F446106

General Info

Members Datasets Scaffolds Average Seq Length
448 176 896 152

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_101151044|Ga0070714_1011510441
Length 184
Sequence MGSLPPFCFCRSPSDALLSPQVAHAVIARYAAAMESRALTSGEIRLCRSVFGDAIDYSKVRLVKGKWWPFQPANAAMAPNGNIYFHPRAGGWSEDFASEPLFRQGFFIHEMTHVWQAQKGGRLFLPLMRHPFCRYRYRLIPGKPFRRYGLEQQAEIVRDRFLADRGAAVAAPPPADLLPFASRS

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
114 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
115 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
116 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
117 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
118 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
119 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
135 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
136 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
137 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
138 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
139 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
140 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
141 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
142 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
143 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
144 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
145 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
155 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
156 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
157 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
158 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
159 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
172 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.67
Rhizosphere 99.33
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_101151044 3300005435 Bacteria 756
2 JGI24739J22299_10002456 3300001989 Bacteria 7150
3 JGI24737J22298_10002555 3300001990 Bacteria 6459
4 JGI24735J21928_10100385 3300002067 Bacteria 831
5 Ga0070658_10011936 3300005327 Bacteria 6975
6 Ga0070658_10107531 3300005327 Bacteria 2308
7 Ga0070658_10170734 3300005327 Bacteria 1827
8 Ga0070658_10183984 3300005327 Bacteria 1759
9 Ga0070658_10459499 3300005327 Bacteria 1098
10 Ga0070683_100011856 3300005329 Bacteria 7554
11 Ga0070683_100263561 3300005329 Bacteria 1639
12 Ga0070670_100010495 3300005331 Bacteria 7907
13 Ga0070670_100193307 3300005331 Bacteria 1768
14 Ga0070677_10084386 3300005333 Bacteria 1367
15 Ga0070666_10002936 3300005335 Bacteria 10315
16 Ga0070666_10920293 3300005335 Bacteria 647
17 Ga0070680_100002233 3300005336 Bacteria 14285
18 Ga0070680_100079437 3300005336 Bacteria 2704
19 Ga0070680_100092492 3300005336 Bacteria 2504
20 Ga0070680_100138926 3300005336 Bacteria 2037
21 Ga0070680_100215192 3300005336 Bacteria 1621
22 Ga0070660_100059190 3300005339 Bacteria 2971
23 Ga0070660_100187295 3300005339 Bacteria 1676
24 Ga0070660_100208003 3300005339 Bacteria 1588
25 Ga0070660_100222411 3300005339 Bacteria 1534
26 Ga0070660_100350441 3300005339 Bacteria 1216
27 Ga0070660_100628764 3300005339 Bacteria 899
28 Ga0070660_101048529 3300005339 Bacteria 689
29 Ga0070661_100000100 3300005344 Bacteria 70585
30 Ga0070661_100483852 3300005344 Bacteria 989
31 Ga0070661_100735912 3300005344 Bacteria 806
32 Ga0070661_101250192 3300005344 Bacteria 622
33 Ga0070692_10003945 3300005345 Bacteria 6121
34 Ga0070675_100223777 3300005354 Bacteria 1639
35 Ga0070671_100050376 3300005355 Bacteria 3463
36 Ga0070674_100010504 3300005356 Bacteria 5601
37 Ga0070673_100005946 3300005364 Bacteria 7887
38 Ga0070673_100049225 3300005364 Bacteria 3290
39 Ga0070673_100355600 3300005364 Bacteria 1301
40 Ga0070659_100001228 3300005366 Bacteria 18614
41 Ga0070659_100006278 3300005366 Bacteria 8590
42 Ga0070659_100024202 3300005366 Bacteria 4653
43 Ga0070659_100031820 3300005366 Bacteria 4088
44 Ga0070659_100035715 3300005366 Bacteria 3871
45 Ga0070659_100324005 3300005366 Bacteria 1288
46 Ga0070659_100559367 3300005366 Bacteria 980
47 Ga0070659_101180364 3300005366 Bacteria 676
48 Ga0070667_100018571 3300005367 Bacteria 5768
49 Ga0070667_100152857 3300005367 Bacteria 2028
50 Ga0070667_100349959 3300005367 Bacteria 1337
51 Ga0070714_100059380 3300005435 Bacteria 3279
52 Ga0070714_100196381 3300005435 Bacteria 1844
53 Ga0070701_10840744 3300005438 Bacteria 629
54 Ga0070701_10857725 3300005438 Bacteria 624
55 Ga0070694_100042064 3300005444 Bacteria 3050
56 Ga0070663_100229625 3300005455 Bacteria 1461
57 Ga0070663_100320805 3300005455 Bacteria 1246
58 Ga0070662_100004489 3300005457 Bacteria 8839
59 Ga0070662_100019551 3300005457 Bacteria 4599
60 Ga0070662_100209828 3300005457 Bacteria 1549
61 Ga0070662_100406113 3300005457 Bacteria 1125
62 Ga0070662_100449024 3300005457 Bacteria 1070
63 Ga0070681_10126995 3300005458 Bacteria 2483
64 Ga0070681_10254922 3300005458 Bacteria 1667
65 Ga0070681_11380220 3300005458 Bacteria 628
66 Ga0068867_100362640 3300005459 Bacteria 1212
67 Ga0070679_100151354 3300005530 Bacteria 2296
68 Ga0070679_100286000 3300005530 Bacteria 1601
69 Ga0070679_100424155 3300005530 Bacteria 1275
70 Ga0070679_101314940 3300005530 Bacteria 669
71 Ga0070684_100009749 3300005535 Bacteria 7581
72 Ga0068853_100152907 3300005539 Bacteria 2078
73 Ga0068853_100693850 3300005539 Bacteria 971
74 Ga0070672_100066782 3300005543 Bacteria 2848
75 Ga0070672_100240067 3300005543 Bacteria 1524
76 Ga0070672_100555201 3300005543 Bacteria 997
77 Ga0070686_100077972 3300005544 Bacteria 2186
78 Ga0070695_100092734 3300005545 Bacteria 2020
79 Ga0070696_100161831 3300005546 Bacteria 1649
80 Ga0070665_100004206 3300005548 Bacteria 15147
81 Ga0070665_100157765 3300005548 Bacteria 2271
82 Ga0070665_101339268 3300005548 Bacteria 725
83 Ga0068855_100068622 3300005563 Bacteria 4127
84 Ga0068855_100212796 3300005563 Bacteria 2171
85 Ga0068855_100333642 3300005563 Bacteria 1674
86 Ga0068855_100345603 3300005563 Bacteria 1639
87 Ga0068855_100369727 3300005563 Bacteria 1576
88 Ga0068855_101397386 3300005563 Bacteria 722
89 Ga0070664_100304936 3300005564 Bacteria 1440
90 Ga0070664_101096699 3300005564 Bacteria 750
91 Ga0068857_100049866 3300005577 Bacteria 3714
92 Ga0068857_100083157 3300005577 Bacteria 2859
93 Ga0068854_100325905 3300005578 Bacteria 1250
94 Ga0068854_100662007 3300005578 Bacteria 898
95 Ga0068856_100057499 3300005614 Bacteria 3839
96 Ga0068856_100317742 3300005614 Bacteria 1575
97 Ga0068856_100447368 3300005614 Bacteria 1313
98 Ga0068856_100630749 3300005614 Bacteria 1092
99 Ga0068856_100772739 3300005614 Bacteria 980
100 Ga0068856_101051634 3300005614 Bacteria 832
101 Ga0068852_100002322 3300005616 Bacteria 13070
102 Ga0068852_100041614 3300005616 Bacteria 3884
103 Ga0068852_100214357 3300005616 Bacteria 1828
104 Ga0068852_100312671 3300005616 Bacteria 1523
105 Ga0068859_100007546 3300005617 Bacteria 11045
106 Ga0068863_100006462 3300005841 Bacteria 11495
107 Ga0068863_100135696 3300005841 Bacteria 2351
108 Ga0068858_100021978 3300005842 Bacteria 5958
109 Ga0068860_100265985 3300005843 Bacteria 1672
110 Ga0068862_100871139 3300005844 Bacteria 884
111 Ga0070712_100009565 3300006175 Bacteria 6111
112 Ga0075434_101055151 3300006871 Bacteria 826
113 Ga0097620_100007546 3300006931 Bacteria 11045
114 Ga0105240_10037873 3300009093 Bacteria 6193
115 Ga0105240_12089873 3300009093 Bacteria 588
116 Ga0111539_10088855 3300009094 Bacteria 3630
117 Ga0105247_10069889 3300009101 Bacteria 2193
118 Ga0105248_10000163 3300009177 Bacteria 77658
119 Ga0105248_10009119 3300009177 Bacteria 10914
120 Ga0105248_10224947 3300009177 Bacteria 2112
121 Ga0105248_10528432 3300009177 Bacteria 1330
122 Ga0105239_11329026 3300010375 Bacteria 829
123 Ga0105239_12003973 3300010375 Bacteria 672
124 Ga0157373_10004400 3300013100 Bacteria 10616
125 Ga0157373_10037250 3300013100 Bacteria 3488
126 Ga0157373_10080929 3300013100 Bacteria 2290
127 Ga0157373_10081263 3300013100 Bacteria 2285
128 Ga0157373_10091414 3300013100 Bacteria 2144
129 Ga0157373_10115294 3300013100 Bacteria 1889
130 Ga0157373_10307846 3300013100 Bacteria 1125
131 Ga0157373_10444700 3300013100 Bacteria 932
132 Ga0157371_10000722 3300013102 Bacteria 38724
133 Ga0157371_10017544 3300013102 Bacteria 5316
134 Ga0157371_10019588 3300013102 Bacteria 4986
135 Ga0157371_10022371 3300013102 Bacteria 4634
136 Ga0157371_10026853 3300013102 Bacteria 4181
137 Ga0157371_10242820 3300013102 Bacteria 1296
138 Ga0157371_10431500 3300013102 Bacteria 967
139 Ga0157371_10696362 3300013102 Bacteria 760
140 Ga0157371_11076186 3300013102 Bacteria 616
141 Ga0157370_10108565 3300013104 Bacteria 2595
142 Ga0157370_10218654 3300013104 Bacteria 1765
143 Ga0157370_10503883 3300013104 Bacteria 1112
144 Ga0157370_10519266 3300013104 Bacteria 1093
145 Ga0157370_10790452 3300013104 Bacteria 864
146 Ga0157370_10990571 3300013104 Bacteria 761
147 Ga0157369_10002370 3300013105 Bacteria 22641
148 Ga0157369_10009078 3300013105 Bacteria 11382
149 Ga0157369_10034859 3300013105 Bacteria 5520
150 Ga0157369_10044937 3300013105 Bacteria 4806
151 Ga0157369_10139994 3300013105 Bacteria 2561
152 Ga0157369_10422135 3300013105 Bacteria 1382
153 Ga0157374_10713288 3300013296 Bacteria 1016
154 Ga0157374_10843765 3300013296 Bacteria 933
155 Ga0157378_10496096 3300013297 Bacteria 1219
156 Ga0163162_10330228 3300013306 Bacteria 1657
157 Ga0157372_10057383 3300013307 Bacteria 4352
158 Ga0157372_10152136 3300013307 Bacteria 2671
159 Ga0157372_10164299 3300013307 Bacteria 2567
160 Ga0157372_10191377 3300013307 Bacteria 2370
161 Ga0157372_10212780 3300013307 Bacteria 2240
162 Ga0157372_11019687 3300013307 Bacteria 958
163 Ga0157372_12093250 3300013307 Bacteria 650
164 Ga0157375_11403158 3300013308 Bacteria 823
165 Ga0163163_10000173 3300014325 Bacteria 67717
166 Ga0157379_10018210 3300014968 Bacteria 6189
167 Ga0206353_11203057 3300020082 Bacteria 1361
168 Ga0207656_10072114 3300025321 Bacteria 1537
169 Ga0207656_10444071 3300025321 Bacteria 655
170 Ga0207710_10038325 3300025900 Bacteria 2119
171 Ga0207680_10007712 3300025903 Bacteria 5261
172 Ga0207647_10000847 3300025904 Bacteria 23725
173 Ga0207647_10020690 3300025904 Bacteria 4408
174 Ga0207647_10139359 3300025904 Bacteria 1422
175 Ga0207705_10224565 3300025909 Bacteria 1427
176 Ga0207707_10055886 3300025912 Bacteria 3434
177 Ga0207695_10149179 3300025913 Bacteria 2279
178 Ga0207693_10049525 3300025915 Bacteria 3299
179 Ga0207660_10003204 3300025917 Bacteria 10704
180 Ga0207660_10004089 3300025917 Bacteria 9501
181 Ga0207660_10009880 3300025917 Bacteria 6181
182 Ga0207657_10030277 3300025919 Bacteria 4913
183 Ga0207657_10222236 3300025919 Bacteria 1513
184 Ga0207657_10499422 3300025919 Bacteria 953
185 Ga0207649_10223823 3300025920 Bacteria 1342
186 Ga0207649_10232115 3300025920 Bacteria 1320
187 Ga0207649_11097533 3300025920 Bacteria 628
188 Ga0207652_10041079 3300025921 Bacteria 3930
189 Ga0207652_10088748 3300025921 Bacteria 2713
190 Ga0207652_10301830 3300025921 Bacteria 1445
191 Ga0207652_10521992 3300025921 Bacteria 1068
192 Ga0207681_10249388 3300025923 Bacteria 1385
193 Ga0207664_10019357 3300025929 Bacteria 5030
194 Ga0207664_10736286 3300025929 Bacteria 887
195 Ga0207644_10481494 3300025931 Bacteria 1022
196 Ga0207644_10851240 3300025931 Bacteria 763
197 Ga0207690_10001344 3300025932 Bacteria 15448
198 Ga0207690_10120170 3300025932 Bacteria 1907
199 Ga0207690_10302643 3300025932 Bacteria 1252
200 Ga0207690_10514337 3300025932 Bacteria 970
201 Ga0207690_10619051 3300025932 Bacteria 885
202 Ga0207706_10005540 3300025933 Bacteria 11774
203 Ga0207706_10062852 3300025933 Bacteria 3269
204 Ga0207706_10169679 3300025933 Bacteria 1917
205 Ga0207706_10209397 3300025933 Bacteria 1709
206 Ga0207706_10590177 3300025933 Bacteria 955
207 Ga0207669_10024273 3300025937 Bacteria 3256
208 Ga0207691_10206199 3300025940 Bacteria 1709
209 Ga0207711_10001440 3300025941 Bacteria 22257
210 Ga0207711_10312875 3300025941 Bacteria 1450
211 Ga0207661_10009585 3300025944 Bacteria 6952
212 Ga0207679_10447129 3300025945 Bacteria 1145
213 Ga0207667_10010120 3300025949 Bacteria 11048
214 Ga0207667_10656259 3300025949 Bacteria 1054
215 Ga0207667_10806536 3300025949 Bacteria 935
216 Ga0207651_10026823 3300025960 Bacteria 3607
217 Ga0207640_10031887 3300025981 Bacteria 3263
218 Ga0207640_10174590 3300025981 Bacteria 1605
219 Ga0207658_10016830 3300025986 Bacteria 5031
220 Ga0207658_10158241 3300025986 Bacteria 1854
221 Ga0207677_10007214 3300026023 Bacteria 6128
222 Ga0207703_10004143 3300026035 Bacteria 11960
223 Ga0207702_10077212 3300026078 Bacteria 2880
224 Ga0207702_10117472 3300026078 Bacteria 2375
225 Ga0207702_10779465 3300026078 Bacteria 945
226 Ga0207702_11225504 3300026078 Bacteria 744
227 Ga0207641_10009836 3300026088 Bacteria 7875
228 Ga0207641_10074813 3300026088 Bacteria 2923
229 Ga0207648_10511114 3300026089 Bacteria 1100
230 Ga0207674_10005849 3300026116 Bacteria 14585
231 Ga0207674_10105832 3300026116 Bacteria 2791
232 Ga0207674_10236928 3300026116 Bacteria 1772
233 Ga0207698_10002083 3300026142 Bacteria 11797
234 Ga0207698_10003489 3300026142 Bacteria 9482
235 Ga0207698_10131585 3300026142 Bacteria 2139
236 Ga0207698_10337301 3300026142 Bacteria 1418
237 Ga0207698_10811938 3300026142 Bacteria 938
238 Ga0207698_11252595 3300026142 Bacteria 756
239 Ga0207428_10185644 3300027907 Bacteria 1569
240 Ga0268266_10042039 3300028379 Bacteria 3902
241 Ga0268266_10345271 3300028379 Bacteria 1398
242 Ga0307408_100026339 3300031548 Bacteria 3993
243 Ga0307408_100767077 3300031548 Bacteria 872
244 Ga0307408_101075757 3300031548 Bacteria 745
245 Ga0307405_10017337 3300031731 Bacteria 3949
246 Ga0307405_10035750 3300031731 Bacteria 2970
247 Ga0307405_10448798 3300031731 Bacteria 1022
248 Ga0307413_10004092 3300031824 Bacteria 6276
249 Ga0307413_10011813 3300031824 Bacteria 4314
250 Ga0307413_10217696 3300031824 Bacteria 1392
251 Ga0307413_10314035 3300031824 Bacteria 1194
252 Ga0307413_10552891 3300031824 Bacteria 934
253 Ga0307410_10000490 3300031852 Bacteria 16059
254 Ga0307410_10020502 3300031852 Bacteria 4044
255 Ga0307410_10031656 3300031852 Bacteria 3397
256 Ga0307410_10436784 3300031852 Bacteria 1065
257 Ga0307406_10016439 3300031901 Bacteria 4299
258 Ga0307406_10095202 3300031901 Bacteria 2014
259 Ga0307406_10294737 3300031901 Bacteria 1243
260 Ga0307407_10032661 3300031903 Bacteria 2832
261 Ga0307407_10089825 3300031903 Bacteria 1880
262 Ga0307407_10173207 3300031903 Bacteria 1423
263 Ga0307407_10262774 3300031903 Bacteria 1188
264 Ga0307412_10109379 3300031911 Bacteria 1970
265 Ga0307412_10319181 3300031911 Bacteria 1235
266 Ga0307412_10509177 3300031911 Bacteria 1004
267 Ga0307412_10698894 3300031911 Bacteria 870
268 Ga0307412_10793797 3300031911 Bacteria 821
269 Ga0307409_100014891 3300031995 Bacteria 5079
270 Ga0307409_100018591 3300031995 Bacteria 4678
271 Ga0307409_100105950 3300031995 Bacteria 2345
272 Ga0307409_100231658 3300031995 Bacteria 1675
273 Ga0307409_100678416 3300031995 Bacteria 1027
274 Ga0307409_101117972 3300031995 Bacteria 809
275 Ga0307416_100633255 3300032002 Bacteria 1152
276 Ga0307416_100788091 3300032002 Bacteria 1045
277 Ga0307414_10019986 3300032004 Bacteria 4163
278 Ga0307414_10038761 3300032004 Bacteria 3203
279 Ga0307414_10098866 3300032004 Bacteria 2190
280 Ga0307414_10732296 3300032004 Bacteria 897
281 Ga0307411_10004629 3300032005 Bacteria 6624
282 Ga0307411_10052038 3300032005 Bacteria 2675
283 Ga0307411_10228181 3300032005 Bacteria 1449
284 Ga0307411_10465174 3300032005 Bacteria 1061
285 Ga0307411_10726684 3300032005 Bacteria 867
286 Ga0307411_11385620 3300032005 Bacteria 643
287 Ga0307415_100122829 3300032126 Bacteria 1950
288 Ga0307415_100362640 3300032126 Bacteria 1224
289 Ga0307415_100666948 3300032126 Bacteria 934
290 Ga0373923_0437223 3300035111 Unclassified 633
291 Ga0373932_0222553 3300035112 Bacteria 679
292 Ga0373953_0036423 3300035117 Bacteria 1938
293 Ga0373954_0012847 3300035118 Bacteria 3729
294 Ga0373956_0083282 3300035119 Bacteria 1470
295 Ga0373957_0023676 3300035120 Bacteria 2198
296 Ga0373943_0001126 3300035170 Bacteria 11940
297 Ga0373946_0076481 3300035171 Bacteria 1457
298 Ga0373955_0017633 3300035172 Bacteria 3537
299 Ga0373962_0156110 3300035242 Bacteria 750
300 Ga0373931_0092775 3300035691 Bacteria 1685
301 Ga0373931_1262367 3300035691 Unclassified 507
302 Ga0373935_0012130 3300035692 Bacteria 5183
303 Ga0373935_0183682 3300035692 Bacteria 1437
304 Ga0373927_0033181 3300035695 Bacteria 3362
305 Ga0373933_0070862 3300035724 Bacteria 2121
306 Ga0373947_0122929 3300035725 Bacteria 1650
307 Ga0373937_0115568 3300036401 Bacteria 2498
308 Ga0373925_0146641 3300037068 Bacteria 1850
309 Ga0395899_0001998 3300037312 Bacteria 16798
310 Ga0395899_0012177 3300037312 Bacteria 6585
311 Ga0395899_0026768 3300037312 Bacteria 4351
312 Ga0395899_0027354 3300037312 Bacteria 4300
313 Ga0395899_0028987 3300037312 Bacteria 4164
314 Ga0395899_0091184 3300037312 Bacteria 2208
315 Ga0395899_0112751 3300037312 Bacteria 1953
316 Ga0395899_0131452 3300037312 Bacteria 1787
317 Ga0395899_0148523 3300037312 Bacteria 1662
318 Ga0395899_0299653 3300037312 Bacteria 1088
319 Ga0395900_0004824 3300037418 Bacteria 14205
320 Ga0395900_0007250 3300037418 Bacteria 11480
321 Ga0395900_0012204 3300037418 Bacteria 8782
322 Ga0395900_0021029 3300037418 Bacteria 6667
323 Ga0395900_0055420 3300037418 Bacteria 4082
324 Ga0395900_0065793 3300037418 Bacteria 3724
325 Ga0395900_0073744 3300037418 Bacteria 3509
326 Ga0395900_0096840 3300037418 Bacteria 3032
327 Ga0395900_0285099 3300037418 Bacteria 1642
328 Ga0395900_0395401 3300037418 Bacteria 1347
329 Ga0395900_0472473 3300037418 Bacteria 1207
330 Ga0395900_0497881 3300037418 Bacteria 1169
331 Ga0395900_1267561 3300037418 Bacteria 651
332 Ga0395898_0008799 3300037466 Bacteria 10638
333 Ga0395898_0009643 3300037466 Bacteria 10136
334 Ga0395898_0022260 3300037466 Bacteria 6421
335 Ga0395898_0038383 3300037466 Bacteria 4747
336 Ga0395898_0056723 3300037466 Bacteria 3818
337 Ga0395898_0063056 3300037466 Bacteria 3597
338 Ga0395898_0071042 3300037466 Bacteria 3364
339 Ga0395898_0138362 3300037466 Bacteria 2331
340 Ga0395898_0247955 3300037466 Bacteria 1698
341 Ga0395898_0455866 3300037466 Bacteria 1217
342 Ga0395898_0556227 3300037466 Bacteria 1089
343 Ga0395898_0839156 3300037466 Bacteria 858
344 Ga0395905_0029032 3300037471 Bacteria 5213
345 Ga0395905_0030510 3300037471 Bacteria 5080
346 Ga0395905_0033176 3300037471 Bacteria 4850
347 Ga0395905_0036413 3300037471 Bacteria 4621
348 Ga0395905_0037962 3300037471 Bacteria 4520
349 Ga0395905_0044306 3300037471 Bacteria 4175
350 Ga0395905_0060782 3300037471 Bacteria 3533
351 Ga0395905_0061732 3300037471 Bacteria 3505
352 Ga0395905_0099929 3300037471 Bacteria 2724
353 Ga0395905_0144597 3300037471 Bacteria 2237
354 Ga0395905_0235739 3300037471 Bacteria 1710
355 Ga0395905_0259169 3300037471 Bacteria 1623
356 Ga0395905_0279148 3300037471 Bacteria 1556
357 Ga0395905_0286698 3300037471 Bacteria 1533
358 Ga0395905_0352888 3300037471 Bacteria 1363
359 Ga0395905_0540334 3300037471 Bacteria 1066
360 Ga0395905_0557585 3300037471 Bacteria 1047
361 Ga0395905_0768137 3300037471 Bacteria 866
362 Ga0395905_0920723 3300037471 Bacteria 777
363 Ga0395905_0981468 3300037471 Bacteria 748
364 Ga0395905_1046098 3300037471 Bacteria 719
365 Ga0395901_0000241 3300038443 Bacteria 68503
366 Ga0395901_0006300 3300038443 Bacteria 12018
367 Ga0395901_0023532 3300038443 Bacteria 6316
368 Ga0395901_0030373 3300038443 Bacteria 5567
369 Ga0395901_0038512 3300038443 Bacteria 4946
370 Ga0395901_0043526 3300038443 Bacteria 4657
371 Ga0395901_0043864 3300038443 Bacteria 4639
372 Ga0395901_0053094 3300038443 Bacteria 4211
373 Ga0395901_0060669 3300038443 Bacteria 3935
374 Ga0395901_0170403 3300038443 Bacteria 2284
375 Ga0395901_0180459 3300038443 Bacteria 2214
376 Ga0395901_0194365 3300038443 Bacteria 2127
377 Ga0395901_0226979 3300038443 Bacteria 1950
378 Ga0395901_0305575 3300038443 Bacteria 1648
379 Ga0395901_0315077 3300038443 Bacteria 1619
380 Ga0395901_0504573 3300038443 Bacteria 1231
381 Ga0395901_0875415 3300038443 Bacteria 882
382 Ga0395901_1326894 3300038443 Bacteria 680
383 Ga0439436_0048388 3300041404 Bacteria 1206
384 Ga0439461_0043581 3300041410 Bacteria 976
385 Ga0439462_0051113 3300042015 Bacteria 1111
386 Ga0450914_003199 3300042118 Bacteria 1241
387 Ga0450917_000634 3300042120 Bacteria 2607
388 Ga0450890_015838 3300042127 Bacteria 994
389 Ga0450889_000126 3300042144 Bacteria 7587
390 Ga0439446_0070287 3300042156 Bacteria 1070
391 Ga0439446_0227120 3300042156 Bacteria 638
392 Ga0439458_0001666 3300042157 Bacteria 5548
393 Ga0439458_0002195 3300042157 Bacteria 4825
394 Ga0466969_0052602 3300044656 Bacteria 2001
395 Ga0466969_0126901 3300044656 Bacteria 1185
396 Ga0466969_0289571 3300044656 Bacteria 741
397 Ga0466972_0088307 3300044658 Bacteria 1472
398 Ga0466972_0329919 3300044658 Bacteria 713
399 Ga0466965_0380800 3300044683 Bacteria 777
400 Ga0466966_0075625 3300044684 Bacteria 2104
401 Ga0466961_0349596 3300044693 Bacteria 900
402 Ga0466963_0012172 3300044694 Bacteria 5259
403 Ga0466963_0082514 3300044694 Bacteria 2179
404 Ga0466963_0540965 3300044694 Bacteria 822
405 Ga0466963_0721009 3300044694 Bacteria 703
406 Ga0466963_0933062 3300044694 Bacteria 611
407 Ga0466971_0321919 3300044719 Bacteria 745
408 Ga0466957_0004838 3300044842 Bacteria 7534
409 Ga0466959_0164340 3300045049 Bacteria 1559
410 Ga0466958_0000625 3300045836 Bacteria 15150
411 Ga0466958_0082854 3300045836 Bacteria 1976
412 Ga0466958_0102140 3300045836 Bacteria 1784
413 Ga0466958_0349937 3300045836 Bacteria 951
414 Ga0466958_0489894 3300045836 Bacteria 797
415 Ga0466967_0007528 3300045976 Bacteria 7863
416 Ga0466967_0020455 3300045976 Bacteria 5350
417 Ga0466967_0024693 3300045976 Bacteria 4945
418 Ga0466967_0504017 3300045976 Bacteria 1188
419 Ga0466967_0590692 3300045976 Bacteria 1095
420 Ga0466967_1543501 3300045976 Bacteria 661
421 Ga0495639_0516916 3300046475 Bacteria 610
422 Ga0495585_0239935 3300046492 Bacteria 908
423 Ga0495663_0222186 3300046525 Bacteria 664
424 Ga0495642_0007855 3300046528 Bacteria 4087
425 Ga0495598_0000692 3300046537 Bacteria 6415
426 Ga0495621_0000420 3300046539 Bacteria 10449
427 Ga0495668_0044669 3300046616 Bacteria 2462
428 Ga0495668_0284185 3300046616 Bacteria 906
429 Ga0495625_0806572 3300046660 Bacteria 545
430 Ga0495623_0072900 3300046679 Bacteria 2135
431 Ga0495669_0001193 3300046684 Bacteria 10803
432 Ga0495669_0007608 3300046684 Bacteria 4546
433 Ga0495669_0014416 3300046684 Bacteria 3378
434 Ga0495669_0045970 3300046684 Bacteria 1947
435 Ga0495669_0055171 3300046684 Bacteria 1789
436 Ga0495670_0004892 3300046691 Bacteria 6581
437 Ga0495677_0062059 3300047445 Bacteria 1387
438 Ga0495602_0039963 3300048088 Bacteria 4312
439 Ga0496104_0407306 3300048907 Bacteria 1272
440 Ga0496112_0644236 3300048915 Bacteria 989
441 Ga0496113_0011070 3300048916 Bacteria 5999
442 Ga0501074_0645750 3300049590 Bacteria 748
443 Ga0501249_029974 3300049679 Bacteria 1211
444 Ga0501225_0369231 3300049705 Bacteria 500
445 Ga0501080_0067082 3300049742 Bacteria 3337
446 Ga0501044_0752120 3300049823 Bacteria 857
447 nmdc:mga08y16_110365_c1 3300050511 Bacteria 2864
448 Ga0466962_0087583 3300061719 Bacteria 1491
449 Ga0070714_101151044
450 JGI24739J22299_10002456
451 JGI24737J22298_10002555
452 JGI24735J21928_10100385
453 Ga0070658_10011936
454 Ga0070658_10107531
455 Ga0070658_10170734
456 Ga0070658_10183984
457 Ga0070658_10459499
458 Ga0070683_100011856
459 Ga0070683_100263561
460 Ga0070670_100010495
461 Ga0070670_100193307
462 Ga0070677_10084386
463 Ga0070666_10002936
464 Ga0070666_10920293
465 Ga0070680_100002233
466 Ga0070680_100079437
467 Ga0070680_100092492
468 Ga0070680_100138926
469 Ga0070680_100215192
470 Ga0070660_100059190
471 Ga0070660_100187295
472 Ga0070660_100208003
473 Ga0070660_100222411
474 Ga0070660_100350441
475 Ga0070660_100628764
476 Ga0070660_101048529
477 Ga0070661_100000100
478 Ga0070661_100483852
479 Ga0070661_100735912
480 Ga0070661_101250192
481 Ga0070692_10003945
482 Ga0070675_100223777
483 Ga0070671_100050376
484 Ga0070674_100010504
485 Ga0070673_100005946
486 Ga0070673_100049225
487 Ga0070673_100355600
488 Ga0070659_100001228
489 Ga0070659_100006278
490 Ga0070659_100024202
491 Ga0070659_100031820
492 Ga0070659_100035715
493 Ga0070659_100324005
494 Ga0070659_100559367
495 Ga0070659_101180364
496 Ga0070667_100018571
497 Ga0070667_100152857
498 Ga0070667_100349959
499 Ga0070714_100059380
500 Ga0070714_100196381
501 Ga0070701_10840744
502 Ga0070701_10857725
503 Ga0070694_100042064
504 Ga0070663_100229625
505 Ga0070663_100320805
506 Ga0070662_100004489
507 Ga0070662_100019551
508 Ga0070662_100209828
509 Ga0070662_100406113
510 Ga0070662_100449024
511 Ga0070681_10126995
512 Ga0070681_10254922
513 Ga0070681_11380220
514 Ga0068867_100362640
515 Ga0070679_100151354
516 Ga0070679_100286000
517 Ga0070679_100424155
518 Ga0070679_101314940
519 Ga0070684_100009749
520 Ga0068853_100152907
521 Ga0068853_100693850
522 Ga0070672_100066782
523 Ga0070672_100240067
524 Ga0070672_100555201
525 Ga0070686_100077972
526 Ga0070695_100092734
527 Ga0070696_100161831
528 Ga0070665_100004206
529 Ga0070665_100157765
530 Ga0070665_101339268
531 Ga0068855_100068622
532 Ga0068855_100212796
533 Ga0068855_100333642
534 Ga0068855_100345603
535 Ga0068855_100369727
536 Ga0068855_101397386
537 Ga0070664_100304936
538 Ga0070664_101096699
539 Ga0068857_100049866
540 Ga0068857_100083157
541 Ga0068854_100325905
542 Ga0068854_100662007
543 Ga0068856_100057499
544 Ga0068856_100317742
545 Ga0068856_100447368
546 Ga0068856_100630749
547 Ga0068856_100772739
548 Ga0068856_101051634
549 Ga0068852_100002322
550 Ga0068852_100041614
551 Ga0068852_100214357
552 Ga0068852_100312671
553 Ga0068859_100007546
554 Ga0068863_100006462
555 Ga0068863_100135696
556 Ga0068858_100021978
557 Ga0068860_100265985
558 Ga0068862_100871139
559 Ga0070712_100009565
560 Ga0075434_101055151
561 Ga0097620_100007546
562 Ga0105240_10037873
563 Ga0105240_12089873
564 Ga0111539_10088855
565 Ga0105247_10069889
566 Ga0105248_10000163
567 Ga0105248_10009119
568 Ga0105248_10224947
569 Ga0105248_10528432
570 Ga0105239_11329026
571 Ga0105239_12003973
572 Ga0157373_10004400
573 Ga0157373_10037250
574 Ga0157373_10080929
575 Ga0157373_10081263
576 Ga0157373_10091414
577 Ga0157373_10115294
578 Ga0157373_10307846
579 Ga0157373_10444700
580 Ga0157371_10000722
581 Ga0157371_10017544
582 Ga0157371_10019588
583 Ga0157371_10022371
584 Ga0157371_10026853
585 Ga0157371_10242820
586 Ga0157371_10431500
587 Ga0157371_10696362
588 Ga0157371_11076186
589 Ga0157370_10108565
590 Ga0157370_10218654
591 Ga0157370_10503883
592 Ga0157370_10519266
593 Ga0157370_10790452
594 Ga0157370_10990571
595 Ga0157369_10002370
596 Ga0157369_10009078
597 Ga0157369_10034859
598 Ga0157369_10044937
599 Ga0157369_10139994
600 Ga0157369_10422135
601 Ga0157374_10713288
602 Ga0157374_10843765
603 Ga0157378_10496096
604 Ga0163162_10330228
605 Ga0157372_10057383
606 Ga0157372_10152136
607 Ga0157372_10164299
608 Ga0157372_10191377
609 Ga0157372_10212780
610 Ga0157372_11019687
611 Ga0157372_12093250
612 Ga0157375_11403158
613 Ga0163163_10000173
614 Ga0157379_10018210
615 Ga0206353_11203057
616 Ga0207656_10072114
617 Ga0207656_10444071
618 Ga0207710_10038325
619 Ga0207680_10007712
620 Ga0207647_10000847
621 Ga0207647_10020690
622 Ga0207647_10139359
623 Ga0207705_10224565
624 Ga0207707_10055886
625 Ga0207695_10149179
626 Ga0207693_10049525
627 Ga0207660_10003204
628 Ga0207660_10004089
629 Ga0207660_10009880
630 Ga0207657_10030277
631 Ga0207657_10222236
632 Ga0207657_10499422
633 Ga0207649_10223823
634 Ga0207649_10232115
635 Ga0207649_11097533
636 Ga0207652_10041079
637 Ga0207652_10088748
638 Ga0207652_10301830
639 Ga0207652_10521992
640 Ga0207681_10249388
641 Ga0207664_10019357
642 Ga0207664_10736286
643 Ga0207644_10481494
644 Ga0207644_10851240
645 Ga0207690_10001344
646 Ga0207690_10120170
647 Ga0207690_10302643
648 Ga0207690_10514337
649 Ga0207690_10619051
650 Ga0207706_10005540
651 Ga0207706_10062852
652 Ga0207706_10169679
653 Ga0207706_10209397
654 Ga0207706_10590177
655 Ga0207669_10024273
656 Ga0207691_10206199
657 Ga0207711_10001440
658 Ga0207711_10312875
659 Ga0207661_10009585
660 Ga0207679_10447129
661 Ga0207667_10010120
662 Ga0207667_10656259
663 Ga0207667_10806536
664 Ga0207651_10026823
665 Ga0207640_10031887
666 Ga0207640_10174590
667 Ga0207658_10016830
668 Ga0207658_10158241
669 Ga0207677_10007214
670 Ga0207703_10004143
671 Ga0207702_10077212
672 Ga0207702_10117472
673 Ga0207702_10779465
674 Ga0207702_11225504
675 Ga0207641_10009836
676 Ga0207641_10074813
677 Ga0207648_10511114
678 Ga0207674_10005849
679 Ga0207674_10105832
680 Ga0207674_10236928
681 Ga0207698_10002083
682 Ga0207698_10003489
683 Ga0207698_10131585
684 Ga0207698_10337301
685 Ga0207698_10811938
686 Ga0207698_11252595
687 Ga0207428_10185644
688 Ga0268266_10042039
689 Ga0268266_10345271
690 Ga0307408_100026339
691 Ga0307408_100767077
692 Ga0307408_101075757
693 Ga0307405_10017337
694 Ga0307405_10035750
695 Ga0307405_10448798
696 Ga0307413_10004092
697 Ga0307413_10011813
698 Ga0307413_10217696
699 Ga0307413_10314035
700 Ga0307413_10552891
701 Ga0307410_10000490
702 Ga0307410_10020502
703 Ga0307410_10031656
704 Ga0307410_10436784
705 Ga0307406_10016439
706 Ga0307406_10095202
707 Ga0307406_10294737
708 Ga0307407_10032661
709 Ga0307407_10089825
710 Ga0307407_10173207
711 Ga0307407_10262774
712 Ga0307412_10109379
713 Ga0307412_10319181
714 Ga0307412_10509177
715 Ga0307412_10698894
716 Ga0307412_10793797
717 Ga0307409_100014891
718 Ga0307409_100018591
719 Ga0307409_100105950
720 Ga0307409_100231658
721 Ga0307409_100678416
722 Ga0307409_101117972
723 Ga0307416_100633255
724 Ga0307416_100788091
725 Ga0307414_10019986
726 Ga0307414_10038761
727 Ga0307414_10098866
728 Ga0307414_10732296
729 Ga0307411_10004629
730 Ga0307411_10052038
731 Ga0307411_10228181
732 Ga0307411_10465174
733 Ga0307411_10726684
734 Ga0307411_11385620
735 Ga0307415_100122829
736 Ga0307415_100362640
737 Ga0307415_100666948
738 Ga0373923_0437223
739 Ga0373932_0222553
740 Ga0373953_0036423
741 Ga0373954_0012847
742 Ga0373956_0083282
743 Ga0373957_0023676
744 Ga0373943_0001126
745 Ga0373946_0076481
746 Ga0373955_0017633
747 Ga0373962_0156110
748 Ga0373931_0092775
749 Ga0373931_1262367
750 Ga0373935_0012130
751 Ga0373935_0183682
752 Ga0373927_0033181
753 Ga0373933_0070862
754 Ga0373947_0122929
755 Ga0373937_0115568
756 Ga0373925_0146641
757 Ga0395899_0001998
758 Ga0395899_0012177
759 Ga0395899_0026768
760 Ga0395899_0027354
761 Ga0395899_0028987
762 Ga0395899_0091184
763 Ga0395899_0112751
764 Ga0395899_0131452
765 Ga0395899_0148523
766 Ga0395899_0299653
767 Ga0395900_0004824
768 Ga0395900_0007250
769 Ga0395900_0012204
770 Ga0395900_0021029
771 Ga0395900_0055420
772 Ga0395900_0065793
773 Ga0395900_0073744
774 Ga0395900_0096840
775 Ga0395900_0285099
776 Ga0395900_0395401
777 Ga0395900_0472473
778 Ga0395900_0497881
779 Ga0395900_1267561
780 Ga0395898_0008799
781 Ga0395898_0009643
782 Ga0395898_0022260
783 Ga0395898_0038383
784 Ga0395898_0056723
785 Ga0395898_0063056
786 Ga0395898_0071042
787 Ga0395898_0138362
788 Ga0395898_0247955
789 Ga0395898_0455866
790 Ga0395898_0556227
791 Ga0395898_0839156
792 Ga0395905_0029032
793 Ga0395905_0030510
794 Ga0395905_0033176
795 Ga0395905_0036413
796 Ga0395905_0037962
797 Ga0395905_0044306
798 Ga0395905_0060782
799 Ga0395905_0061732
800 Ga0395905_0099929
801 Ga0395905_0144597
802 Ga0395905_0235739
803 Ga0395905_0259169
804 Ga0395905_0279148
805 Ga0395905_0286698
806 Ga0395905_0352888
807 Ga0395905_0540334
808 Ga0395905_0557585
809 Ga0395905_0768137
810 Ga0395905_0920723
811 Ga0395905_0981468
812 Ga0395905_1046098
813 Ga0395901_0000241
814 Ga0395901_0006300
815 Ga0395901_0023532
816 Ga0395901_0030373
817 Ga0395901_0038512
818 Ga0395901_0043526
819 Ga0395901_0043864
820 Ga0395901_0053094
821 Ga0395901_0060669
822 Ga0395901_0170403
823 Ga0395901_0180459
824 Ga0395901_0194365
825 Ga0395901_0226979
826 Ga0395901_0305575
827 Ga0395901_0315077
828 Ga0395901_0504573
829 Ga0395901_0875415
830 Ga0395901_1326894
831 Ga0439436_0048388
832 Ga0439461_0043581
833 Ga0439462_0051113
834 Ga0450914_003199
835 Ga0450917_000634
836 Ga0450890_015838
837 Ga0450889_000126
838 Ga0439446_0070287
839 Ga0439446_0227120
840 Ga0439458_0001666
841 Ga0439458_0002195
842 Ga0466969_0052602
843 Ga0466969_0126901
844 Ga0466969_0289571
845 Ga0466972_0088307
846 Ga0466972_0329919
847 Ga0466965_0380800
848 Ga0466966_0075625
849 Ga0466961_0349596
850 Ga0466963_0012172
851 Ga0466963_0082514
852 Ga0466963_0540965
853 Ga0466963_0721009
854 Ga0466963_0933062
855 Ga0466971_0321919
856 Ga0466957_0004838
857 Ga0466959_0164340
858 Ga0466958_0000625
859 Ga0466958_0082854
860 Ga0466958_0102140
861 Ga0466958_0349937
862 Ga0466958_0489894
863 Ga0466967_0007528
864 Ga0466967_0020455
865 Ga0466967_0024693
866 Ga0466967_0504017
867 Ga0466967_0590692
868 Ga0466967_1543501
869 Ga0495639_0516916
870 Ga0495585_0239935
871 Ga0495663_0222186
872 Ga0495642_0007855
873 Ga0495598_0000692
874 Ga0495621_0000420
875 Ga0495668_0044669
876 Ga0495668_0284185
877 Ga0495625_0806572
878 Ga0495623_0072900
879 Ga0495669_0001193
880 Ga0495669_0007608
881 Ga0495669_0014416
882 Ga0495669_0045970
883 Ga0495669_0055171
884 Ga0495670_0004892
885 Ga0495677_0062059
886 Ga0495602_0039963
887 Ga0496104_0407306
888 Ga0496112_0644236
889 Ga0496113_0011070
890 Ga0501074_0645750
891 Ga0501249_029974
892 Ga0501225_0369231
893 Ga0501080_0067082
894 Ga0501044_0752120
895 nmdc:mga08y16_110365_c1
896 Ga0466962_0087583

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6h56-assembly1.cif.gz_B effector domain of pseudomonas aeruginosa vgrg2b 0.8518 4 133
6h56-assembly1.cif.gz_B effector domain of pseudomonas aeruginosa vgrg2b 0.7468 4 133
6fj2-assembly1.cif.gz_A structure of thermolysin solved from sad data collected at the peak of the zn absorption edge on id30b 0.5699 10 133
7skm-assembly2.cif.gz_C complex between s. aureus aureolysin and wt impi. 0.5662 9 131
2a7g-assembly1.cif.gz_E on the routine use of soft x-rays in macromolecular crystallography, part iii- the optimal data collection wavelength 0.5638 9 133
ID Description Score Start End Superfamily
af_Q22531_1217_1473_1.10.390.10 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.5202 8 81 1.10.390.10
5lv0B03 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.4928 27 92 3.40.390.10
af_B8JIB4_286_534_1.10.390.10 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.4915 29 89 1.10.390.10
af_P77544_4_214_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.4683 106 137 3.40.50.720
af_Q17405_400_654_1.10.390.10 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.4651 7 131 1.10.390.10
ID Description Score Start End GO Terms
AF-A0A7G9SKR0-F1-model_v4 Vgr related protein 0.9814 2 147
AF-A0A7H0GFA1-F1-model_v4 deleted 0.9719 18 148
AF-A0A352HCK9-F1-model_v4 deleted 0.9668 3 126
AF-A0A7G9SKR0-F1-model_v4 Vgr related protein 0.9619 2 147
AF-A0A5B8S790-F1-model_v4 Vgr related protein 0.9596 3 148

Map