_0077905 3300049590 Bacteria 2379
401 Ga0501075_0098610 3300049591 Bacteria 2218
402 Ga0501075_0141247 3300049591 Bacteria 1835
403 Ga0501076_0098027 3300049592 Bacteria 2361
404 Ga0501076_0122161 3300049592 Bacteria 2109
405 Ga0501077_0012224 3300049593 Bacteria 5376
406 Ga0501077_0106368 3300049593 Bacteria 1778
407 Ga0501079_0082899 3300049741 Bacteria 2480
408 Ga0501081_0003946 3300049743 Bacteria 9505
409 Ga0501081_0005591 3300049743 Bacteria 8119
410 Ga0501083_0573415 3300049744 Bacteria 734
411 Ga0501280_009640 3300049776 Bacteria 1343
412 Ga0501044_0803659 3300049823 Bacteria 820
413 Ga0501045_0004592 3300049824 Bacteria 9533
414 Ga0501045_0011600 3300049824 Bacteria 6190
415 nmdc:mga03683_100059_c1 3300050489 Bacteria 1273
416 nmdc:mga03n38_263868_c1 3300050490 Bacteria 914
417 nmdc:mga03n38_77858_c1 3300050490 Bacteria 1551
418 nmdc:mga00v17_233240_c1 3300050491 Bacteria 1193
419 nmdc:mga0yw44_124226_c1 3300050492 Bacteria 1665
420 nmdc:mga0yw44_147095_c1 3300050492 Bacteria 1535
421 nmdc:mga04h51_152566_c1 3300050495 Bacteria 884
422 nmdc:mga04h51_323980_c1 3300050495 Unclassified 632
423 nmdc:mga04h51_84256_c1 3300050495 Bacteria 799
424 nmdc:mga07m45_466521_c1 3300050496 Bacteria 732
425 nmdc:mga05p37_1085_c1 3300050507 Bacteria 31262
426 nmdc:mga05p37_2109_c1 3300050507 Bacteria 23230
427 nmdc:mga09592_1_c1 3300050508 Bacteria 201102
428 nmdc:mga0qj67_12_c3 3300050509 Bacteria 26384
429 nmdc:mga0qj67_835393_c1 3300050509 Bacteria 728
430 nmdc:mga06r32_7_c1 3300050510 Bacteria 117700
431 nmdc:mga08y16_1752249_c1 3300050511 Bacteria 575
432 nmdc:mga0n895_2376_c1 3300050512 Bacteria 14673
433 nmdc:mga0n895_276247_c1 3300050512 Bacteria 1704
434 nmdc:mga0n895_29154_c1 3300050512 Bacteria 5260
435 nmdc:mga0rr50_9706_c1 3300050513 Bacteria 6070
436 nmdc:mga08x19_109276_c1 3300050514 Bacteria 1843
437 nmdc:mga08x19_348246_c1 3300050514 Bacteria 1034
438 nmdc:mga0a205_293415_c1 3300050515 Bacteria 1500
439 nmdc:mga0a205_6453_c1 3300050515 Bacteria 10607
440 Ga0495601_0562831 3300053077 Unclassified 733
441 Ga0495619_0084622 3300053085 Bacteria 2141
442 Ga0501084_0006542 3300054114 Bacteria 9577
443 Ga0501084_0019434 3300054114 Bacteria 5660
444 Ga0501084_0537313 3300054114 Bacteria 988
445 Ga0501084_0549350 3300054114 Bacteria 976
446 Ga0501082_0031215 3300060353 Bacteria 4593
447 Ga0530510_0716893 3300061734 Bacteria 762
448 3006829204 3006826541 Bacteria 4678913
449 Ga0070713_100342116
450 Ga0070676_10070314
451 Ga0070690_100001773
452 Ga0070690_100929888
453 Ga0070670_100066363
454 Ga0070670_100190527
455 Ga0070677_10174657
456 Ga0068869_100089326
457 Ga0070666_10002142
458 Ga0070680_100116064
459 Ga0070682_100006996
460 Ga0068868_100009919
461 Ga0068868_100415045
462 Ga0070660_100024507
463 Ga0070687_100145024
464 Ga0070692_10564545
465 Ga0070668_100086754
466 Ga0070669_100097849
467 Ga0070675_100171649
468 Ga0070674_100037448
469 Ga0070674_100053169
470 Ga0070673_100472842
471 Ga0070688_100046603
472 Ga0070688_100079685
473 Ga0070659_100057329
474 Ga0070667_100003624
475 Ga0070667_100471429
476 Ga0070667_100493469
477 Ga0070709_10478812
478 Ga0070709_10498624
479 Ga0070714_100162579
480 Ga0070710_10511347
481 Ga0070711_100272731
482 Ga0070705_100081628
483 Ga0070700_100427436
484 Ga0070700_100625996
485 Ga0070708_100314647
486 Ga0070663_100006548
487 Ga0070678_100539728
488 Ga0070662_100018944
489 Ga0070681_10300157
490 Ga0068867_100027649
491 Ga0068867_100183128
492 Ga0070685_10478915
493 Ga0070706_100030398
494 Ga0070707_100000332
495 Ga0070707_100216437
496 Ga0070707_100318675
497 Ga0070698_100007739
498 Ga0070698_100035201
499 Ga0070699_100087822
500 Ga0070699_100399465
501 Ga0070699_100478675
502 Ga0070699_100751132
503 Ga0070672_100004328
504 Ga0070686_100074053
505 Ga0070693_100008144
506 Ga0070665_100027937
507 Ga0070704_100029320
508 Ga0070704_101137738
509 Ga0068855_100086560
510 Ga0070664_100000621
511 Ga0070664_100102699
512 Ga0070664_100532355
513 Ga0068857_100747989
514 Ga0068857_100835663
515 Ga0068856_100007601
516 Ga0068856_100008798
517 Ga0070702_100029329
518 Ga0070702_100065254
519 Ga0068852_100266448
520 Ga0068852_100868514
521 Ga0068859_100003430
522 Ga0068859_100054757
523 Ga0068859_100436119
524 Ga0068864_100384777
525 Ga0068864_100396558
526 Ga0068864_100806541
527 Ga0068866_10008311
528 Ga0068861_100161275
529 Ga0068861_100287850
530 Ga0068870_10221567
531 Ga0068870_10331243
532 Ga0068863_100017445
533 Ga0068863_100306414
534 Ga0068863_100540493
535 Ga0068863_101641598
536 Ga0068858_100016587
537 Ga0068858_100367352
538 Ga0068860_100076622
539 Ga0068860_100173269
540 Ga0068860_100977077
541 Ga0068862_100310846
542 Ga0075365_10057570
543 Ga0075365_10158690
544 Ga0075365_10251944
545 Ga0075368_10084106
546 Ga0075368_10177403
547 Ga0075363_100023106
548 Ga0075364_10145837
549 Ga0070716_100293939
550 Ga0070712_100936880
551 Ga0075367_10076311
552 Ga0097621_100003502
553 Ga0097621_100139799
554 Ga0097621_100372475
555 Ga0068871_100043055
556 Ga0068871_100092474
557 Ga0075428_100008819
558 Ga0075428_100865982
559 Ga0075430_100006823
560 Ga0075430_100901889
561 Ga0075431_100427642
562 Ga0075431_101211682
563 Ga0075433_10057131
564 Ga0075433_10317229
565 Ga0075434_100002203
566 Ga0075434_100004292
567 Ga0075434_100055587
568 Ga0075429_100000518
569 Ga0068865_100109324
570 Ga0068865_100264608
571 Ga0075436_100017160
572 Ga0075436_100377057
573 Ga0097620_100003430
574 Ga0097620_100054759
575 Ga0097620_100436132
576 Ga0075435_100000783
577 Ga0075435_100033163
578 Ga0075435_100346005
579 Ga0105245_10009770
580 Ga0105245_10158198
581 Ga0105245_10641725
582 Ga0105245_11274874
583 Ga0105247_10043592
584 Ga0105247_10088430
585 Ga0114129_10000440
586 Ga0114129_10001932
587 Ga0105243_10051333
588 Ga0105243_10174626
589 Ga0105241_10054774
590 Ga0105241_10408205
591 Ga0105242_10093329
592 Ga0105242_10234742
593 Ga0105248_10049390
594 Ga0105248_10163265
595 Ga0105248_10416849
596 Ga0105248_10926065
597 Ga0105248_12468573
598 Ga0105237_10114356
599 Ga0105237_10644549
600 Ga0105237_11162292
601 Ga0105238_10019520
602 Ga0105249_10705617
603 Ga0105249_12196290
604 Ga0105239_10280273
605 Ga0105246_10022018
606 Ga0105246_10334641
607 Ga0157370_10240873
608 Ga0157369_10984131
609 Ga0157374_10043384
610 Ga0157378_10019831
611 Ga0157378_10026668
612 Ga0157378_11095179
613 Ga0157378_12175971
614 Ga0163162_10136012
615 Ga0163162_10297420
616 Ga0157372_10045078
617 Ga0157375_10004178
618 Ga0157375_10066837
619 Ga0157375_10466947
620 Ga0163163_10017274
621 Ga0163163_10934565
622 Ga0157377_10032302
623 Ga0157377_10146897
624 Ga0157379_10000370
625 Ga0157376_10010169
626 Ga0157376_10033534
627 Ga0157376_10365262
628 Ga0157376_11015602
629 Ga0207697_10106468
630 Ga0207682_10068860
631 Ga0207642_10276440
632 Ga0207710_10070049
633 Ga0207688_10007286
634 Ga0207688_10200568
635 Ga0207680_10013079
636 Ga0207647_10172519
637 Ga0207699_10738444
638 Ga0207645_10018624
639 Ga0207643_10008329
640 Ga0207684_10007138
641 Ga0207684_10970717
642 Ga0207654_10529939
643 Ga0207707_10376931
644 Ga0207671_10519064
645 Ga0207671_11058305
646 Ga0207657_10017661
647 Ga0207646_10000095
648 Ga0207646_10891601
649 Ga0207681_10073692
650 Ga0207694_10077897
651 Ga0207650_10274825
652 Ga0207650_10496563
653 Ga0207659_10188340
654 Ga0207687_10006136
655 Ga0207687_10470040
656 Ga0207687_10494360
657 Ga0207700_10291715
658 Ga0207690_10028466
659 Ga0207690_10653839
660 Ga0207706_10015264
661 Ga0207706_10744928
662 Ga0207686_10022369
663 Ga0207686_10096303
664 Ga0207686_10614492
665 Ga0207709_10123367
666 Ga0207669_10018115
667 Ga0207704_10061286
668 Ga0207704_10212207
669 Ga0207665_10024992
670 Ga0207691_10002400
671 Ga0207691_10006267
672 Ga0207711_10000328
673 Ga0207711_10265880
674 Ga0207711_10609971
675 Ga0207689_10051417
676 Ga0207689_10106668
677 Ga0207679_10157112
678 Ga0207667_10067416
679 Ga0207651_10423527
680 Ga0207712_10155570
681 Ga0207668_10306470
682 Ga0207668_10344853
683 Ga0207658_10002902
684 Ga0207677_10019928
685 Ga0207703_10010625
686 Ga0207678_10056216
687 Ga0207708_10146895
688 Ga0207708_10236901
689 Ga0207708_10459238
690 Ga0207708_10519164
691 Ga0207702_10006781
692 Ga0207702_10024844
693 Ga0207641_10032129
694 Ga0207641_10325791
695 Ga0207641_11428867
696 Ga0207641_11625093
697 Ga0207648_10006781
698 Ga0207648_10008484
699 Ga0207648_10009475
700 Ga0207676_10020487
701 Ga0207676_10329371
702 Ga0207674_10137124
703 Ga0207683_10008671
704 Ga0207683_10889572
705 Ga0207698_10125812
706 Ga0209813_10086673
707 Ga0268266_10916803
708 Ga0268265_10097220
709 Ga0268264_10007217
710 Ga0268264_10062841
711 Ga0268264_11166892
712 Ga0265319_1005876
713 Ga0265338_10004161
714 Ga0265320_10001434
715 Ga0265331_10003536
716 Ga0265327_10001411
717 Ga0307405_10771742
718 Ga0307406_10129473
719 Ga0307412_10166981
720 Ga0307416_100047267
721 Ga0307415_100231254
722 Ga0373960_0104489
723 Ga0373933_0389289
724 Ga0373937_0050195
725 Ga0395900_0012486
726 Ga0395898_0010320
727 Ga0395905_0798891
728 Ga0395901_0238090
729 Ga0395901_1760759
730 Ga0400489_75970
731 Ga0400489_85121
732 Ga0436365_0772313
733 Ga0436363_1687670
734 Ga0451845_0030699
735 Ga0466966_0034871
736 Ga0466961_0101179
737 Ga0466963_0155033
738 Ga0453684_0921162
739 Ga0451576_0304568
740 Ga0466958_0199055
741 Ga0495590_0040238
742 Ga0495629_0330020
743 Ga0495629_0532145
744 Ga0495641_0137893
745 Ga0495651_0051939
746 Ga0495653_0016250
747 Ga0495580_0046911
748 Ga0495664_0503643
749 Ga0495607_0079712
750 Ga0495606_0000036
751 Ga0495608_0006238
752 Ga0495620_0091913
753 Ga0495628_0188387
754 Ga0495640_0018959
755 Ga0495609_0178427
756 Ga0495621_0218638
757 Ga0495645_0286126
758 Ga0495633_0217171
759 Ga0495667_0115779
760 Ga0495668_0203190
761 Ga0495635_0088789
762 Ga0495659_0096412
763 Ga0495657_0022867
764 Ga0495624_0393755
765 Ga0495671_0059163
766 Ga0495589_0061407
767 Ga0495600_0237909
768 Ga0495604_0108566
769 Ga0495674_0009375
770 Ga0495680_0005451
771 Ga0495684_0104011
772 Ga0495602_0895449
773 Ga0496100_0012318
774 Ga0496100_0326098
775 Ga0496100_0670386
776 Ga0496100_0705871
777 Ga0496101_0000608
778 Ga0496101_0001601
779 Ga0496101_0039305
780 Ga0496101_0073147
781 Ga0496101_0453526
782 Ga0496102_0003601
783 Ga0496102_0023595
784 Ga0496102_0087377
785 Ga0496103_0072779
786 Ga0496104_0162039
787 Ga0496104_1088970
788 Ga0496105_0039230
789 Ga0496105_0325859
790 Ga0496105_0337452
791 Ga0496106_0000669
792 Ga0496106_0003966
793 Ga0496106_0015414
794 Ga0496106_0168532
795 Ga0496107_0000354
796 Ga0496107_0012759
797 Ga0496107_0032693
798 Ga0496107_0244414
799 Ga0496108_0023016
800 Ga0496108_0086360
801 Ga0496109_0048627
802 Ga0496109_0054608
803 Ga0496109_0240179
804 Ga0496109_0265452
805 Ga0496110_0014322
806 Ga0496110_0117551
807 Ga0496110_1484301
808 Ga0496111_0013852
809 Ga0496111_0082131
810 Ga0496112_0017257
811 Ga0496113_0092271
812 Ga0496113_0389718
813 Ga0496113_0430661
814 Ga0496114_0003964
815 Ga0496114_0228742
816 Ga0496114_0418058
817 Ga0496114_0428152
818 Ga0496114_0963948
819 Ga0496115_0019099
820 Ga0496115_0032410
821 Ga0496115_0178281
822 Ga0496115_0392813
823 Ga0501031_0024185
824 Ga0501033_0138106
825 Ga0501036_0011171
826 Ga0501036_0037172
827 Ga0501037_0683707
828 Ga0501038_0005612
829 Ga0501039_0059895
830 Ga0501039_0134889
831 Ga0501039_0752265
832 Ga0501040_0001937
833 Ga0501040_1073360
834 Ga0501041_0003505
835 Ga0501041_0017844
836 Ga0501041_0465866
837 Ga0501042_0027909
838 Ga0501042_0068609
839 Ga0501043_0225119
840 Ga0501043_0250071
841 Ga0501048_0016989
842 Ga0501048_0090662
843 Ga0501071_0000876
844 Ga0501071_0036033
845 Ga0501072_0008046
846 Ga0501072_0078480
847 Ga0501074_0001994
848 Ga0501074_0077905
849 Ga0501075_0098610
850 Ga0501075_0141247
851 Ga0501076_0098027
852 Ga0501076_0122161
853 Ga0501077_0012224
854 Ga0501077_0106368
855 Ga0501079_0082899
856 Ga0501081_0003946
857 Ga0501081_0005591
858 Ga0501083_0573415
859 Ga0501280_009640
860 Ga0501044_0803659
861 Ga0501045_0004592
862 Ga0501045_0011600
863 nmdc:mga03683_100059_c1
864 nmdc:mga03n38_263868_c1
865 nmdc:mga03n38_77858_c1
866 nmdc:mga00v17_233240_c1
867 nmdc:mga0yw44_124226_c1
868 nmdc:mga0yw44_147095_c1
869 nmdc:mga04h51_152566_c1
870 nmdc:mga04h51_323980_c1
871 nmdc:mga04h51_84256_c1
872 nmdc:mga07m45_466521_c1
873 nmdc:mga05p37_1085_c1
874 nmdc:mga05p37_2109_c1
875 nmdc:mga09592_1_c1
876 nmdc:mga0qj67_12_c3
877 nmdc:mga0qj67_835393_c1
878 nmdc:mga06r32_7_c1
879 nmdc:mga08y16_1752249_c1
880 nmdc:mga0n895_2376_c1
881 nmdc:mga0n895_276247_c1
882 nmdc:mga0n895_29154_c1
883 nmdc:mga0rr50_9706_c1
884 nmdc:mga08x19_109276_c1
885 nmdc:mga08x19_348246_c1
886 nmdc:mga0a205_293415_c1
887 nmdc:mga0a205_6453_c1
888 Ga0495601_0562831
889 Ga0495619_0084622
890 Ga0501084_0006542
891 Ga0501084_0019434
892 Ga0501084_0537313
893 Ga0501084_0549350
894 Ga0501082_0031215
895 Ga0530510_0716893
896 3006829204

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13420

Acetyltransf_4

Acetyltransferase (GNAT) domain

73

183

0.9

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

42

162

0.81

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

71

164

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dwn-assembly2.cif.gz_C crystal structure of phosphinothricin n-acetyltransferase from brucella ovis in complex with acetylcoa <structure_details = 0.922 4 162
1yr0-assembly2.cif.gz_D crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens 0.9217 4 160
4j3g-assembly2.cif.gz_C crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis 0.9127 6 160
1yvo-assembly1.cif.gz_A hypothetical acetyltransferase from p.aeruginosa pa01 0.9098 6 160
2j8n-assembly1.cif.gz_A structure of p. aeruginosa acetyltransferase pa4866 solved at room temperature 0.9071 6 160
ID Description Score Start End Superfamily
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.96 113 161 3.40.630.30
5dwmA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9193 4 162 3.40.630.30
af_P9WQG5_1_155_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9097 52 160 3.40.630.30
af_I1MSW7_129_252_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9086 60 139 3.40.630.30
af_A0A1D6QIS1_205_278_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9069 97 160 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A4Z0PW60-F1-model_v4 N-acetyltransferase family protein 0.9946 6 163 GO:0016747
AF-A0A7V9BFU2-F1-model_v4 N-acetyltransferase 0.9939 6 160 GO:0016747
AF-A0A1W1VF75-F1-model_v4 GCN5-related N-acetyltransferase 0.9929 6 163 GO:0016747
AF-H5X2W5-F1-model_v4 Sortase-like acyltransferase 0.9908 5 162 GO:0003700
GO:0016747
AF-A0A7Y1TNT8-F1-model_v4 N-acetyltransferase 0.9908 6 146 GO:0016747

Map