F446021

General Info

Members Datasets Scaffolds Average Seq Length
447 209 894 301

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0003162|Ga0495668_0003162_7061_8086
Length 341
Sequence LSCFAPLVVSFSFAFVRYGRWHRFYITGADIKYEFSYLTMIKTPPYLQPGDTIGITCPAGYMAAAKAMTCIDTLQEWGYPVKVGKTLGSDSDTYFSGTDEERLRDFQEMLDDDDVKAILCGRGGYGMGRIIDQIDFSKFSKNPKWIIGFSDITVLHSHLYSNYKIASLHAPMAAAFNDEGYDNIYVQSLKAALEGKKARYQCEVHEFNQKGEAVGELVGGNLSLLAHLVGTPSDIKTKGRILFLEDVGEYLYNVDRMLYQLKRAGKLDKLAGLIIGGFTDNKDTERPFGKNVYEIIHDIVKDYDYPICFNFPVSHEKQNYALKVGEGYKLKVGKTKVMLEE

Samples

Sample ID Description Type Environment
1 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
140 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
147 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
148 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
149 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
150 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
151 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
152 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
168 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
176 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
177 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
178 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
179 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
180 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
181 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
182 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
183 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
184 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
185 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
186 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
187 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
188 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
189 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
190 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
191 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
201 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
202 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
203 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
204 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
205 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
206 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
207 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
208 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
209 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.68
Nodule 0
Rhizoplane 0.45
Rhizosphere 93.51
Stem 0
Stem Tuber 0
Unclassified 11.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495668_0003162 3300046616 Bacteria 12690
2 rootH1_10017247 3300003316 Bacteria 2654
3 rootH1_10043460 3300003316 Bacteria 9314
4 rootH1_10186377 3300003316 Bacteria 1418
5 rootH2_10253432 3300003320 Bacteria 2827
6 rootL2_10093489 3300003322 Bacteria 1168
7 rootH1_10023435 3300003323 Bacteria 23065
8 Ga0065707_10168671 3300005295 Unclassified 1500
9 Ga0070676_10009136 3300005328 Bacteria 5363
10 Ga0070683_100002310 3300005329 Bacteria 15119
11 Ga0070683_100031522 3300005329 Bacteria 4821
12 Ga0070683_100192653 3300005329 Bacteria 1936
13 Ga0070690_100006658 3300005330 Bacteria 6563
14 Ga0070690_100098426 3300005330 Bacteria 1936
15 Ga0070690_100339566 3300005330 Bacteria 1087
16 Ga0070670_100019297 3300005331 Bacteria 5850
17 Ga0070670_100033113 3300005331 Unclassified 4452
18 Ga0070670_100066547 3300005331 Bacteria 3092
19 Ga0070670_100070327 3300005331 Bacteria 3004
20 Ga0070670_100093916 3300005331 Unclassified 2580
21 Ga0070677_10019677 3300005333 Bacteria 2449
22 Ga0068869_100003774 3300005334 Bacteria 9330
23 Ga0068869_100007130 3300005334 Bacteria 7121
24 Ga0068869_100039875 3300005334 Bacteria 3355
25 Ga0068869_100041995 3300005334 Bacteria 3277
26 Ga0068869_100045073 3300005334 Unclassified 3173
27 Ga0070666_10006049 3300005335 Bacteria 7434
28 Ga0070666_10015500 3300005335 Bacteria 4863
29 Ga0070666_10079539 3300005335 Bacteria 2239
30 Ga0070666_10126145 3300005335 Bacteria 1777
31 Ga0068868_100004509 3300005338 Bacteria 9769
32 Ga0068868_100008622 3300005338 Bacteria 7302
33 Ga0068868_100046968 3300005338 Bacteria 3380
34 Ga0068868_100078270 3300005338 Bacteria 2647
35 Ga0068868_100338670 3300005338 Bacteria 1286
36 Ga0070689_100115655 3300005340 Bacteria 2138
37 Ga0070689_100125394 3300005340 Unclassified 2054
38 Ga0070661_100013620 3300005344 Bacteria 5710
39 Ga0070661_100063669 3300005344 Unclassified 2709
40 Ga0070661_100106954 3300005344 Bacteria 2086
41 Ga0070668_100052414 3300005347 Bacteria 3144
42 Ga0070668_100161025 3300005347 Bacteria 1821
43 Ga0070669_100039357 3300005353 Bacteria 3436
44 Ga0070669_100398099 3300005353 Bacteria 1126
45 Ga0070675_100166261 3300005354 Bacteria 1900
46 Ga0070671_100029980 3300005355 Bacteria 4488
47 Ga0070671_100049154 3300005355 Bacteria 3509
48 Ga0070671_100061170 3300005355 Bacteria 3136
49 Ga0070671_100079377 3300005355 Unclassified 2743
50 Ga0070671_100129529 3300005355 Bacteria 2125
51 Ga0070671_100138739 3300005355 Bacteria 2051
52 Ga0070673_100041993 3300005364 Bacteria 3523
53 Ga0070673_100180546 3300005364 Bacteria 1806
54 Ga0070673_100311578 3300005364 Bacteria 1388
55 Ga0070688_100027561 3300005365 Bacteria 3384
56 Ga0070688_100060215 3300005365 Bacteria 2397
57 Ga0070659_100001755 3300005366 Bacteria 15575
58 Ga0070659_100014364 3300005366 Bacteria 5916
59 Ga0070659_100201087 3300005366 Bacteria 1640
60 Ga0070667_100006513 3300005367 Bacteria 9709
61 Ga0070667_100008663 3300005367 Bacteria 8429
62 Ga0070667_100108427 3300005367 Bacteria 2406
63 Ga0070667_100116814 3300005367 Unclassified 2317
64 Ga0070667_100143785 3300005367 Bacteria 2091
65 Ga0070667_100261550 3300005367 Bacteria 1549
66 Ga0070667_100661029 3300005367 Unclassified 965
67 Ga0070663_100493014 3300005455 Unclassified 1016
68 Ga0070678_100006566 3300005456 Bacteria 6836
69 Ga0070662_100024952 3300005457 Bacteria 4124
70 Ga0070662_100033185 3300005457 Bacteria 3633
71 Ga0070662_100043290 3300005457 Bacteria 3220
72 Ga0070662_100077025 3300005457 Bacteria 2474
73 Ga0070662_100140314 3300005457 Bacteria 1872
74 Ga0070681_10081990 3300005458 Bacteria 3181
75 Ga0068867_100010470 3300005459 Bacteria 6544
76 Ga0068867_100276450 3300005459 Bacteria 1375
77 Ga0068867_100478111 3300005459 Bacteria 1067
78 Ga0070685_10155049 3300005466 Bacteria 1455
79 Ga0070684_100002874 3300005535 Bacteria 12801
80 Ga0070684_100007093 3300005535 Bacteria 8709
81 Ga0070684_100018210 3300005535 Bacteria 5782
82 Ga0070684_100141108 3300005535 Unclassified 2179
83 Ga0068853_100001293 3300005539 Bacteria 17972
84 Ga0068853_100001810 3300005539 Bacteria 15718
85 Ga0068853_100078283 3300005539 Unclassified 2889
86 Ga0070672_100016237 3300005543 Bacteria 5325
87 Ga0070672_100039139 3300005543 Unclassified 3630
88 Ga0070672_100052146 3300005543 Bacteria 3193
89 Ga0070693_100142951 3300005547 Bacteria 1508
90 Ga0070665_100000018 3300005548 Bacteria 434118
91 Ga0070665_100056090 3300005548 Bacteria 3950
92 Ga0070664_100011609 3300005564 Bacteria 7146
93 Ga0070664_100053719 3300005564 Unclassified 3416
94 Ga0068857_100003231 3300005577 Bacteria 13531
95 Ga0068857_100003537 3300005577 Bacteria 13060
96 Ga0068857_100031441 3300005577 Bacteria 4691
97 Ga0068857_100175494 3300005577 Bacteria 1949
98 Ga0068854_100003818 3300005578 Bacteria 9429
99 Ga0068854_100116043 3300005578 Bacteria 2026
100 Ga0068854_100119669 3300005578 Bacteria 1997
101 Ga0068854_100146542 3300005578 Bacteria 1817
102 Ga0068856_100057285 3300005614 Bacteria 3847
103 Ga0070702_100175152 3300005615 Bacteria 1399
104 Ga0068852_100000424 3300005616 Bacteria 28108
105 Ga0068852_100002379 3300005616 Bacteria 12954
106 Ga0068852_100159367 3300005616 Bacteria 2106
107 Ga0068852_100175363 3300005616 Bacteria 2012
108 Ga0068852_100353550 3300005616 Bacteria 1435
109 Ga0068852_100441739 3300005616 Bacteria 1286
110 Ga0068859_100000588 3300005617 Bacteria 36240
111 Ga0068859_100008683 3300005617 Bacteria 10273
112 Ga0068859_100034496 3300005617 Bacteria 5078
113 Ga0068864_100028197 3300005618 Bacteria 4744
114 Ga0068864_100029240 3300005618 Bacteria 4664
115 Ga0068866_10024241 3300005718 Bacteria 2833
116 Ga0068851_10030284 3300005834 Bacteria 2683
117 Ga0068851_10053472 3300005834 Unclassified 2056
118 Ga0068851_10156043 3300005834 Bacteria 1251
119 Ga0068870_10005475 3300005840 Bacteria 5549
120 Ga0068863_100002277 3300005841 Bacteria 19080
121 Ga0068858_100039304 3300005842 Bacteria 4388
122 Ga0068860_100006770 3300005843 Bacteria 11492
123 Ga0068860_100012561 3300005843 Bacteria 8338
124 Ga0068860_100023111 3300005843 Bacteria 6012
125 Ga0068860_100074346 3300005843 Bacteria 3231
126 Ga0081539_10020735 3300005985 Bacteria 4425
127 Ga0097621_100010566 3300006237 Bacteria 6763
128 Ga0097621_100144655 3300006237 Bacteria 2034
129 Ga0068871_100013178 3300006358 Bacteria 6131
130 Ga0068871_100027554 3300006358 Unclassified 4446
131 Ga0068871_100047988 3300006358 Bacteria 3445
132 Ga0075428_100000697 3300006844 Bacteria 34709
133 Ga0075430_100045080 3300006846 Bacteria 3726
134 Ga0075431_100171233 3300006847 Bacteria 2231
135 Ga0075434_100430710 3300006871 Bacteria 1340
136 Ga0075429_100031651 3300006880 Bacteria 4597
137 Ga0075429_100066294 3300006880 Unclassified 3143
138 Ga0068865_100039784 3300006881 Bacteria 3191
139 Ga0068865_100127016 3300006881 Unclassified 1905
140 Ga0068865_100206940 3300006881 Bacteria 1526
141 Ga0068865_100256538 3300006881 Bacteria 1382
142 Ga0097620_100000588 3300006931 Bacteria 36240
143 Ga0097620_100008683 3300006931 Bacteria 10273
144 Ga0097620_100034496 3300006931 Bacteria 5078
145 Ga0105240_10000431 3300009093 Bacteria 77497
146 Ga0105240_10001434 3300009093 Bacteria 40792
147 Ga0105240_10004355 3300009093 Bacteria 21610
148 Ga0105240_10006516 3300009093 Bacteria 17139
149 Ga0105240_10020767 3300009093 Bacteria 8749
150 Ga0105240_10178605 3300009093 Bacteria 2507
151 Ga0105240_10314308 3300009093 Bacteria 1788
152 Ga0111539_10009272 3300009094 Bacteria 12434
153 Ga0105247_10021229 3300009101 Bacteria 3907
154 Ga0105247_10068130 3300009101 Unclassified 2219
155 Ga0114129_10002037 3300009147 Bacteria 27713
156 Ga0105241_10002146 3300009174 Bacteria 14869
157 Ga0105241_10007371 3300009174 Bacteria 8093
158 Ga0105241_10030710 3300009174 Bacteria 4018
159 Ga0105241_10106245 3300009174 Bacteria 2240
160 Ga0105242_10133602 3300009176 Bacteria 2145
161 Ga0105248_10434333 3300009177 Bacteria 1479
162 Ga0105237_10002049 3300009545 Bacteria 25638
163 Ga0105237_10009667 3300009545 Bacteria 10322
164 Ga0105237_10013246 3300009545 Bacteria 8653
165 Ga0105237_10040303 3300009545 Bacteria 4711
166 Ga0105237_10057280 3300009545 Bacteria 3900
167 Ga0105238_10001088 3300009551 Bacteria 27427
168 Ga0105238_10013492 3300009551 Bacteria 8249
169 Ga0105238_10028644 3300009551 Bacteria 5673
170 Ga0105249_10002214 3300009553 Bacteria 16849
171 Ga0105249_10004787 3300009553 Bacteria 11686
172 Ga0105249_10085483 3300009553 Unclassified 2940
173 Ga0105249_10177243 3300009553 Bacteria 2071
174 Ga0105249_10305839 3300009553 Bacteria 1596
175 Ga0105239_10002512 3300010375 Bacteria 23336
176 Ga0105239_10024455 3300010375 Bacteria 6655
177 Ga0105239_10463319 3300010375 Unclassified 1439
178 Ga0105246_10018612 3300011119 Bacteria 4429
179 Ga0157373_10025384 3300013100 Bacteria 4286
180 Ga0157373_10246414 3300013100 Bacteria 1263
181 Ga0157371_10026504 3300013102 Bacteria 4213
182 Ga0157371_10064551 3300013102 Bacteria 2594
183 Ga0157370_10024877 3300013104 Bacteria 5928
184 Ga0157370_10266399 3300013104 Bacteria 1583
185 Ga0157369_10017716 3300013105 Bacteria 7999
186 Ga0157369_10288063 3300013105 Bacteria 1710
187 Ga0157374_10019930 3300013296 Bacteria 5945
188 Ga0157374_10025142 3300013296 Bacteria 5343
189 Ga0157374_10025814 3300013296 Bacteria 5281
190 Ga0157374_10028722 3300013296 Bacteria 5027
191 Ga0157374_10029504 3300013296 Bacteria 4969
192 Ga0157374_10051285 3300013296 Bacteria 3839
193 Ga0157374_10122966 3300013296 Bacteria 2506
194 Ga0157374_10194301 3300013296 Bacteria 1986
195 Ga0157378_10003494 3300013297 Bacteria 13950
196 Ga0157378_10004784 3300013297 Bacteria 11864
197 Ga0157378_10087731 3300013297 Bacteria 2822
198 Ga0157378_10106649 3300013297 Bacteria 2563
199 Ga0157378_10244792 3300013297 Bacteria 1714
200 Ga0163162_10015360 3300013306 Bacteria 7482
201 Ga0163162_10016512 3300013306 Bacteria 7214
202 Ga0163162_10064244 3300013306 Unclassified 3715
203 Ga0163162_10273268 3300013306 Bacteria 1822
204 Ga0163162_10371342 3300013306 Bacteria 1563
205 Ga0157372_10000294 3300013307 Bacteria 55599
206 Ga0157372_10116950 3300013307 Bacteria 3057
207 Ga0157372_10352097 3300013307 Unclassified 1716
208 Ga0157372_10411581 3300013307 Bacteria 1576
209 Ga0157372_10759442 3300013307 Bacteria 1127
210 Ga0157372_10812205 3300013307 Bacteria 1086
211 Ga0157375_10041044 3300013308 Bacteria 4466
212 Ga0157375_10091404 3300013308 Bacteria 3105
213 Ga0157375_10103136 3300013308 Bacteria 2939
214 Ga0157375_10106755 3300013308 Bacteria 2892
215 Ga0157375_10106776 3300013308 Bacteria 2892
216 Ga0157375_10216555 3300013308 Bacteria 2073
217 Ga0157375_10387523 3300013308 Bacteria 1564
218 Ga0157375_10846309 3300013308 Bacteria 1061
219 Ga0163163_10003809 3300014325 Bacteria 12849
220 Ga0163163_10059845 3300014325 Bacteria 3769
221 Ga0163163_10085911 3300014325 Bacteria 3154
222 Ga0163163_10101882 3300014325 Bacteria 2894
223 Ga0163163_10311589 3300014325 Bacteria 1627
224 Ga0157377_10023604 3300014745 Bacteria 3262
225 Ga0157377_10060442 3300014745 Bacteria 2163
226 Ga0157379_10068828 3300014968 Bacteria 3165
227 Ga0157379_10112462 3300014968 Bacteria 2447
228 Ga0157379_10340056 3300014968 Bacteria 1372
229 Ga0157376_10006150 3300014969 Bacteria 8453
230 Ga0157376_10012769 3300014969 Bacteria 6246
231 Ga0157376_10352509 3300014969 Bacteria 1409
232 Ga0163161_10364258 3300017792 Bacteria 1152
233 Ga0209646_1001005 3300025246 Bacteria 8660
234 Ga0207697_10048736 3300025315 Bacteria 1748
235 Ga0207642_10026528 3300025899 Bacteria 2359
236 Ga0207710_10015749 3300025900 Bacteria 3196
237 Ga0207688_10003403 3300025901 Bacteria 8675
238 Ga0207688_10107376 3300025901 Bacteria 1617
239 Ga0207680_10165695 3300025903 Bacteria 1485
240 Ga0207680_10240217 3300025903 Bacteria 1248
241 Ga0207647_10000017 3300025904 Bacteria 129999
242 Ga0207647_10097852 3300025904 Bacteria 1744
243 Ga0207645_10008616 3300025907 Bacteria 7101
244 Ga0207643_10005893 3300025908 Bacteria 6546
245 Ga0207654_10009877 3300025911 Unclassified 4855
246 Ga0207654_10012124 3300025911 Bacteria 4411
247 Ga0207654_10052675 3300025911 Bacteria 2346
248 Ga0207707_10076152 3300025912 Unclassified 2928
249 Ga0207695_10001411 3300025913 Bacteria 40483
250 Ga0207695_10012182 3300025913 Bacteria 10335
251 Ga0207695_10041052 3300025913 Bacteria 4953
252 Ga0207695_10051044 3300025913 Bacteria 4346
253 Ga0207671_10001751 3300025914 Bacteria 24414
254 Ga0207671_10004781 3300025914 Bacteria 12765
255 Ga0207671_10006312 3300025914 Bacteria 10588
256 Ga0207671_10008658 3300025914 Bacteria 8590
257 Ga0207657_10050966 3300025919 Bacteria 3599
258 Ga0207657_10092971 3300025919 Unclassified 2513
259 Ga0207649_10005326 3300025920 Bacteria 6964
260 Ga0207649_10085194 3300025920 Unclassified 2056
261 Ga0207681_10179101 3300025923 Bacteria 1613
262 Ga0207681_10197530 3300025923 Bacteria 1543
263 Ga0207694_10015366 3300025924 Bacteria 5774
264 Ga0207694_10040357 3300025924 Unclassified 3593
265 Ga0207650_10096693 3300025925 Unclassified 2266
266 Ga0207650_10102610 3300025925 Bacteria 2204
267 Ga0207650_10124741 3300025925 Unclassified 2009
268 Ga0207650_10233841 3300025925 Bacteria 1483
269 Ga0207659_10251389 3300025926 Bacteria 1434
270 Ga0207659_10468046 3300025926 Bacteria 1063
271 Ga0207644_10058436 3300025931 Unclassified 2788
272 Ga0207644_10102331 3300025931 Bacteria 2154
273 Ga0207644_10243458 3300025931 Bacteria 1433
274 Ga0207690_10313435 3300025932 Bacteria 1231
275 Ga0207706_10038469 3300025933 Bacteria 4243
276 Ga0207706_10044952 3300025933 Bacteria 3913
277 Ga0207706_10045670 3300025933 Bacteria 3880
278 Ga0207706_10339921 3300025933 Bacteria 1306
279 Ga0207686_10144748 3300025934 Bacteria 1647
280 Ga0207670_10037929 3300025936 Bacteria 3143
281 Ga0207670_10476412 3300025936 Unclassified 1010
282 Ga0207669_10059828 3300025937 Bacteria 2332
283 Ga0207704_10017727 3300025938 Bacteria 3700
284 Ga0207691_10018396 3300025940 Bacteria 6621
285 Ga0207691_10089954 3300025940 Bacteria 2752
286 Ga0207691_10153751 3300025940 Bacteria 2022
287 Ga0207691_10287371 3300025940 Bacteria 1414
288 Ga0207689_10000800 3300025942 Bacteria 30321
289 Ga0207689_10004939 3300025942 Bacteria 12012
290 Ga0207689_10007437 3300025942 Bacteria 9601
291 Ga0207689_10030870 3300025942 Unclassified 4465
292 Ga0207689_10037407 3300025942 Bacteria 4025
293 Ga0207689_10259242 3300025942 Bacteria 1438
294 Ga0207661_10018648 3300025944 Bacteria 5157
295 Ga0207661_10561095 3300025944 Bacteria 1046
296 Ga0207679_10006127 3300025945 Bacteria 7593
297 Ga0207679_10008446 3300025945 Bacteria 6558
298 Ga0207679_10269288 3300025945 Bacteria 1456
299 Ga0207667_10000403 3300025949 Bacteria 58481
300 Ga0207651_10067572 3300025960 Bacteria 2516
301 Ga0207651_10140751 3300025960 Bacteria 1863
302 Ga0207712_10029647 3300025961 Bacteria 3673
303 Ga0207712_10089124 3300025961 Bacteria 2267
304 Ga0207668_10058001 3300025972 Bacteria 2704
305 Ga0207640_10040954 3300025981 Bacteria 2943
306 Ga0207640_10205646 3300025981 Bacteria 1495
307 Ga0207640_10476569 3300025981 Bacteria 1034
308 Ga0207658_10024979 3300025986 Bacteria 4181
309 Ga0207658_10074761 3300025986 Bacteria 2575
310 Ga0207658_10077960 3300025986 Bacteria 2530
311 Ga0207658_10143923 3300025986 Bacteria 1933
312 Ga0207658_10188363 3300025986 Bacteria 1713
313 Ga0207677_10010638 3300026023 Bacteria 5212
314 Ga0207677_10172621 3300026023 Bacteria 1692
315 Ga0207677_10442811 3300026023 Bacteria 1111
316 Ga0207703_10002892 3300026035 Bacteria 14620
317 Ga0207703_10159705 3300026035 Bacteria 1973
318 Ga0207703_10353435 3300026035 Bacteria 1353
319 Ga0207639_10018474 3300026041 Bacteria 4955
320 Ga0207639_10018765 3300026041 Bacteria 4919
321 Ga0207639_10049306 3300026041 Bacteria 3193
322 Ga0207702_10071588 3300026078 Bacteria 2986
323 Ga0207702_10213030 3300026078 Bacteria 1797
324 Ga0207641_10000133 3300026088 Bacteria 109199
325 Ga0207648_10002545 3300026089 Bacteria 19559
326 Ga0207648_10007711 3300026089 Bacteria 10527
327 Ga0207676_10012264 3300026095 Bacteria 6135
328 Ga0207676_10031997 3300026095 Bacteria 3960
329 Ga0207676_10034656 3300026095 Bacteria 3823
330 Ga0207676_10037572 3300026095 Bacteria 3691
331 Ga0207676_10437790 3300026095 Bacteria 1230
332 Ga0207674_10000600 3300026116 Bacteria 47324
333 Ga0207674_10001468 3300026116 Bacteria 30467
334 Ga0207674_10044130 3300026116 Bacteria 4594
335 Ga0207674_10059731 3300026116 Bacteria 3857
336 Ga0207674_10085723 3300026116 Unclassified 3144
337 Ga0207674_10365752 3300026116 Bacteria 1394
338 Ga0207674_10508887 3300026116 Bacteria 1163
339 Ga0207675_100200578 3300026118 Bacteria 1916
340 Ga0207675_100282359 3300026118 Bacteria 1613
341 Ga0207683_10030991 3300026121 Bacteria 4639
342 Ga0207683_10036879 3300026121 Bacteria 4257
343 Ga0207683_10101578 3300026121 Bacteria 2568
344 Ga0207683_10304601 3300026121 Bacteria 1458
345 Ga0207698_10011350 3300026142 Bacteria 5771
346 Ga0207698_10128509 3300026142 Bacteria 2161
347 Ga0207698_10914374 3300026142 Bacteria 885
348 Ga0207428_10159044 3300027907 Bacteria 1716
349 Ga0268266_10000026 3300028379 Bacteria 434485
350 Ga0268265_10068243 3300028380 Bacteria 2756
351 Ga0268264_10000015 3300028381 Bacteria 508501
352 Ga0268264_10000019 3300028381 Bacteria 488112
353 Ga0268264_10000054 3300028381 Bacteria 317048
354 Ga0268264_10011225 3300028381 Bacteria 7401
355 Ga0268264_10018928 3300028381 Bacteria 5630
356 Ga0268264_10028905 3300028381 Bacteria 4538
357 Ga0268264_10045085 3300028381 Bacteria 3660
358 Ga0268264_10229350 3300028381 Unclassified 1714
359 Ga0307517_10001171 3300028786 Bacteria 44114
360 Ga0307517_10117486 3300028786 Bacteria 1985
361 Ga0307515_10000024 3300028794 Bacteria 393119
362 Ga0307511_10000024 3300030521 Bacteria 112616
363 Ga0265313_10109441 3300031595 Bacteria 1216
364 Ga0307410_10186703 3300031852 Unclassified 1574
365 Ga0307510_10010057 3300033180 Bacteria 11243
366 Ga0373937_0343082 3300036401 Bacteria 1414
367 Ga0395898_0483126 3300037466 Unclassified 1178
368 Ga0395905_0164596 3300037471 Unclassified 2084
369 Ga0439465_0095938 3300041413 Bacteria 1019
370 Ga0451849_1071058 3300041505 Bacteria 1691
371 Ga0451853_0952037 3300041512 Bacteria 1701
372 Ga0451853_3986052 3300041512 Unclassified 2902
373 Ga0439449_0008697 3300042007 Bacteria 3854
374 Ga0439449_0010441 3300042007 Bacteria 3507
375 Ga0439457_003978 3300042014 Bacteria 3931
376 Ga0439462_0005705 3300042015 Bacteria 3076
377 Ga0466972_0000032 3300044658 Bacteria 159445
378 Ga0466970_0223244 3300044765 Unclassified 1052
379 Ga0466957_0000656 3300044842 Bacteria 17549
380 Ga0495638_0044701 3300046460 Bacteria 2789
381 Ga0495638_0044975 3300046460 Bacteria 2780
382 Ga0495606_0003604 3300046507 Bacteria 16293
383 Ga0495628_0200007 3300046516 Unclassified 1506
384 Ga0495630_0081437 3300046517 Bacteria 2443
385 Ga0495648_0001051 3300046524 Bacteria 28002
386 Ga0495667_0315988 3300046559 Unclassified 989
387 Ga0495668_0000106 3300046616 Bacteria 133476
388 Ga0495611_0002528 3300046648 Bacteria 8319
389 Ga0495672_0013705 3300047320 Bacteria 5578
390 Ga0495687_000031 3300047443 Bacteria 274659
391 Ga0495686_0000128 3300047472 Bacteria 156223
392 Ga0496104_0385468 3300048907 Bacteria 1314
393 Ga0496110_0352773 3300048913 Bacteria 1340
394 Ga0501290_001589 3300049513 Bacteria 3062
395 Ga0501298_013270 3300049521 Unclassified 1456
396 Ga0501032_0036133 3300049569 Bacteria 3374
397 Ga0501032_0177563 3300049569 Bacteria 1395
398 Ga0501034_0207281 3300049571 Unclassified 1916
399 Ga0501038_0015399 3300049574 Bacteria 6952
400 Ga0501039_0124356 3300049575 Bacteria 2023
401 Ga0501043_0061179 3300049579 Bacteria 2957
402 Ga0501043_0091803 3300049579 Bacteria 2387
403 Ga0501047_0003414 3300049581 Bacteria 15035
404 Ga0501047_0029171 3300049581 Bacteria 5321
405 Ga0501047_0042976 3300049581 Bacteria 4366
406 Ga0501198_006734 3300049649 Bacteria 1640
407 Ga0501202_000356 3300049652 Bacteria 6369
408 Ga0501202_020321 3300049652 Bacteria 1319
409 Ga0501206_001354 3300049653 Bacteria 3062
410 Ga0501207_005253 3300049654 Unclassified 1787
411 Ga0501208_022517 3300049655 Bacteria 1045
412 Ga0501217_000636 3300049661 Bacteria 5919
413 Ga0501222_005852 3300049662 Unclassified 1654
414 Ga0501223_004407 3300049663 Bacteria 3014
415 Ga0501224_000608 3300049664 Bacteria 4414
416 Ga0501233_005284 3300049668 Bacteria 2396
417 Ga0501235_000430 3300049669 Bacteria 8137
418 Ga0501243_000328 3300049675 Bacteria 6180
419 Ga0501253_000404 3300049683 Bacteria 3637
420 Ga0501259_000947 3300049688 Bacteria 4793
421 Ga0501221_005376 3300049704 Unclassified 2136
422 Ga0501225_0000892 3300049705 Bacteria 9288
423 Ga0501225_0001221 3300049705 Bacteria 8004
424 Ga0501225_0010247 3300049705 Bacteria 2659
425 Ga0501266_011022 3300049763 Unclassified 1155
426 Ga0501035_0428852 3300049822 Bacteria 1097
427 Ga0501044_0013869 3300049823 Bacteria 8710
428 Ga0501044_0065602 3300049823 Bacteria 3702
429 Ga0501044_0120040 3300049823 Unclassified 2631
430 Ga0501284_00015 3300050005 Bacteria 104438
431 nmdc:mga0k408_21233_c1 3300050493 Bacteria 3645
432 nmdc:mga05p37_1846_c2 3300050507 Bacteria 21167
433 nmdc:mga09592_70544_c1 3300050508 Unclassified 2964
434 nmdc:mga0qj67_28351_c1 3300050509 Bacteria 4346
435 nmdc:mga0n895_414063_c1 3300050512 Bacteria 1363
436 Ga0495619_0147276 3300053085 Bacteria 1624
437 Ga0500644_0041093 3300053088 Bacteria 1534
438 Ga0500583_0000048 3300053092 Bacteria 78503
439 Ga0500583_0013232 3300053092 Bacteria 3184
440 Ga0500642_0121369 3300053130 Bacteria 1223
441 Ga0500559_0138710 3300053136 Unclassified 1138
442 Ga0500568_0018661 3300053139 Bacteria 3030
443 Ga0500588_0040876 3300053146 Bacteria 1397
444 Ga0500619_041797 3300053154 Bacteria 1452
445 Ga0500622_0002533 3300053156 Bacteria 13120
446 Ga0500622_0057886 3300053156 Bacteria 1982
447 Ga0500637_0220641 3300053178 Bacteria 1072
448 Ga0495668_0003162
449 rootH1_10017247
450 rootH1_10043460
451 rootH1_10186377
452 rootH2_10253432
453 rootL2_10093489
454 rootH1_10023435
455 Ga0065707_10168671
456 Ga0070676_10009136
457 Ga0070683_100002310
458 Ga0070683_100031522
459 Ga0070683_100192653
460 Ga0070690_100006658
461 Ga0070690_100098426
462 Ga0070690_100339566
463 Ga0070670_100019297
464 Ga0070670_100033113
465 Ga0070670_100066547
466 Ga0070670_100070327
467 Ga0070670_100093916
468 Ga0070677_10019677
469 Ga0068869_100003774
470 Ga0068869_100007130
471 Ga0068869_100039875
472 Ga0068869_100041995
473 Ga0068869_100045073
474 Ga0070666_10006049
475 Ga0070666_10015500
476 Ga0070666_10079539
477 Ga0070666_10126145
478 Ga0068868_100004509
479 Ga0068868_100008622
480 Ga0068868_100046968
481 Ga0068868_100078270
482 Ga0068868_100338670
483 Ga0070689_100115655
484 Ga0070689_100125394
485 Ga0070661_100013620
486 Ga0070661_100063669
487 Ga0070661_100106954
488 Ga0070668_100052414
489 Ga0070668_100161025
490 Ga0070669_100039357
491 Ga0070669_100398099
492 Ga0070675_100166261
493 Ga0070671_100029980
494 Ga0070671_100049154
495 Ga0070671_100061170
496 Ga0070671_100079377
497 Ga0070671_100129529
498 Ga0070671_100138739
499 Ga0070673_100041993
500 Ga0070673_100180546
501 Ga0070673_100311578
502 Ga0070688_100027561
503 Ga0070688_100060215
504 Ga0070659_100001755
505 Ga0070659_100014364
506 Ga0070659_100201087
507 Ga0070667_100006513
508 Ga0070667_100008663
509 Ga0070667_100108427
510 Ga0070667_100116814
511 Ga0070667_100143785
512 Ga0070667_100261550
513 Ga0070667_100661029
514 Ga0070663_100493014
515 Ga0070678_100006566
516 Ga0070662_100024952
517 Ga0070662_100033185
518 Ga0070662_100043290
519 Ga0070662_100077025
520 Ga0070662_100140314
521 Ga0070681_10081990
522 Ga0068867_100010470
523 Ga0068867_100276450
524 Ga0068867_100478111
525 Ga0070685_10155049
526 Ga0070684_100002874
527 Ga0070684_100007093
528 Ga0070684_100018210
529 Ga0070684_100141108
530 Ga0068853_100001293
531 Ga0068853_100001810
532 Ga0068853_100078283
533 Ga0070672_100016237
534 Ga0070672_100039139
535 Ga0070672_100052146
536 Ga0070693_100142951
537 Ga0070665_100000018
538 Ga0070665_100056090
539 Ga0070664_100011609
540 Ga0070664_100053719
541 Ga0068857_100003231
542 Ga0068857_100003537
543 Ga0068857_100031441
544 Ga0068857_100175494
545 Ga0068854_100003818
546 Ga0068854_100116043
547 Ga0068854_100119669
548 Ga0068854_100146542
549 Ga0068856_100057285
550 Ga0070702_100175152
551 Ga0068852_100000424
552 Ga0068852_100002379
553 Ga0068852_100159367
554 Ga0068852_100175363
555 Ga0068852_100353550
556 Ga0068852_100441739
557 Ga0068859_100000588
558 Ga0068859_100008683
559 Ga0068859_100034496
560 Ga0068864_100028197
561 Ga0068864_100029240
562 Ga0068866_10024241
563 Ga0068851_10030284
564 Ga0068851_10053472
565 Ga0068851_10156043
566 Ga0068870_10005475
567 Ga0068863_100002277
568 Ga0068858_100039304
569 Ga0068860_100006770
570 Ga0068860_100012561
571 Ga0068860_100023111
572 Ga0068860_100074346
573 Ga0081539_10020735
574 Ga0097621_100010566
575 Ga0097621_100144655
576 Ga0068871_100013178
577 Ga0068871_100027554
578 Ga0068871_100047988
579 Ga0075428_100000697
580 Ga0075430_100045080
581 Ga0075431_100171233
582 Ga0075434_100430710
583 Ga0075429_100031651
584 Ga0075429_100066294
585 Ga0068865_100039784
586 Ga0068865_100127016
587 Ga0068865_100206940
588 Ga0068865_100256538
589 Ga0097620_100000588
590 Ga0097620_100008683
591 Ga0097620_100034496
592 Ga0105240_10000431
593 Ga0105240_10001434
594 Ga0105240_10004355
595 Ga0105240_10006516
596 Ga0105240_10020767
597 Ga0105240_10178605
598 Ga0105240_10314308
599 Ga0111539_10009272
600 Ga0105247_10021229
601 Ga0105247_10068130
602 Ga0114129_10002037
603 Ga0105241_10002146
604 Ga0105241_10007371
605 Ga0105241_10030710
606 Ga0105241_10106245
607 Ga0105242_10133602
608 Ga0105248_10434333
609 Ga0105237_10002049
610 Ga0105237_10009667
611 Ga0105237_10013246
612 Ga0105237_10040303
613 Ga0105237_10057280
614 Ga0105238_10001088
615 Ga0105238_10013492
616 Ga0105238_10028644
617 Ga0105249_10002214
618 Ga0105249_10004787
619 Ga0105249_10085483
620 Ga0105249_10177243
621 Ga0105249_10305839
622 Ga0105239_10002512
623 Ga0105239_10024455
624 Ga0105239_10463319
625 Ga0105246_10018612
626 Ga0157373_10025384
627 Ga0157373_10246414
628 Ga0157371_10026504
629 Ga0157371_10064551
630 Ga0157370_10024877
631 Ga0157370_10266399
632 Ga0157369_10017716
633 Ga0157369_10288063
634 Ga0157374_10019930
635 Ga0157374_10025142
636 Ga0157374_10025814
637 Ga0157374_10028722
638 Ga0157374_10029504
639 Ga0157374_10051285
640 Ga0157374_10122966
641 Ga0157374_10194301
642 Ga0157378_10003494
643 Ga0157378_10004784
644 Ga0157378_10087731
645 Ga0157378_10106649
646 Ga0157378_10244792
647 Ga0163162_10015360
648 Ga0163162_10016512
649 Ga0163162_10064244
650 Ga0163162_10273268
651 Ga0163162_10371342
652 Ga0157372_10000294
653 Ga0157372_10116950
654 Ga0157372_10352097
655 Ga0157372_10411581
656 Ga0157372_10759442
657 Ga0157372_10812205
658 Ga0157375_10041044
659 Ga0157375_10091404
660 Ga0157375_10103136
661 Ga0157375_10106755
662 Ga0157375_10106776
663 Ga0157375_10216555
664 Ga0157375_10387523
665 Ga0157375_10846309
666 Ga0163163_10003809
667 Ga0163163_10059845
668 Ga0163163_10085911
669 Ga0163163_10101882
670 Ga0163163_10311589
671 Ga0157377_10023604
672 Ga0157377_10060442
673 Ga0157379_10068828
674 Ga0157379_10112462
675 Ga0157379_10340056
676 Ga0157376_10006150
677 Ga0157376_10012769
678 Ga0157376_10352509
679 Ga0163161_10364258
680 Ga0209646_1001005
681 Ga0207697_10048736
682 Ga0207642_10026528
683 Ga0207710_10015749
684 Ga0207688_10003403
685 Ga0207688_10107376
686 Ga0207680_10165695
687 Ga0207680_10240217
688 Ga0207647_10000017
689 Ga0207647_10097852
690 Ga0207645_10008616
691 Ga0207643_10005893
692 Ga0207654_10009877
693 Ga0207654_10012124
694 Ga0207654_10052675
695 Ga0207707_10076152
696 Ga0207695_10001411
697 Ga0207695_10012182
698 Ga0207695_10041052
699 Ga0207695_10051044
700 Ga0207671_10001751
701 Ga0207671_10004781
702 Ga0207671_10006312
703 Ga0207671_10008658
704 Ga0207657_10050966
705 Ga0207657_10092971
706 Ga0207649_10005326
707 Ga0207649_10085194
708 Ga0207681_10179101
709 Ga0207681_10197530
710 Ga0207694_10015366
711 Ga0207694_10040357
712 Ga0207650_10096693
713 Ga0207650_10102610
714 Ga0207650_10124741
715 Ga0207650_10233841
716 Ga0207659_10251389
717 Ga0207659_10468046
718 Ga0207644_10058436
719 Ga0207644_10102331
720 Ga0207644_10243458
721 Ga0207690_10313435
722 Ga0207706_10038469
723 Ga0207706_10044952
724 Ga0207706_10045670
725 Ga0207706_10339921
726 Ga0207686_10144748
727 Ga0207670_10037929
728 Ga0207670_10476412
729 Ga0207669_10059828
730 Ga0207704_10017727
731 Ga0207691_10018396
732 Ga0207691_10089954
733 Ga0207691_10153751
734 Ga0207691_10287371
735 Ga0207689_10000800
736 Ga0207689_10004939
737 Ga0207689_10007437
738 Ga0207689_10030870
739 Ga0207689_10037407
740 Ga0207689_10259242
741 Ga0207661_10018648
742 Ga0207661_10561095
743 Ga0207679_10006127
744 Ga0207679_10008446
745 Ga0207679_10269288
746 Ga0207667_10000403
747 Ga0207651_10067572
748 Ga0207651_10140751
749 Ga0207712_10029647
750 Ga0207712_10089124
751 Ga0207668_10058001
752 Ga0207640_10040954
753 Ga0207640_10205646
754 Ga0207640_10476569
755 Ga0207658_10024979
756 Ga0207658_10074761
757 Ga0207658_10077960
758 Ga0207658_10143923
759 Ga0207658_10188363
760 Ga0207677_10010638
761 Ga0207677_10172621
762 Ga0207677_10442811
763 Ga0207703_10002892
764 Ga0207703_10159705
765 Ga0207703_10353435
766 Ga0207639_10018474
767 Ga0207639_10018765
768 Ga0207639_10049306
769 Ga0207702_10071588
770 Ga0207702_10213030
771 Ga0207641_10000133
772 Ga0207648_10002545
773 Ga0207648_10007711
774 Ga0207676_10012264
775 Ga0207676_10031997
776 Ga0207676_10034656
777 Ga0207676_10037572
778 Ga0207676_10437790
779 Ga0207674_10000600
780 Ga0207674_10001468
781 Ga0207674_10044130
782 Ga0207674_10059731
783 Ga0207674_10085723
784 Ga0207674_10365752
785 Ga0207674_10508887
786 Ga0207675_100200578
787 Ga0207675_100282359
788 Ga0207683_10030991
789 Ga0207683_10036879
790 Ga0207683_10101578
791 Ga0207683_10304601
792 Ga0207698_10011350
793 Ga0207698_10128509
794 Ga0207698_10914374
795 Ga0207428_10159044
796 Ga0268266_10000026
797 Ga0268265_10068243
798 Ga0268264_10000015
799 Ga0268264_10000019
800 Ga0268264_10000054
801 Ga0268264_10011225
802 Ga0268264_10018928
803 Ga0268264_10028905
804 Ga0268264_10045085
805 Ga0268264_10229350
806 Ga0307517_10001171
807 Ga0307517_10117486
808 Ga0307515_10000024
809 Ga0307511_10000024
810 Ga0265313_10109441
811 Ga0307410_10186703
812 Ga0307510_10010057
813 Ga0373937_0343082
814 Ga0395898_0483126
815 Ga0395905_0164596
816 Ga0439465_0095938
817 Ga0451849_1071058
818 Ga0451853_0952037
819 Ga0451853_3986052
820 Ga0439449_0008697
821 Ga0439449_0010441
822 Ga0439457_003978
823 Ga0439462_0005705
824 Ga0466972_0000032
825 Ga0466970_0223244
826 Ga0466957_0000656
827 Ga0495638_0044701
828 Ga0495638_0044975
829 Ga0495606_0003604
830 Ga0495628_0200007
831 Ga0495630_0081437
832 Ga0495648_0001051
833 Ga0495667_0315988
834 Ga0495668_0000106
835 Ga0495611_0002528
836 Ga0495672_0013705
837 Ga0495687_000031
838 Ga0495686_0000128
839 Ga0496104_0385468
840 Ga0496110_0352773
841 Ga0501290_001589
842 Ga0501298_013270
843 Ga0501032_0036133
844 Ga0501032_0177563
845 Ga0501034_0207281
846 Ga0501038_0015399
847 Ga0501039_0124356
848 Ga0501043_0061179
849 Ga0501043_0091803
850 Ga0501047_0003414
851 Ga0501047_0029171
852 Ga0501047_0042976
853 Ga0501198_006734
854 Ga0501202_000356
855 Ga0501202_020321
856 Ga0501206_001354
857 Ga0501207_005253
858 Ga0501208_022517
859 Ga0501217_000636
860 Ga0501222_005852
861 Ga0501223_004407
862 Ga0501224_000608
863 Ga0501233_005284
864 Ga0501235_000430
865 Ga0501243_000328
866 Ga0501253_000404
867 Ga0501259_000947
868 Ga0501221_005376
869 Ga0501225_0000892
870 Ga0501225_0001221
871 Ga0501225_0010247
872 Ga0501266_011022
873 Ga0501035_0428852
874 Ga0501044_0013869
875 Ga0501044_0065602
876 Ga0501044_0120040
877 Ga0501284_00015
878 nmdc:mga0k408_21233_c1
879 nmdc:mga05p37_1846_c2
880 nmdc:mga09592_70544_c1
881 nmdc:mga0qj67_28351_c1
882 nmdc:mga0n895_414063_c1
883 Ga0495619_0147276
884 Ga0500644_0041093
885 Ga0500583_0000048
886 Ga0500583_0013232
887 Ga0500642_0121369
888 Ga0500559_0138710
889 Ga0500568_0018661
890 Ga0500588_0040876
891 Ga0500619_041797
892 Ga0500622_0002533
893 Ga0500622_0057886
894 Ga0500637_0220641

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02016

Peptidase_S66

LD-carboxypeptidase N-terminal domain

53

170

0.95

PF17676

Peptidase_S66C

LD-carboxypeptidase C-terminal domain

214

330

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6uuk-assembly1.cif.gz_B crystal structure of muramoyltetrapeptide carboxypeptidase from oxalobacter formigenes 0.9116 12 301
6uuk-assembly1.cif.gz_A crystal structure of muramoyltetrapeptide carboxypeptidase from oxalobacter formigenes 0.9006 15 301
6uuk-assembly1.cif.gz_B crystal structure of muramoyltetrapeptide carboxypeptidase from oxalobacter formigenes 0.8909 12 301
3tyx-assembly1.cif.gz_B crystal structure of the f177s mutant of mycrocine immunity protein (mccf) with amp 0.8889 5 302
3gjz-assembly1.cif.gz_A crystal structure of microcin immunity protein mccf from bacillus anthracis str. ames 0.8888 5 302
ID Description Score Start End Superfamily
af_P76008_161_291_3.50.30.60 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;LD-carboxypeptidase A C-terminal domain-like 0.9263 169 295 3.50.30.60
4h1hB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain 0.9002 4 157 3.40.50.10740
af_P76008_161_291_3.50.30.60 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;LD-carboxypeptidase A C-terminal domain-like 0.893 169 295 3.50.30.60
4h1hB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain 0.8835 4 157 3.40.50.10740
af_P76008_4_153_3.40.50.10740 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain 0.8717 15 157 3.40.50.10740
ID Description Score Start End GO Terms
AF-A0A1Q3TJL7-F1-model_v4 LD-carboxypeptidase 0.999 1 302 GO:0004180
GO:0006508
GO:0008236
AF-A0A7X9Q622-F1-model_v4 LD-carboxypeptidase 0.9977 1 133 GO:0004180
AF-A0A1Q3TJL7-F1-model_v4 LD-carboxypeptidase 0.9957 1 302 GO:0004180
GO:0006508
GO:0008236
AF-A0A3C1T5W8-F1-model_v4 LD-carboxypeptidase 0.9955 90 302 GO:0004180
GO:0006508
GO:0008236
AF-A0A4Q3VWA9-F1-model_v4 LD-carboxypeptidase 0.992 1 271 GO:0004180
GO:0006508
GO:0008236

Map