F446065

General Info

Members Datasets Scaffolds Average Seq Length
447 293 894 557

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3006321560|3006322166
Length 611
Sequence LSDAPRSAAAPAAADRARDWWRDAVIYQVYPRSFADGNGDGMGDLPGVTARLPYLRDLGVDAVWLSPFYSSPQADAGYDVADYREVDPMFGTLSDADELVRAAHALDLRVIVDLVPNHCSDQHEWFKQALREGPGSALRDRFHFRPGKGVSGELPPNDWESIFGGPAWTRTTNPDGTPGEWYLHLFAPEQPDFDWDHPAVHEEFRSVLRFWLDLGVDGFRIDVAHGLVKAAGLPDIGHSEQLALLGSAPMPYFDQDGVHEIYRGWRRILDEYPGQRIGVAEAWTPTIERAALYLRPDELHQAFNFEYLGTAWDAAELRRVIDGCLAAMAGVGAPATWVLSNHDVTRHATRFANPPGLGTQLREPGDRELGLRRARAATLLMLALPGSAYLYQGEELGLPDVTDLPDEVRQDPSFFRAAGQDGFRDGCRVPIPWSGDEPPYGFGPVAGGPSWLPQPASWAGLSVEAQTGDPASTLEMYRAALRLRRELPALGAGEAVRWLPAPEGVLAFRRDPGAGRDGSGRGGGLLCLVNLTARPVTLAVPAGRAVLSSAPAVSVPSAPAVSGAGAGSGAGAVSAVSGVVGRQATGAAGGADGINRMDVTIAADTTIWWAI

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
14 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
22 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
25 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
26 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
27 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
28 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
29 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
30 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
38 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
40 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
41 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
42 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
43 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
44 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
45 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
46 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
47 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
48 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
49 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
50 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
51 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
52 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
53 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
54 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
55 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
56 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
57 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
58 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
59 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
60 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
61 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
62 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
63 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
64 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
65 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
66 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
67 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
68 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
69 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
70 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
71 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
72 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
73 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
74 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
75 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
76 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
77 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
78 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
79 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
80 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
81 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
82 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
83 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
84 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
85 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
86 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
87 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
88 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
89 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
90 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
91 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
92 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
93 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
94 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
95 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
96 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
97 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
98 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
99 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
102 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
103 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
104 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
105 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
106 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
107 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
108 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
109 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
110 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
111 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
112 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
113 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
114 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
115 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
116 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
117 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
118 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
119 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
120 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
123 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
124 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
125 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
126 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
129 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
130 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
131 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
132 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
133 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
134 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
135 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
138 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
171 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
172 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
176 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
177 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
178 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
179 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
180 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
181 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
182 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
183 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
184 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
185 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
186 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
191 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
192 2501939600 Micromonospora sp. L5 Isolate Unclassified
193 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
194 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
195 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
196 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
197 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
198 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
199 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
200 2643221548 Streptomyces sp. Root55 Isolate Unclassified
201 2643221578 Streptomyces sp. Root63 Isolate Unclassified
202 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
203 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
204 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
205 2643221647 Streptomyces sp. Root369 Isolate Unclassified
206 2643221670 Streptomyces sp. Root431 Isolate Unclassified
207 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
208 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
209 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
210 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
211 2643221714 Streptomyces sp. Root264 Isolate Unclassified
212 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
213 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
214 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
215 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
216 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
217 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
218 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
219 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
220 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
221 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
222 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
223 2808606448 Streptomyces sp. 193411 Isolate Unclassified
224 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
225 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
226 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
227 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
228 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
229 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
230 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
231 2855683550 Micromonospora sp. RP3T Isolate Unclassified
232 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
233 2858868258 Micromonospora sp. MH33 Isolate Unclassified
234 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
235 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
236 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
237 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
238 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
239 2862574272 Streptomyces sp. AcE210 Isolate Nodule
240 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
241 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
242 2867369537 Streptomyces sp. Z26 Isolate Unclassified
243 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
244 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
245 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
246 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
247 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
248 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
249 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
250 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
251 2902582711 Micromonospora sp. AP08 Isolate Unclassified
252 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
253 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
254 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
255 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
256 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
257 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
258 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
259 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
260 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
261 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
262 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
263 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
264 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
265 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
266 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
267 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
268 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
269 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
270 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
271 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
272 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
273 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
274 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
275 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
276 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
277 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
278 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
279 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
280 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
281 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
282 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
283 649633069 Micromonospora sp. L5 Isolate Unclassified
284 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
285 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
286 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
287 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
288 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
289 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
290 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
291 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
292 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
293 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.72
Metatranscriptomes 0.22
Isolates 25.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.59
Nodule 0.67
Rhizoplane 2.01
Rhizosphere 71.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10002539 3300003203 Bacteria 8633
2 Ga0006562J51391_1042986 3300003578 Bacteria 2774
3 Ga0070683_100117505 3300005329 Bacteria 2511
4 Ga0070661_100113625 3300005344 Bacteria 2024
5 Ga0070667_100073277 3300005367 Bacteria 2920
6 Ga0070714_100005628 3300005435 Bacteria 9582
7 Ga0070714_100083106 3300005435 Bacteria 2791
8 Ga0070711_100030041 3300005439 Bacteria 3594
9 Ga0070711_100081213 3300005439 Bacteria 2310
10 Ga0070663_100049855 3300005455 Bacteria 2975
11 Ga0070698_100013333 3300005471 Bacteria 8700
12 Ga0070684_100044499 3300005535 Bacteria 3840
13 Ga0070684_100200210 3300005535 Bacteria 1819
14 Ga0068855_100018712 3300005563 Bacteria 8328
15 Ga0081455_10000854 3300005937 Bacteria 39254
16 Ga0081455_10007258 3300005937 Bacteria 11701
17 Ga0081455_10008313 3300005937 Bacteria 10812
18 Ga0081455_10044152 3300005937 Bacteria 3891
19 Ga0081540_1005598 3300005983 Bacteria 9350
20 Ga0081539_10000143 3300005985 Bacteria 165345
21 Ga0070717_10023442 3300006028 Bacteria 4890
22 Ga0075365_10003472 3300006038 Bacteria 8130
23 Ga0075368_10013332 3300006042 Bacteria 3018
24 Ga0075363_100005155 3300006048 Bacteria 5782
25 Ga0075367_10000362 3300006178 Bacteria 16344
26 Ga0075431_100048054 3300006847 Bacteria 4401
27 Ga0075431_100148095 3300006847 Bacteria 2418
28 Ga0105251_10012393 3300009011 Bacteria 4823
29 Ga0105241_10000454 3300009174 Bacteria 30798
30 Ga0105249_10056517 3300009553 Bacteria 3593
31 Ga0182008_10002474 3300014497 Bacteria 11561
32 Ga0182007_10000440 3300015262 Bacteria 25194
33 Ga0183367_1009 3300015688 Bacteria 484598
34 Ga0213875_10000217 3300021388 Bacteria 58346
35 Ga0213875_10000499 3300021388 Bacteria 32899
36 Ga0209758_1003317 3300025297 Bacteria 14830
37 Ga0207426_1001688 3300025302 Bacteria 17035
38 Ga0207426_1003153 3300025302 Bacteria 9363
39 Ga0207671_10002071 3300025914 Bacteria 21948
40 Ga0207663_10039581 3300025916 Bacteria 2858
41 Ga0207700_10019602 3300025928 Bacteria 4570
42 Ga0207664_10021545 3300025929 Bacteria 4795
43 Ga0207664_10079508 3300025929 Bacteria 2662
44 Ga0207712_10012387 3300025961 Bacteria 5448
45 Ga0207678_10006738 3300026067 Bacteria 10187
46 Ga0207678_10033566 3300026067 Bacteria 4470
47 Ga0207675_100126714 3300026118 Bacteria 2418
48 Ga0209813_10000738 3300027866 Bacteria 7444
49 Ga0268266_10134687 3300028379 Bacteria 2212
50 Ga0307517_10011593 3300028786 Bacteria 12203
51 Ga0307517_10019267 3300028786 Bacteria 8767
52 Ga0307517_10030767 3300028786 Bacteria 6276
53 Ga0307515_10001805 3300028794 Bacteria 47772
54 Ga0307515_10002305 3300028794 Bacteria 41711
55 Ga0307515_10031226 3300028794 Bacteria 8892
56 Ga0307511_10001658 3300030521 Bacteria 23438
57 Ga0307511_10047126 3300030521 Bacteria 3532
58 Ga0307512_10001551 3300030522 Bacteria 32217
59 Ga0307512_10001914 3300030522 Bacteria 27799
60 Ga0307513_10007142 3300031456 Bacteria 14519
61 Ga0307513_10008019 3300031456 Bacteria 13570
62 Ga0307513_10016722 3300031456 Bacteria 8828
63 Ga0307513_10017018 3300031456 Bacteria 8736
64 Ga0307509_10010961 3300031507 Bacteria 11048
65 Ga0307509_10054986 3300031507 Bacteria 4234
66 Ga0307509_10082205 3300031507 Bacteria 3323
67 Ga0307508_10003492 3300031616 Bacteria 15863
68 Ga0307508_10004202 3300031616 Bacteria 14156
69 Ga0307508_10027491 3300031616 Bacteria 5147
70 Ga0307514_10016585 3300031649 Bacteria 6067
71 Ga0307514_10029111 3300031649 Bacteria 4446
72 Ga0307516_10000105 3300031730 Bacteria 96224
73 Ga0307516_10005435 3300031730 Bacteria 15245
74 Ga0307516_10011499 3300031730 Bacteria 9610
75 Ga0307516_10027809 3300031730 Bacteria 5731
76 Ga0307507_10009112 3300033179 Bacteria 13353
77 Ga0307507_10010258 3300033179 Bacteria 12170
78 Ga0307507_10022864 3300033179 Bacteria 6886
79 Ga0307510_10007913 3300033180 Bacteria 12657
80 Ga0307510_10019255 3300033180 Bacteria 8010
81 Ga0307510_10032686 3300033180 Bacteria 5858
82 Ga0373925_0000245 3300037068 Bacteria 57711
83 Ga0395900_0029155 3300037418 Bacteria 5661
84 Ga0395898_0006885 3300037466 Bacteria 12094
85 Ga0436364_0062912 3300037853 Bacteria 47359
86 Ga0436364_0232843 3300037853 Bacteria 50861
87 Ga0395901_0159084 3300038443 Bacteria 2372
88 Ga0439448_0003972 3300042005 Bacteria 4153
89 Ga0439449_0000981 3300042007 Bacteria 11219
90 Ga0439449_0003337 3300042007 Bacteria 6258
91 Ga0439457_009350 3300042014 Bacteria 2284
92 Ga0439462_0003390 3300042015 Bacteria 3822
93 Ga0450899_001235 3300042135 Bacteria 2901
94 Ga0450903_000088 3300042138 Bacteria 18956
95 Ga0450906_006685 3300042145 Bacteria 2310
96 Ga0439458_0000045 3300042157 Bacteria 19993
97 Ga0466969_0004896 3300044656 Bacteria 7132
98 Ga0466972_0002464 3300044658 Bacteria 9153
99 Ga0466972_0007548 3300044658 Bacteria 5458
100 Ga0466965_0009467 3300044683 Bacteria 4525
101 Ga0466965_0022175 3300044683 Bacteria 3062
102 Ga0466966_0003972 3300044684 Bacteria 9774
103 Ga0466966_0020516 3300044684 Bacteria 4343
104 Ga0466961_0001652 3300044693 Bacteria 13859
105 Ga0466961_0034002 3300044693 Bacteria 3275
106 Ga0466961_0034249 3300044693 Bacteria 3261
107 Ga0466963_0000121 3300044694 Bacteria 29248
108 Ga0466963_0000769 3300044694 Bacteria 15874
109 Ga0466971_0000989 3300044719 Bacteria 11722
110 Ga0466971_0019611 3300044719 Bacteria 3005
111 Ga0466968_0059200 3300044735 Bacteria 1649
112 Ga0466970_0000251 3300044765 Bacteria 26272
113 Ga0466970_0000404 3300044765 Bacteria 21023
114 Ga0466957_0002075 3300044842 Bacteria 10715
115 Ga0466960_0002562 3300044901 Bacteria 6829
116 Ga0466959_0000608 3300045049 Bacteria 20897
117 Ga0466959_0035602 3300045049 Bacteria 3680
118 Ga0466958_0005492 3300045836 Bacteria 6837
119 Ga0466967_0013069 3300045976 Bacteria 6393
120 Ga0466967_0034222 3300045976 Bacteria 4310
121 Ga0466967_0082932 3300045976 Bacteria 2898
122 Ga0495617_005583 3300046452 Bacteria 4452
123 Ga0495627_007050 3300046453 Bacteria 4354
124 Ga0495592_0003112 3300046454 Bacteria 11844
125 Ga0495592_0007007 3300046454 Bacteria 8427
126 Ga0495603_0001436 3300046455 Bacteria 13848
127 Ga0495603_0005179 3300046455 Bacteria 7784
128 Ga0495603_0009488 3300046455 Bacteria 5879
129 Ga0495603_0085677 3300046455 Bacteria 1844
130 Ga0495629_0001223 3300046459 Bacteria 20188
131 Ga0495629_0001589 3300046459 Bacteria 17862
132 Ga0495629_0001656 3300046459 Bacteria 17493
133 Ga0495629_0002447 3300046459 Bacteria 14244
134 Ga0495629_0002909 3300046459 Bacteria 13060
135 Ga0495629_0029783 3300046459 Bacteria 3870
136 Ga0495629_0043904 3300046459 Bacteria 3138
137 Ga0495629_0119949 3300046459 Bacteria 1832
138 Ga0495638_0010143 3300046460 Bacteria 6561
139 Ga0495638_0074142 3300046460 Bacteria 2076
140 Ga0495651_0002785 3300046462 Bacteria 13551
141 Ga0495651_0003768 3300046462 Bacteria 11598
142 Ga0495651_0016511 3300046462 Bacteria 5719
143 Ga0495653_0008946 3300046463 Bacteria 8188
144 Ga0495653_0036080 3300046463 Bacteria 3897
145 Ga0495662_0001544 3300046476 Bacteria 11442
146 Ga0495664_0000762 3300046477 Bacteria 16510
147 Ga0495664_0010573 3300046477 Bacteria 5179
148 Ga0495585_0022307 3300046492 Bacteria 3634
149 Ga0495585_0035126 3300046492 Bacteria 2834
150 Ga0495594_0000274 3300046499 Bacteria 25385
151 Ga0495594_0018413 3300046499 Bacteria 3698
152 Ga0495607_0008099 3300046501 Bacteria 7215
153 Ga0495610_0027176 3300046512 Bacteria 3046
154 Ga0495616_0005017 3300046513 Bacteria 8246
155 Ga0495618_0094248 3300046514 Bacteria 1914
156 Ga0495628_0027168 3300046516 Bacteria 4659
157 Ga0495630_0031441 3300046517 Bacteria 3953
158 Ga0495631_0005247 3300046518 Bacteria 6812
159 Ga0495632_0035229 3300046519 Bacteria 2556
160 Ga0495637_0024243 3300046520 Bacteria 2745
161 Ga0495643_0002315 3300046522 Bacteria 15364
162 Ga0495666_0002230 3300046526 Bacteria 9650
163 Ga0495666_0002887 3300046526 Bacteria 8602
164 Ga0495666_0073396 3300046526 Bacteria 1623
165 Ga0495652_0015681 3300046529 Bacteria 6782
166 Ga0495652_0080649 3300046529 Bacteria 2687
167 Ga0495654_0021899 3300046530 Bacteria 3323
168 Ga0495640_0003185 3300046533 Bacteria 13221
169 Ga0495640_0007518 3300046533 Bacteria 8561
170 Ga0495640_0008447 3300046533 Bacteria 8077
171 Ga0495587_0002910 3300046536 Bacteria 11455
172 Ga0495587_0008023 3300046536 Bacteria 6816
173 Ga0495609_0031682 3300046538 Bacteria 2402
174 Ga0495609_0040945 3300046538 Bacteria 2084
175 Ga0495645_0008241 3300046543 Bacteria 7268
176 Ga0495645_0014076 3300046543 Bacteria 5669
177 Ga0495622_0003147 3300046557 Bacteria 7810
178 Ga0495622_0008556 3300046557 Bacteria 4742
179 Ga0495633_0013912 3300046558 Bacteria 4219
180 Ga0495634_0001190 3300046642 Bacteria 24054
181 Ga0495634_0003683 3300046642 Bacteria 12232
182 Ga0495611_0006283 3300046648 Bacteria 5068
183 Ga0495611_0011635 3300046648 Bacteria 3732
184 Ga0495625_0006146 3300046660 Bacteria 10751
185 Ga0495625_0027453 3300046660 Bacteria 4286
186 Ga0495625_0076374 3300046660 Bacteria 2342
187 Ga0495635_0012526 3300046663 Bacteria 5941
188 Ga0495635_0014513 3300046663 Bacteria 5512
189 Ga0495661_0026312 3300046665 Bacteria 3748
190 Ga0495588_0004085 3300046674 Bacteria 6424
191 Ga0495588_0012990 3300046674 Bacteria 3955
192 Ga0495588_0046376 3300046674 Bacteria 2229
193 Ga0495657_0000231 3300046675 Bacteria 50474
194 Ga0495657_0012562 3300046675 Bacteria 6287
195 Ga0495623_0034859 3300046679 Bacteria 3227
196 Ga0495623_0070446 3300046679 Bacteria 2178
197 Ga0495646_0000166 3300046680 Bacteria 33047
198 Ga0495646_0000359 3300046680 Bacteria 23525
199 Ga0495646_0002160 3300046680 Bacteria 11966
200 Ga0495613_0000266 3300046689 Bacteria 48702
201 Ga0495613_0003178 3300046689 Bacteria 12298
202 Ga0495613_0003819 3300046689 Bacteria 11282
203 Ga0495613_0009321 3300046689 Bacteria 7284
204 Ga0495670_0020831 3300046691 Bacteria 3233
205 Ga0495670_0023560 3300046691 Bacteria 3038
206 Ga0495671_0022822 3300046692 Bacteria 3274
207 Ga0495589_0049825 3300046794 Bacteria 2072
208 Ga0495600_0038064 3300046809 Bacteria 3128
209 Ga0495660_0043922 3300046810 Bacteria 2461
210 Ga0495660_0055016 3300046810 Bacteria 2155
211 Ga0495581_0001673 3300047315 Bacteria 12351
212 Ga0495581_0003257 3300047315 Bacteria 9309
213 Ga0495604_0000320 3300047317 Bacteria 43232
214 Ga0495604_0002297 3300047317 Bacteria 15311
215 Ga0495604_0010743 3300047317 Bacteria 7269
216 Ga0495604_0039654 3300047317 Bacteria 3700
217 Ga0495604_0058367 3300047317 Bacteria 2963
218 Ga0495636_0000479 3300047318 Bacteria 14733
219 Ga0495676_0001221 3300047321 Bacteria 22020
220 Ga0495676_0001923 3300047321 Bacteria 18218
221 Ga0495676_0004646 3300047321 Bacteria 12575
222 Ga0495676_0004977 3300047321 Bacteria 12184
223 Ga0495676_0010741 3300047321 Bacteria 8289
224 Ga0495676_0022349 3300047321 Bacteria 5503
225 Ga0495680_0060303 3300047322 Bacteria 2925
226 Ga0495683_0042174 3300047323 Bacteria 2301
227 Ga0495687_001600 3300047443 Bacteria 20432
228 Ga0495687_002378 3300047443 Bacteria 15200
229 Ga0495687_031993 3300047443 Bacteria 2407
230 Ga0495675_0016051 3300047444 Bacteria 4735
231 Ga0495675_0061699 3300047444 Bacteria 2375
232 Ga0495675_0072946 3300047444 Bacteria 2165
233 Ga0495675_0081407 3300047444 Bacteria 2039
234 Ga0495685_000716 3300047447 Bacteria 10193
235 Ga0495685_002101 3300047447 Bacteria 6194
236 Ga0495685_003589 3300047447 Bacteria 4962
237 Ga0495681_0001810 3300047470 Bacteria 15713
238 Ga0495681_0009995 3300047470 Bacteria 5781
239 Ga0495681_0059687 3300047470 Bacteria 1762
240 Ga0495684_0025537 3300047471 Bacteria 4538
241 Ga0495686_0006017 3300047472 Bacteria 9425
242 Ga0495686_0014560 3300047472 Bacteria 5410
243 Ga0495593_0000122 3300047673 Bacteria 37761
244 Ga0495593_0001202 3300047673 Bacteria 15131
245 Ga0495602_0077322 3300048088 Bacteria 2816
246 Ga0495614_0000175 3300048089 Bacteria 23725
247 Ga0495614_0001212 3300048089 Bacteria 11104
248 Ga0495614_0007062 3300048089 Bacteria 5013
249 Ga0495614_0014549 3300048089 Bacteria 3441
250 Ga0495626_0025248 3300048091 Bacteria 2907
251 Ga0496104_0082517 3300048907 Bacteria 3065
252 Ga0496106_0007417 3300048909 Bacteria 8106
253 Ga0496107_0142650 3300048910 Bacteria 1771
254 Ga0496108_0000053 3300048911 Bacteria 125641
255 Ga0496109_0031903 3300048912 Bacteria 4732
256 Ga0496110_0089551 3300048913 Bacteria 2750
257 Ga0496111_0142144 3300048914 Bacteria 1778
258 Ga0496112_0021197 3300048915 Bacteria 6176
259 Ga0496114_0033438 3300048917 Bacteria 4236
260 Ga0495678_025114 3300049459 Bacteria 2563
261 Ga0501031_0012391 3300049568 Bacteria 5560
262 Ga0501031_0052819 3300049568 Bacteria 2648
263 Ga0501032_0001273 3300049569 Bacteria 20198
264 Ga0501032_0017711 3300049569 Bacteria 5000
265 Ga0501033_0001008 3300049570 Bacteria 25590
266 Ga0501033_0005490 3300049570 Bacteria 10037
267 Ga0501034_0002464 3300049571 Bacteria 22311
268 Ga0501034_0003262 3300049571 Bacteria 18536
269 Ga0501036_0000728 3300049572 Bacteria 24326
270 Ga0501036_0002349 3300049572 Bacteria 14793
271 Ga0501036_0014551 3300049572 Bacteria 6551
272 Ga0501036_0018853 3300049572 Bacteria 5788
273 Ga0501037_0001790 3300049573 Bacteria 15605
274 Ga0501037_0002775 3300049573 Bacteria 12677
275 Ga0501037_0026483 3300049573 Bacteria 4286
276 Ga0501037_0097107 3300049573 Bacteria 2129
277 Ga0501038_0010430 3300049574 Bacteria 8498
278 Ga0501038_0013127 3300049574 Bacteria 7554
279 Ga0501038_0025604 3300049574 Bacteria 5257
280 Ga0501038_0071098 3300049574 Bacteria 2952
281 Ga0501038_0085692 3300049574 Bacteria 2648
282 Ga0501039_0001589 3300049575 Bacteria 16715
283 Ga0501043_0002625 3300049579 Bacteria 15143
284 Ga0501043_0018287 3300049579 Bacteria 5495
285 Ga0501043_0024999 3300049579 Bacteria 4686
286 Ga0501046_0004818 3300049580 Bacteria 12160
287 Ga0501046_0005245 3300049580 Bacteria 11584
288 Ga0501047_0000189 3300049581 Bacteria 74827
289 Ga0501047_0001311 3300049581 Bacteria 24485
290 Ga0501047_0012562 3300049581 Bacteria 8020
291 Ga0501047_0015573 3300049581 Bacteria 7245
292 Ga0501047_0045567 3300049581 Bacteria 4241
293 Ga0501047_0083653 3300049581 Bacteria 3067
294 Ga0501048_0006191 3300049582 Bacteria 9104
295 Ga0501067_0001708 3300049583 Bacteria 12086
296 Ga0501070_0001439 3300049586 Bacteria 21297
297 Ga0501070_0015233 3300049586 Bacteria 6471
298 Ga0501071_0000222 3300049587 Bacteria 26207
299 Ga0501072_0002560 3300049588 Bacteria 13625
300 Ga0501073_0009092 3300049589 Bacteria 7332
301 Ga0501074_0001766 3300049590 Bacteria 14768
302 Ga0501080_0108671 3300049742 Bacteria 2570
303 Ga0501035_0002246 3300049822 Bacteria 19123
304 Ga0501035_0005110 3300049822 Bacteria 12429
305 Ga0501035_0015512 3300049822 Bacteria 7028
306 Ga0501035_0026560 3300049822 Bacteria 5296
307 Ga0501035_0036869 3300049822 Bacteria 4430
308 Ga0501035_0081955 3300049822 Bacteria 2847
309 Ga0501044_0002142 3300049823 Bacteria 22623
310 Ga0501044_0082387 3300049823 Bacteria 3255
311 Ga0501044_0114139 3300049823 Bacteria 2707
312 nmdc:mga0yw44_32629_c1 3300050492 Bacteria 3036
313 nmdc:mga06z11_400_c1 3300050494 Bacteria 16335
314 nmdc:mga04h51_5510_c1 3300050495 Bacteria 3230
315 nmdc:mga06r32_97052_c1 3300050510 Bacteria 2887
316 nmdc:mga0n895_297541_c1 3300050512 Bacteria 1636
317 Ga0500644_0002964 3300053088 Bacteria 4210
318 Ga0500583_0050194 3300053092 Bacteria 1934
319 Ga0500640_048559 3300053095 Bacteria 1860
320 Ga0500660_029561 3300053100 Bacteria 2868
321 Ga0500569_000741 3300053109 Bacteria 5696
322 Ga0500569_004852 3300053109 Bacteria 2858
323 Ga0500628_007037 3300053129 Bacteria 1917
324 Ga0500658_0010003 3300053134 Bacteria 3499
325 Ga0500658_0011156 3300053134 Bacteria 3308
326 Ga0500573_0075467 3300053140 Bacteria 1919
327 Ga0500616_0008022 3300053153 Bacteria 6613
328 Ga0500633_0004287 3300053160 Bacteria 3251
329 Ga0500634_0020709 3300053161 Bacteria 3559
330 Ga0500656_000230 3300053732 Bacteria 3711
331 Ga0501084_0028659 3300054114 Bacteria 4655
332 Ga0501082_0002516 3300060353 Bacteria 16044
333 Ga0466962_0000590 3300061719 Bacteria 16000
334 Ga0466962_0002632 3300061719 Bacteria 8530
335 Ga0530510_0036876 3300061734 Bacteria 3523
336 3006322166 3006321560 Bacteria 8247479
337 2501940608 2501939600 Bacteria 6907073
338 2547407658 2547132111 Bacteria 8013147
339 2554258868 2554235005 Bacteria 6457341
340 2585299754 2582581312 Bacteria 7308206
341 2585306937 2582581313 Bacteria 10042643
342 2585317940 2582581314 Bacteria 11452267
343 2616694399 2616644814 Bacteria 11555299
344 2616899538 2616644941 Bacteria 8510691
345 2616901228 2616644941 Bacteria 8510691
346 2643759413 2643221548 Bacteria 8053412
347 2643897486 2643221578 Bacteria 9213798
348 2643945041 2643221587 Bacteria 7586415
349 2644013617 2643221601 Bacteria 7493239
350 2644018345 2643221601 Bacteria 7493239
351 2644177657 2643221631 Bacteria 8168043
352 2644178751 2643221631 Bacteria 8168043
353 2644265425 2643221647 Bacteria 10741251
354 2644387276 2643221670 Bacteria 6497041
355 2644408630 2643221673 Bacteria 9196637
356 2644431940 2643221677 Bacteria 7584031
357 2644435895 2643221678 Bacteria 9540101
358 2644463171 2643221682 Bacteria 6743283
359 2644632226 2643221714 Bacteria 9015452
360 2676494720 2675903060 Bacteria 10051191
361 2753076842 2751185734 Bacteria 8863695
362 2774392198 2773857762 Bacteria 5971770
363 2784587508 2784132148 Bacteria 8627943
364 2785344837 2784746763 Bacteria 9783172
365 2785368052 2784746768 Bacteria 10036182
366 2786669103 2786546132 Bacteria 10419719
367 2804844526 2802429296 Bacteria 7227771
368 2808840705 2808606359 Bacteria 9866990
369 2808846314 2808606359 Bacteria 9866990
370 2808919301 2808606375 Bacteria 9466072
371 2809195998 2808606439 Bacteria 5952208
372 2809231066 2808606448 Bacteria 8656184
373 2811847715 2808606982 Bacteria 7791042
374 2812351865 2811994878 Bacteria 5992952
375 2812359476 2811994879 Bacteria 9313447
376 2812481610 2811994917 Bacteria 7761064
377 2819694011 2818991463 Bacteria 7948711
378 2819743885 2818991472 Bacteria 10089953
379 2852642898 2852635781 Bacteria 8251373
380 2855688418 2855683550 Bacteria 7134265
381 2856862693 2856858025 Bacteria 7255264
382 2858874429 2858868258 Bacteria 7683772
383 2862182829 2862178590 Bacteria 8583590
384 2862288556 2862281513 Bacteria 9621493
385 2862293349 2862290372 Bacteria 7471434
386 2862385412 2862382967 Bacteria 10317375
387 2862511423 2862507626 Bacteria 9425308
388 2862582789 2862574272 Bacteria 10567477
389 2862711072 2862705112 Bacteria 6563286
390 2863406070 2863404153 Bacteria 9672205
391 2867370737 2867369537 Bacteria 6501581
392 2867374325 2867369537 Bacteria 6501581
393 2867510138 2867507094 Bacteria 6506033
394 2873152294 2873151551 Bacteria 8625867
395 2873156912 2873151551 Bacteria 8625867
396 2875393429 2875391855 Bacteria 7600475
397 2877682491 2877676314 Bacteria 9512378
398 2884695513 2884693830 Bacteria 11273186
399 2891970501 2891968417 Bacteria 5821697
400 2895436836 2895427314 Bacteria 13147766
401 2895445780 2895442618 Bacteria 11027144
402 2902585440 2902582711 Bacteria 6187705
403 2912721521 2912715099 Bacteria 9460473
404 2912725381 2912723979 Bacteria 8557534
405 2912727471 2912723979 Bacteria 8557534
406 2912759633 2912757875 Bacteria 7940295
407 2918503333 2918501144 Bacteria 8668083
408 2919468256 2919468124 Bacteria 9133025
409 2935395767 2935390628 Bacteria 7043367
410 2935395771 2935390628 Bacteria 7043367
411 2946051263 2946045630 Bacteria 8527308
412 2946066443 2946064051 Bacteria 8957905
413 2946074693 2946072368 Bacteria 8999607
414 2947230936 2947224130 Bacteria 9938529
415 2954004224 2954002825 Bacteria 9173742
416 2954387694 2954380949 Bacteria 10050426
417 2954675402 2954673503 Bacteria 9685905
418 2954688730 2954682443 Bacteria 9862841
419 2954698506 2954691527 Bacteria 10720516
420 2954703718 2954701450 Bacteria 10834262
421 2954717478 2954711539 Bacteria 10867210
422 2954727441 2954721474 Bacteria 10456478
423 2954734359 2954731030 Bacteria 10243860
424 2954746337 2954740390 Bacteria 10229294
425 2954753242 2954749733 Bacteria 10366972
426 2954765451 2954759201 Bacteria 9358192
427 2966603631 2966598605 Bacteria 7676064
428 2990049493 2990044586 Bacteria 6603797
429 2990062554 2990059506 Bacteria 9321252
430 2990090757 2990088156 Bacteria 6657676
431 2995470946 2995463766 Bacteria 8577691
432 2996223198 2996221748 Bacteria 6799777
433 2997456135 2997451912 Bacteria 8492419
434 3006491558 3006486233 Bacteria 8157040
435 3006495650 3006493962 Bacteria 8825450
436 649815527 649633069 Bacteria 6962533
437 8008489427 8008485437 Bacteria 7198341
438 8008562220 8008558824 Bacteria 10610750
439 8008579961 8008574985 Bacteria 7815457
440 8023628597 8023623736 Bacteria 8593882
441 8025417115 8025413630 Bacteria 7014048
442 8025528997 8025524527 Bacteria 7197316
443 8025533638 8025530807 Bacteria 8495698
444 8048408936 8048406513 Bacteria 8936924
445 8054167676 8054160619 Bacteria 7783213
446 8054167680 8054160619 Bacteria 7783213
447 8056836552 8056829672 Bacteria 9045328
448 JGI25406J46586_10002539
449 Ga0006562J51391_1042986
450 Ga0070683_100117505
451 Ga0070661_100113625
452 Ga0070667_100073277
453 Ga0070714_100005628
454 Ga0070714_100083106
455 Ga0070711_100030041
456 Ga0070711_100081213
457 Ga0070663_100049855
458 Ga0070698_100013333
459 Ga0070684_100044499
460 Ga0070684_100200210
461 Ga0068855_100018712
462 Ga0081455_10000854
463 Ga0081455_10007258
464 Ga0081455_10008313
465 Ga0081455_10044152
466 Ga0081540_1005598
467 Ga0081539_10000143
468 Ga0070717_10023442
469 Ga0075365_10003472
470 Ga0075368_10013332
471 Ga0075363_100005155
472 Ga0075367_10000362
473 Ga0075431_100048054
474 Ga0075431_100148095
475 Ga0105251_10012393
476 Ga0105241_10000454
477 Ga0105249_10056517
478 Ga0182008_10002474
479 Ga0182007_10000440
480 Ga0183367_1009
481 Ga0213875_10000217
482 Ga0213875_10000499
483 Ga0209758_1003317
484 Ga0207426_1001688
485 Ga0207426_1003153
486 Ga0207671_10002071
487 Ga0207663_10039581
488 Ga0207700_10019602
489 Ga0207664_10021545
490 Ga0207664_10079508
491 Ga0207712_10012387
492 Ga0207678_10006738
493 Ga0207678_10033566
494 Ga0207675_100126714
495 Ga0209813_10000738
496 Ga0268266_10134687
497 Ga0307517_10011593
498 Ga0307517_10019267
499 Ga0307517_10030767
500 Ga0307515_10001805
501 Ga0307515_10002305
502 Ga0307515_10031226
503 Ga0307511_10001658
504 Ga0307511_10047126
505 Ga0307512_10001551
506 Ga0307512_10001914
507 Ga0307513_10007142
508 Ga0307513_10008019
509 Ga0307513_10016722
510 Ga0307513_10017018
511 Ga0307509_10010961
512 Ga0307509_10054986
513 Ga0307509_10082205
514 Ga0307508_10003492
515 Ga0307508_10004202
516 Ga0307508_10027491
517 Ga0307514_10016585
518 Ga0307514_10029111
519 Ga0307516_10000105
520 Ga0307516_10005435
521 Ga0307516_10011499
522 Ga0307516_10027809
523 Ga0307507_10009112
524 Ga0307507_10010258
525 Ga0307507_10022864
526 Ga0307510_10007913
527 Ga0307510_10019255
528 Ga0307510_10032686
529 Ga0373925_0000245
530 Ga0395900_0029155
531 Ga0395898_0006885
532 Ga0436364_0062912
533 Ga0436364_0232843
534 Ga0395901_0159084
535 Ga0439448_0003972
536 Ga0439449_0000981
537 Ga0439449_0003337
538 Ga0439457_009350
539 Ga0439462_0003390
540 Ga0450899_001235
541 Ga0450903_000088
542 Ga0450906_006685
543 Ga0439458_0000045
544 Ga0466969_0004896
545 Ga0466972_0002464
546 Ga0466972_0007548
547 Ga0466965_0009467
548 Ga0466965_0022175
549 Ga0466966_0003972
550 Ga0466966_0020516
551 Ga0466961_0001652
552 Ga0466961_0034002
553 Ga0466961_0034249
554 Ga0466963_0000121
555 Ga0466963_0000769
556 Ga0466971_0000989
557 Ga0466971_0019611
558 Ga0466968_0059200
559 Ga0466970_0000251
560 Ga0466970_0000404
561 Ga0466957_0002075
562 Ga0466960_0002562
563 Ga0466959_0000608
564 Ga0466959_0035602
565 Ga0466958_0005492
566 Ga0466967_0013069
567 Ga0466967_0034222
568 Ga0466967_0082932
569 Ga0495617_005583
570 Ga0495627_007050
571 Ga0495592_0003112
572 Ga0495592_0007007
573 Ga0495603_0001436
574 Ga0495603_0005179
575 Ga0495603_0009488
576 Ga0495603_0085677
577 Ga0495629_0001223
578 Ga0495629_0001589
579 Ga0495629_0001656
580 Ga0495629_0002447
581 Ga0495629_0002909
582 Ga0495629_0029783
583 Ga0495629_0043904
584 Ga0495629_0119949
585 Ga0495638_0010143
586 Ga0495638_0074142
587 Ga0495651_0002785
588 Ga0495651_0003768
589 Ga0495651_0016511
590 Ga0495653_0008946
591 Ga0495653_0036080
592 Ga0495662_0001544
593 Ga0495664_0000762
594 Ga0495664_0010573
595 Ga0495585_0022307
596 Ga0495585_0035126
597 Ga0495594_0000274
598 Ga0495594_0018413
599 Ga0495607_0008099
600 Ga0495610_0027176
601 Ga0495616_0005017
602 Ga0495618_0094248
603 Ga0495628_0027168
604 Ga0495630_0031441
605 Ga0495631_0005247
606 Ga0495632_0035229
607 Ga0495637_0024243
608 Ga0495643_0002315
609 Ga0495666_0002230
610 Ga0495666_0002887
611 Ga0495666_0073396
612 Ga0495652_0015681
613 Ga0495652_0080649
614 Ga0495654_0021899
615 Ga0495640_0003185
616 Ga0495640_0007518
617 Ga0495640_0008447
618 Ga0495587_0002910
619 Ga0495587_0008023
620 Ga0495609_0031682
621 Ga0495609_0040945
622 Ga0495645_0008241
623 Ga0495645_0014076
624 Ga0495622_0003147
625 Ga0495622_0008556
626 Ga0495633_0013912
627 Ga0495634_0001190
628 Ga0495634_0003683
629 Ga0495611_0006283
630 Ga0495611_0011635
631 Ga0495625_0006146
632 Ga0495625_0027453
633 Ga0495625_0076374
634 Ga0495635_0012526
635 Ga0495635_0014513
636 Ga0495661_0026312
637 Ga0495588_0004085
638 Ga0495588_0012990
639 Ga0495588_0046376
640 Ga0495657_0000231
641 Ga0495657_0012562
642 Ga0495623_0034859
643 Ga0495623_0070446
644 Ga0495646_0000166
645 Ga0495646_0000359
646 Ga0495646_0002160
647 Ga0495613_0000266
648 Ga0495613_0003178
649 Ga0495613_0003819
650 Ga0495613_0009321
651 Ga0495670_0020831
652 Ga0495670_0023560
653 Ga0495671_0022822
654 Ga0495589_0049825
655 Ga0495600_0038064
656 Ga0495660_0043922
657 Ga0495660_0055016
658 Ga0495581_0001673
659 Ga0495581_0003257
660 Ga0495604_0000320
661 Ga0495604_0002297
662 Ga0495604_0010743
663 Ga0495604_0039654
664 Ga0495604_0058367
665 Ga0495636_0000479
666 Ga0495676_0001221
667 Ga0495676_0001923
668 Ga0495676_0004646
669 Ga0495676_0004977
670 Ga0495676_0010741
671 Ga0495676_0022349
672 Ga0495680_0060303
673 Ga0495683_0042174
674 Ga0495687_001600
675 Ga0495687_002378
676 Ga0495687_031993
677 Ga0495675_0016051
678 Ga0495675_0061699
679 Ga0495675_0072946
680 Ga0495675_0081407
681 Ga0495685_000716
682 Ga0495685_002101
683 Ga0495685_003589
684 Ga0495681_0001810
685 Ga0495681_0009995
686 Ga0495681_0059687
687 Ga0495684_0025537
688 Ga0495686_0006017
689 Ga0495686_0014560
690 Ga0495593_0000122
691 Ga0495593_0001202
692 Ga0495602_0077322
693 Ga0495614_0000175
694 Ga0495614_0001212
695 Ga0495614_0007062
696 Ga0495614_0014549
697 Ga0495626_0025248
698 Ga0496104_0082517
699 Ga0496106_0007417
700 Ga0496107_0142650
701 Ga0496108_0000053
702 Ga0496109_0031903
703 Ga0496110_0089551
704 Ga0496111_0142144
705 Ga0496112_0021197
706 Ga0496114_0033438
707 Ga0495678_025114
708 Ga0501031_0012391
709 Ga0501031_0052819
710 Ga0501032_0001273
711 Ga0501032_0017711
712 Ga0501033_0001008
713 Ga0501033_0005490
714 Ga0501034_0002464
715 Ga0501034_0003262
716 Ga0501036_0000728
717 Ga0501036_0002349
718 Ga0501036_0014551
719 Ga0501036_0018853
720 Ga0501037_0001790
721 Ga0501037_0002775
722 Ga0501037_0026483
723 Ga0501037_0097107
724 Ga0501038_0010430
725 Ga0501038_0013127
726 Ga0501038_0025604
727 Ga0501038_0071098
728 Ga0501038_0085692
729 Ga0501039_0001589
730 Ga0501043_0002625
731 Ga0501043_0018287
732 Ga0501043_0024999
733 Ga0501046_0004818
734 Ga0501046_0005245
735 Ga0501047_0000189
736 Ga0501047_0001311
737 Ga0501047_0012562
738 Ga0501047_0015573
739 Ga0501047_0045567
740 Ga0501047_0083653
741 Ga0501048_0006191
742 Ga0501067_0001708
743 Ga0501070_0001439
744 Ga0501070_0015233
745 Ga0501071_0000222
746 Ga0501072_0002560
747 Ga0501073_0009092
748 Ga0501074_0001766
749 Ga0501080_0108671
750 Ga0501035_0002246
751 Ga0501035_0005110
752 Ga0501035_0015512
753 Ga0501035_0026560
754 Ga0501035_0036869
755 Ga0501035_0081955
756 Ga0501044_0002142
757 Ga0501044_0082387
758 Ga0501044_0114139
759 nmdc:mga0yw44_32629_c1
760 nmdc:mga06z11_400_c1
761 nmdc:mga04h51_5510_c1
762 nmdc:mga06r32_97052_c1
763 nmdc:mga0n895_297541_c1
764 Ga0500644_0002964
765 Ga0500583_0050194
766 Ga0500640_048559
767 Ga0500660_029561
768 Ga0500569_000741
769 Ga0500569_004852
770 Ga0500628_007037
771 Ga0500658_0010003
772 Ga0500658_0011156
773 Ga0500573_0075467
774 Ga0500616_0008022
775 Ga0500633_0004287
776 Ga0500634_0020709
777 Ga0500656_000230
778 Ga0501084_0028659
779 Ga0501082_0002516
780 Ga0466962_0000590
781 Ga0466962_0002632
782 Ga0530510_0036876
783 3006322166
784 2501940608
785 2547407658
786 2554258868
787 2585299754
788 2585306937
789 2585317940
790 2616694399
791 2616899538
792 2616901228
793 2643759413
794 2643897486
795 2643945041
796 2644013617
797 2644018345
798 2644177657
799 2644178751
800 2644265425
801 2644387276
802 2644408630
803 2644431940
804 2644435895
805 2644463171
806 2644632226
807 2676494720
808 2753076842
809 2774392198
810 2784587508
811 2785344837
812 2785368052
813 2786669103
814 2804844526
815 2808840705
816 2808846314
817 2808919301
818 2809195998
819 2809231066
820 2811847715
821 2812351865
822 2812359476
823 2812481610
824 2819694011
825 2819743885
826 2852642898
827 2855688418
828 2856862693
829 2858874429
830 2862182829
831 2862288556
832 2862293349
833 2862385412
834 2862511423
835 2862582789
836 2862711072
837 2863406070
838 2867370737
839 2867374325
840 2867510138
841 2873152294
842 2873156912
843 2875393429
844 2877682491
845 2884695513
846 2891970501
847 2895436836
848 2895445780
849 2902585440
850 2912721521
851 2912725381
852 2912727471
853 2912759633
854 2918503333
855 2919468256
856 2935395767
857 2935395771
858 2946051263
859 2946066443
860 2946074693
861 2947230936
862 2954004224
863 2954387694
864 2954675402
865 2954688730
866 2954698506
867 2954703718
868 2954717478
869 2954727441
870 2954734359
871 2954746337
872 2954753242
873 2954765451
874 2966603631
875 2990049493
876 2990062554
877 2990090757
878 2995470946
879 2996223198
880 2997456135
881 3006491558
882 3006495650
883 649815527
884 8008489427
885 8008562220
886 8008579961
887 8023628597
888 8025417115
889 8025528997
890 8025533638
891 8048408936
892 8054167676
893 8054167680
894 8056836552

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11941

DUF3459

Domain of unknown function (DUF3459)

476

571

0.89

PF00128

Alpha-amylase

Alpha amylase, catalytic domain

43

407

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7voh-assembly2.cif.gz_B the a-glucosidase qsgh13 from qipengyuania seohaensis 0.8771 7 535
7voh-assembly1.cif.gz_A the a-glucosidase qsgh13 from qipengyuania seohaensis 0.8736 7 535
7voh-assembly2.cif.gz_B the a-glucosidase qsgh13 from qipengyuania seohaensis 0.8722 7 535
7voh-assembly1.cif.gz_A the a-glucosidase qsgh13 from qipengyuania seohaensis 0.8687 7 535
8ibk-assembly1.cif.gz_A crystal structure of bacillus sp. ahu2216 gh13_31 alpha-glucosidase e256q/n258g in complex with maltotriose 0.8674 6 537
ID Description Score Start End Superfamily
af_P0CW41_2_118_3.30.750.90 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.9679 3 110 3.30.750.90
af_O53198_131_208_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9181 107 176 3.20.20.80
af_A0A4P1SA55_34_491_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8937 7 454 3.20.20.80
af_P0CW41_2_118_3.30.750.90 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.8867 3 110 3.30.750.90
af_A0A4P1SA55_34_491_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8727 7 454 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A3S3T530-F1-model_v4 deleted 0.9984 11 100
AF-A0A2S6W9V7-F1-model_v4 Trehalose synthase 0.9875 11 100 GO:0005975
AF-A0A7V9JJG7-F1-model_v4 Glycosyl hydrolase family 13 catalytic domain-containing protein 0.9874 4 114 GO:0005975
AF-A0A1L5KZY7-F1-model_v4 Trehalose_treC 0.9874 3 101 GO:0004556
GO:0009313
AF-A0A060CC02-F1-model_v4 Alpha-amylase 0.9831 38 200 GO:0004556
GO:0009313

Map