F445960

General Info

Members Datasets Scaffolds Average Seq Length
447 213 894 77

Family's Representative Sequence

Representative Sequence 3300025909|Ga0207705_11111949|Ga0207705_111119492
Length 75
Sequence MTDELLRLLGPGEPEVGCDECFDQLDRHVEAELAGERTVAEMDAHLGGCPACREEYESLRDLLSAEPVETGRMPG

Samples

Sample ID Description Type Environment
1 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
85 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
136 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
137 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
138 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
139 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
140 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
144 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
145 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
150 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
151 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
154 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
155 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
156 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.66
Metatranscriptomes 1.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 10.74
Rhizosphere 87.92
Stem 0
Stem Tuber 0
Unclassified 11.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207705_11111949 3300025909 Bacteria 608
2 Ga0070658_10082559 3300005327 Bacteria 2641
3 Ga0070658_10090158 3300005327 Bacteria 2526
4 Ga0070683_100003621 3300005329 Bacteria 12586
5 Ga0070683_100056891 3300005329 Bacteria 3632
6 Ga0070683_100461823 3300005329 Unclassified 1212
7 Ga0070683_101349919 3300005329 Bacteria 685
8 Ga0070670_101430394 3300005331 Bacteria 634
9 Ga0070680_100003415 3300005336 Bacteria 11854
10 Ga0070680_100103389 3300005336 Bacteria 2367
11 Ga0070682_100012849 3300005337 Bacteria 4806
12 Ga0070682_100278963 3300005337 Unclassified 1217
13 Ga0070682_100429460 3300005337 Unclassified 1006
14 Ga0068868_100039911 3300005338 Bacteria 3650
15 Ga0068868_100054049 3300005338 Bacteria 3164
16 Ga0068868_101817423 3300005338 Unclassified 576
17 Ga0070660_100027594 3300005339 Bacteria 4239
18 Ga0070660_100058860 3300005339 Bacteria 2979
19 Ga0070660_100408784 3300005339 Bacteria 1123
20 Ga0070660_100533505 3300005339 Bacteria 978
21 Ga0070689_102186167 3300005340 Bacteria 507
22 Ga0070691_10303432 3300005341 Bacteria 873
23 Ga0070661_100049597 3300005344 Bacteria 3073
24 Ga0070661_100188268 3300005344 Bacteria 1573
25 Ga0070661_100367961 3300005344 Unclassified 1131
26 Ga0070692_10105543 3300005345 Bacteria 1551
27 Ga0070669_101922423 3300005353 Bacteria 517
28 Ga0070675_101560032 3300005354 Bacteria 609
29 Ga0070671_100045699 3300005355 Bacteria 3640
30 Ga0070671_100798201 3300005355 Unclassified 822
31 Ga0070674_100194526 3300005356 Bacteria 1562
32 Ga0070674_100376501 3300005356 Bacteria 1154
33 Ga0070673_100850739 3300005364 Bacteria 844
34 Ga0070659_100006764 3300005366 Bacteria 8292
35 Ga0070659_100056832 3300005366 Bacteria 3085
36 Ga0070659_100754843 3300005366 Unclassified 844
37 Ga0070659_101667180 3300005366 Bacteria 570
38 Ga0070709_10396906 3300005434 Unclassified 1029
39 Ga0070701_10101590 3300005438 Bacteria 1594
40 Ga0070708_100192442 3300005445 Bacteria 1908
41 Ga0070663_100244466 3300005455 Bacteria 1418
42 Ga0070663_102044545 3300005455 Bacteria 516
43 Ga0070678_100022189 3300005456 Bacteria 4200
44 Ga0070678_100365569 3300005456 Bacteria 1244
45 Ga0070662_100024962 3300005457 Bacteria 4124
46 Ga0070662_101663368 3300005457 Bacteria 551
47 Ga0070681_10022109 3300005458 Bacteria 6383
48 Ga0070681_10045833 3300005458 Bacteria 4373
49 Ga0068867_100241383 3300005459 Bacteria 1465
50 Ga0070698_100364068 3300005471 Bacteria 1378
51 Ga0070679_100002150 3300005530 Bacteria 17770
52 Ga0070684_100023662 3300005535 Bacteria 5143
53 Ga0070684_100078924 3300005535 Bacteria 2909
54 Ga0070684_100167338 3300005535 Bacteria 1996
55 Ga0070684_101367423 3300005535 Unclassified 667
56 Ga0068853_100057840 3300005539 Bacteria 3347
57 Ga0070695_101080209 3300005545 Unclassified 656
58 Ga0070696_100484851 3300005546 Bacteria 981
59 Ga0070693_100019768 3300005547 Bacteria 3539
60 Ga0070665_100642026 3300005548 Bacteria 1074
61 Ga0070665_102546486 3300005548 Bacteria 513
62 Ga0070704_100613586 3300005549 Bacteria 957
63 Ga0070704_100907158 3300005549 Bacteria 793
64 Ga0068855_100213622 3300005563 Bacteria 2167
65 Ga0068855_100241803 3300005563 Bacteria 2017
66 Ga0068855_101534316 3300005563 Unclassified 683
67 Ga0068855_101751560 3300005563 Bacteria 632
68 Ga0070664_100144751 3300005564 Bacteria 2095
69 Ga0070664_100985351 3300005564 Bacteria 792
70 Ga0070664_101688552 3300005564 Bacteria 600
71 Ga0068857_100051164 3300005577 Bacteria 3664
72 Ga0068857_101273098 3300005577 Bacteria 713
73 Ga0068854_100130249 3300005578 Bacteria 1920
74 Ga0068854_101159365 3300005578 Bacteria 691
75 Ga0068856_100009418 3300005614 Bacteria 9481
76 Ga0068856_100021475 3300005614 Bacteria 6275
77 Ga0068856_100033286 3300005614 Bacteria 5046
78 Ga0068856_100688473 3300005614 Bacteria 1043
79 Ga0068856_101301660 3300005614 Unclassified 742
80 Ga0068856_102160844 3300005614 Bacteria 566
81 Ga0070702_100262738 3300005615 Bacteria 1176
82 Ga0068852_100068943 3300005616 Bacteria 3097
83 Ga0068852_102778065 3300005616 Bacteria 508
84 Ga0068866_10069062 3300005718 Bacteria 1860
85 Ga0068866_10518049 3300005718 Bacteria 792
86 Ga0068870_11419385 3300005840 Bacteria 509
87 Ga0068858_101152292 3300005842 Bacteria 762
88 Ga0081455_10652108 3300005937 Bacteria 678
89 Ga0070717_11928166 3300006028 Unclassified 533
90 Ga0075365_10413512 3300006038 Bacteria 952
91 Ga0097621_101614143 3300006237 Bacteria 617
92 Ga0068871_100691113 3300006358 Bacteria 934
93 Ga0068871_101295546 3300006358 Bacteria 685
94 Ga0075428_100047777 3300006844 Bacteria 4699
95 Ga0075428_100180049 3300006844 Bacteria 2288
96 Ga0075431_100288236 3300006847 Bacteria 1661
97 Ga0075431_101627410 3300006847 Unclassified 603
98 Ga0075433_10014517 3300006852 Bacteria 6439
99 Ga0075433_11323507 3300006852 Bacteria 624
100 Ga0075434_100001863 3300006871 Bacteria 18229
101 Ga0075434_100103671 3300006871 Bacteria 2853
102 Ga0075429_100008446 3300006880 Bacteria 8963
103 Ga0068865_100601301 3300006881 Bacteria 929
104 Ga0068865_101970612 3300006881 Bacteria 530
105 Ga0075436_100523850 3300006914 Bacteria 869
106 Ga0075435_100098814 3300007076 Bacteria 2416
107 Ga0075435_100246603 3300007076 Bacteria 1520
108 Ga0105240_10041148 3300009093 Bacteria 5901
109 Ga0111539_11926884 3300009094 Bacteria 685
110 Ga0111539_12135804 3300009094 Bacteria 650
111 Ga0111539_12469640 3300009094 Unclassified 603
112 Ga0105245_10021874 3300009098 Bacteria 5613
113 Ga0105245_10046322 3300009098 Bacteria 3886
114 Ga0105245_10092427 3300009098 Bacteria 2786
115 Ga0105245_10232823 3300009098 Bacteria 1782
116 Ga0105245_10255417 3300009098 Bacteria 1704
117 Ga0105245_12487116 3300009098 Bacteria 571
118 Ga0105247_11675107 3300009101 Bacteria 525
119 Ga0114129_10050703 3300009147 Bacteria 5829
120 Ga0114129_11309481 3300009147 Unclassified 897
121 Ga0105243_10279975 3300009148 Bacteria 1502
122 Ga0105243_10556711 3300009148 Bacteria 1097
123 Ga0105243_10968847 3300009148 Bacteria 851
124 Ga0105241_10412102 3300009174 Unclassified 1187
125 Ga0105241_10698814 3300009174 Bacteria 925
126 Ga0105241_11096082 3300009174 Bacteria 750
127 Ga0105242_10122464 3300009176 Bacteria 2234
128 Ga0105242_10825763 3300009176 Bacteria 920
129 Ga0105242_11012136 3300009176 Unclassified 839
130 Ga0105248_11704800 3300009177 Bacteria 714
131 Ga0105248_13035681 3300009177 Bacteria 534
132 Ga0105237_10027799 3300009545 Bacteria 5765
133 Ga0105238_10213984 3300009551 Bacteria 1904
134 Ga0105238_10368880 3300009551 Bacteria 1426
135 Ga0105249_10858369 3300009553 Bacteria 973
136 Ga0105249_11032946 3300009553 Bacteria 891
137 Ga0105239_10033768 3300010375 Bacteria 5617
138 Ga0105239_10786550 3300010375 Bacteria 1090
139 Ga0105239_10820105 3300010375 Bacteria 1066
140 Ga0105239_10851621 3300010375 Unclassified 1045
141 Ga0105246_10138531 3300011119 Bacteria 1827
142 Ga0105246_11199687 3300011119 Bacteria 698
143 Ga0157373_10269610 3300013100 Bacteria 1205
144 Ga0157370_10018556 3300013104 Bacteria 6993
145 Ga0157369_10016496 3300013105 Bacteria 8308
146 Ga0157369_11421141 3300013105 Bacteria 706
147 Ga0157374_11456127 3300013296 Bacteria 708
148 Ga0157374_11740222 3300013296 Bacteria 648
149 Ga0163162_10206844 3300013306 Bacteria 2092
150 Ga0163162_10752954 3300013306 Bacteria 1093
151 Ga0157372_10049674 3300013307 Bacteria 4665
152 Ga0157372_10156004 3300013307 Bacteria 2637
153 Ga0157372_11856937 3300013307 Unclassified 693
154 Ga0157372_12950831 3300013307 Bacteria 544
155 Ga0157375_10774670 3300013308 Bacteria 1109
156 Ga0157375_10791056 3300013308 Bacteria 1098
157 Ga0157375_10895707 3300013308 Bacteria 1031
158 Ga0157375_10987427 3300013308 Bacteria 982
159 Ga0157375_11993199 3300013308 Unclassified 690
160 Ga0157375_12366591 3300013308 Unclassified 634
161 Ga0163163_10427516 3300014325 Unclassified 1384
162 Ga0163163_10571355 3300014325 Bacteria 1194
163 Ga0163163_11768004 3300014325 Bacteria 679
164 Ga0182008_10668695 3300014497 Bacteria 590
165 Ga0157377_10143041 3300014745 Bacteria 1472
166 Ga0157377_10485896 3300014745 Bacteria 860
167 Ga0157377_11282856 3300014745 Bacteria 571
168 Ga0157376_10830456 3300014969 Bacteria 938
169 Ga0206355_1025735 3300020076 Bacteria 638
170 Ga0206354_10307361 3300020081 Bacteria 844
171 Ga0206354_10731697 3300020081 Bacteria 2301
172 Ga0206353_10048157 3300020082 Bacteria 10173
173 Ga0224712_10072606 3300022467 Bacteria 1401
174 Ga0224712_10430289 3300022467 Unclassified 632
175 Ga0207642_10655735 3300025899 Bacteria 658
176 Ga0207645_10475863 3300025907 Bacteria 844
177 Ga0207643_10869630 3300025908 Bacteria 584
178 Ga0207705_10054438 3300025909 Bacteria 2883
179 Ga0207654_10658756 3300025911 Bacteria 750
180 Ga0207707_10021680 3300025912 Bacteria 5615
181 Ga0207707_10021744 3300025912 Bacteria 5607
182 Ga0207707_10167272 3300025912 Bacteria 1922
183 Ga0207695_10202036 3300025913 Bacteria 1901
184 Ga0207671_10068945 3300025914 Bacteria 2636
185 Ga0207663_11388978 3300025916 Unclassified 566
186 Ga0207660_10023243 3300025917 Bacteria 4185
187 Ga0207660_10567376 3300025917 Bacteria 923
188 Ga0207660_10575834 3300025917 Bacteria 916
189 Ga0207662_10606798 3300025918 Bacteria 762
190 Ga0207657_10015881 3300025919 Bacteria 7275
191 Ga0207657_10020097 3300025919 Bacteria 6321
192 Ga0207657_10216625 3300025919 Bacteria 1535
193 Ga0207649_10069476 3300025920 Bacteria 2243
194 Ga0207649_10348164 3300025920 Unclassified 1096
195 Ga0207652_10011603 3300025921 Bacteria 7109
196 Ga0207652_10068266 3300025921 Bacteria 3084
197 Ga0207652_10280525 3300025921 Bacteria 1503
198 Ga0207694_10027678 3300025924 Bacteria 4318
199 Ga0207694_10444734 3300025924 Bacteria 1081
200 Ga0207659_10907369 3300025926 Bacteria 758
201 Ga0207659_11144900 3300025926 Unclassified 669
202 Ga0207659_11370940 3300025926 Bacteria 606
203 Ga0207659_11680280 3300025926 Bacteria 541
204 Ga0207687_10002078 3300025927 Bacteria 13689
205 Ga0207687_10046293 3300025927 Bacteria 3011
206 Ga0207687_10095983 3300025927 Unclassified 2172
207 Ga0207687_10195474 3300025927 Bacteria 1577
208 Ga0207687_10316999 3300025927 Bacteria 1261
209 Ga0207687_10334757 3300025927 Bacteria 1229
210 Ga0207687_10580819 3300025927 Bacteria 943
211 Ga0207644_10384277 3300025931 Bacteria 1145
212 Ga0207644_11440745 3300025931 Unclassified 578
213 Ga0207644_11572149 3300025931 Bacteria 552
214 Ga0207690_10131763 3300025932 Bacteria 1831
215 Ga0207690_10204031 3300025932 Unclassified 1503
216 Ga0207690_10796470 3300025932 Unclassified 781
217 Ga0207706_10040807 3300025933 Bacteria 4114
218 Ga0207706_11494070 3300025933 Bacteria 551
219 Ga0207686_10265916 3300025934 Bacteria 1259
220 Ga0207686_10338792 3300025934 Bacteria 1129
221 Ga0207686_11005486 3300025934 Bacteria 677
222 Ga0207709_10007090 3300025935 Bacteria 6262
223 Ga0207709_10082415 3300025935 Bacteria 2077
224 Ga0207709_10367598 3300025935 Bacteria 1091
225 Ga0207670_11770427 3300025936 Unclassified 525
226 Ga0207669_10165527 3300025937 Bacteria 1568
227 Ga0207669_10181945 3300025937 Bacteria 1508
228 Ga0207704_10491078 3300025938 Bacteria 988
229 Ga0207704_11456837 3300025938 Bacteria 587
230 Ga0207704_11755828 3300025938 Bacteria 533
231 Ga0207689_10319844 3300025942 Bacteria 1287
232 Ga0207661_10038281 3300025944 Bacteria 3757
233 Ga0207661_10276883 3300025944 Bacteria 1499
234 Ga0207661_10306758 3300025944 Unclassified 1424
235 Ga0207661_11478161 3300025944 Bacteria 623
236 Ga0207679_10147652 3300025945 Bacteria 1909
237 Ga0207679_11326430 3300025945 Bacteria 660
238 Ga0207667_10357458 3300025949 Bacteria 1489
239 Ga0207667_10434398 3300025949 Bacteria 1335
240 Ga0207667_12141254 3300025949 Bacteria 517
241 Ga0207667_12156147 3300025949 Bacteria 515
242 Ga0207651_11152401 3300025960 Bacteria 695
243 Ga0207712_10825561 3300025961 Bacteria 816
244 Ga0207712_11192311 3300025961 Bacteria 679
245 Ga0207640_10242013 3300025981 Bacteria 1395
246 Ga0207640_10638117 3300025981 Bacteria 906
247 Ga0207677_10066267 3300026023 Bacteria 2524
248 Ga0207677_10789265 3300026023 Bacteria 849
249 Ga0207677_10988439 3300026023 Bacteria 762
250 Ga0207703_10569891 3300026035 Bacteria 1069
251 Ga0207639_10152794 3300026041 Bacteria 1935
252 Ga0207639_12216124 3300026041 Bacteria 511
253 Ga0207708_10049375 3300026075 Bacteria 3203
254 Ga0207702_10009830 3300026078 Bacteria 8019
255 Ga0207702_10012177 3300026078 Bacteria 7158
256 Ga0207702_10096339 3300026078 Bacteria 2602
257 Ga0207702_10142670 3300026078 Bacteria 2169
258 Ga0207702_10817478 3300026078 Unclassified 922
259 Ga0207648_10204987 3300026089 Bacteria 1750
260 Ga0207674_10080917 3300026116 Bacteria 3251
261 Ga0207683_10063908 3300026121 Bacteria 3243
262 Ga0207683_10084618 3300026121 Bacteria 2819
263 Ga0207698_10075405 3300026142 Bacteria 2695
264 Ga0268266_11098262 3300028379 Bacteria 770
265 Ga0268266_12052610 3300028379 Bacteria 545
266 Ga0307406_10061391 3300031901 Bacteria 2427
267 Ga0307409_101032562 3300031995 Bacteria 841
268 Ga0395900_0005305 3300037418 Bacteria 13510
269 Ga0395900_0188780 3300037418 Bacteria 2091
270 Ga0395900_0610270 3300037418 Bacteria 1031
271 Ga0395900_0700275 3300037418 Unclassified 946
272 Ga0395898_0003605 3300037466 Bacteria 17244
273 Ga0395898_0007873 3300037466 Bacteria 11305
274 Ga0395898_0020775 3300037466 Bacteria 6665
275 Ga0395898_0106985 3300037466 Bacteria 2682
276 Ga0395898_0275358 3300037466 Bacteria 1605
277 Ga0395898_0489794 3300037466 Unclassified 1170
278 Ga0395898_1352014 3300037466 Bacteria 641
279 Ga0395898_1574323 3300037466 Unclassified 582
280 Ga0395898_1643296 3300037466 Unclassified 566
281 Ga0395905_0073506 3300037471 Bacteria 3205
282 Ga0395905_0116160 3300037471 Bacteria 2515
283 Ga0395905_0252734 3300037471 Unclassified 1646
284 Ga0395905_0384691 3300037471 Bacteria 1297
285 Ga0395905_1806388 3300037471 Unclassified 517
286 Ga0395901_0007441 3300038443 Bacteria 11050
287 Ga0395901_0023245 3300038443 Bacteria 6354
288 Ga0395901_0114450 3300038443 Bacteria 2833
289 Ga0395901_0201706 3300038443 Bacteria 2085
290 Ga0395901_0672541 3300038443 Bacteria 1036
291 Ga0395901_0939559 3300038443 Unclassified 844
292 Ga0451835_1201720 3300041492 Bacteria 576
293 Ga0451839_0497042 3300041496 Bacteria 725
294 Ga0451851_0169916 3300041507 Bacteria 670
295 Ga0451853_0815237 3300041512 Bacteria 1136
296 Ga0451853_1172985 3300041512 Bacteria 681
297 Ga0439464_0121199 3300042439 Bacteria 806
298 Ga0466966_0085649 3300044684 Bacteria 1959
299 Ga0466966_0617491 3300044684 Bacteria 653
300 Ga0466961_0120875 3300044693 Archaea 1645
301 Ga0466963_0002359 3300044694 Bacteria 10542
302 Ga0466963_0293497 3300044694 Bacteria 1143
303 Ga0466964_0525004 3300044706 Bacteria 639
304 Ga0466971_0061863 3300044719 Bacteria 1694
305 Ga0466970_0147852 3300044765 Bacteria 1297
306 Ga0466970_0493065 3300044765 Unclassified 705
307 Ga0466957_0104776 3300044842 Bacteria 1787
308 Ga0466958_0052757 3300045836 Bacteria 2465
309 Ga0466967_0000750 3300045976 Bacteria 16704
310 Ga0466967_0089479 3300045976 Bacteria 2795
311 Ga0466967_0441182 3300045976 Bacteria 1271
312 Ga0466967_0684905 3300045976 Bacteria 1015
313 Ga0466967_0908941 3300045976 Bacteria 875
314 Ga0466967_1148942 3300045976 Bacteria 774
315 Ga0466967_1607338 3300045976 Bacteria 647
316 Ga0466967_1821170 3300045976 Bacteria 606
317 Ga0495641_0125334 3300046461 Bacteria 1146
318 Ga0495616_0285300 3300046513 Bacteria 701
319 Ga0495616_0341345 3300046513 Unclassified 625
320 Ga0495656_0063056 3300046615 Bacteria 1623
321 Ga0495656_0165010 3300046615 Unclassified 1079
322 Ga0495613_1117157 3300046689 Bacteria 503
323 Ga0495589_0135174 3300046794 Bacteria 1183
324 Ga0495581_0487227 3300047315 Bacteria 717
325 Ga0495677_0286991 3300047445 Bacteria 646
326 Ga0495679_115032 3300047446 Bacteria 739
327 Ga0496100_0359522 3300048903 Bacteria 1101
328 Ga0496100_0712578 3300048903 Unclassified 783
329 Ga0496100_1056219 3300048903 Bacteria 640
330 Ga0496100_1425201 3300048903 Unclassified 547
331 Ga0496101_0006408 3300048904 Bacteria 7576
332 Ga0496101_0013118 3300048904 Bacteria 5544
333 Ga0496101_0815047 3300048904 Bacteria 736
334 Ga0496101_0859730 3300048904 Bacteria 715
335 Ga0496101_1218933 3300048904 Bacteria 589
336 Ga0496102_0001583 3300048905 Bacteria 20081
337 Ga0496102_0064428 3300048905 Bacteria 3357
338 Ga0496102_0222192 3300048905 Bacteria 1781
339 Ga0496102_0516859 3300048905 Bacteria 1116
340 Ga0496103_0001717 3300048906 Bacteria 14315
341 Ga0496103_0018737 3300048906 Unclassified 4154
342 Ga0496104_0020974 3300048907 Bacteria 5994
343 Ga0496105_0000376 3300048908 Bacteria 29483
344 Ga0496106_0248836 3300048909 Bacteria 1421
345 Ga0496106_0482187 3300048909 Unclassified 996
346 Ga0496106_0700506 3300048909 Bacteria 807
347 Ga0496107_0534396 3300048910 Bacteria 869
348 Ga0496107_0675209 3300048910 Bacteria 761
349 Ga0496108_0023582 3300048911 Bacteria 5064
350 Ga0496108_0116680 3300048911 Bacteria 2287
351 Ga0496109_0000890 3300048912 Bacteria 24961
352 Ga0496109_0173063 3300048912 Bacteria 2026
353 Ga0496109_0262948 3300048912 Bacteria 1625
354 Ga0496109_1094176 3300048912 Bacteria 734
355 Ga0496110_0008944 3300048913 Bacteria 8075
356 Ga0496110_0022055 3300048913 Bacteria 5401
357 Ga0496110_0038349 3300048913 Bacteria 4169
358 Ga0496110_0086302 3300048913 Bacteria 2802
359 Ga0496110_0220238 3300048913 Bacteria 1726
360 Ga0496111_0008565 3300048914 Bacteria 6775
361 Ga0496111_0024268 3300048914 Bacteria 4267
362 Ga0496112_0052993 3300048915 Unclassified 3983
363 Ga0496112_0485635 3300048915 Bacteria 1171
364 Ga0496112_0911309 3300048915 Bacteria 801
365 Ga0496113_0125684 3300048916 Bacteria 2008
366 Ga0496113_0417533 3300048916 Bacteria 1078
367 Ga0496113_0529913 3300048916 Bacteria 945
368 Ga0496114_0003361 3300048917 Bacteria 12291
369 Ga0496114_0006099 3300048917 Bacteria 9492
370 Ga0496114_0037919 3300048917 Bacteria 3987
371 Ga0496114_0067095 3300048917 Unclassified 3009
372 Ga0496114_0234672 3300048917 Bacteria 1612
373 Ga0496115_0055443 3300048918 Bacteria 3184
374 Ga0496115_0333573 3300048918 Bacteria 1239
375 Ga0501031_0001912 3300049568 Bacteria 13123
376 Ga0501032_0026846 3300049569 Bacteria 3958
377 Ga0501033_0047200 3300049570 Bacteria 3202
378 Ga0501036_0001080 3300049572 Bacteria 20679
379 Ga0501038_0001400 3300049574 Bacteria 22061
380 Ga0501040_0078386 3300049576 Bacteria 2286
381 Ga0501040_0183979 3300049576 Bacteria 1482
382 Ga0501041_0001022 3300049577 Bacteria 15300
383 Ga0501041_0608809 3300049577 Bacteria 697
384 Ga0501042_0067248 3300049578 Bacteria 2562
385 Ga0501046_0773507 3300049580 Bacteria 674
386 Ga0501048_0001360 3300049582 Bacteria 18537
387 Ga0501048_0672680 3300049582 Bacteria 743
388 Ga0501048_0942587 3300049582 Bacteria 621
389 Ga0501067_0125929 3300049583 Bacteria 1426
390 Ga0501067_0347397 3300049583 Bacteria 827
391 Ga0501068_0000338 3300049584 Bacteria 23564
392 Ga0501070_0014105 3300049586 Bacteria 6727
393 Ga0501070_1226000 3300049586 Bacteria 575
394 Ga0501071_0000079 3300049587 Bacteria 34768
395 Ga0501071_0739385 3300049587 Bacteria 758
396 Ga0501071_1151953 3300049587 Bacteria 599
397 Ga0501072_0000403 3300049588 Bacteria 30914
398 Ga0501072_0011062 3300049588 Bacteria 6885
399 Ga0501072_0676144 3300049588 Bacteria 812
400 Ga0501072_1099123 3300049588 Bacteria 619
401 Ga0501072_1111963 3300049588 Bacteria 615
402 Ga0501073_0147161 3300049589 Bacteria 1632
403 Ga0501074_0000475 3300049590 Bacteria 24315
404 Ga0501074_0156268 3300049590 Bacteria 1629
405 Ga0501075_0336650 3300049591 Bacteria 1150
406 Ga0501075_0823595 3300049591 Bacteria 706
407 Ga0501076_0265372 3300049592 Bacteria 1406
408 Ga0501076_0909874 3300049592 Bacteria 725
409 Ga0501076_1481549 3300049592 Bacteria 557
410 Ga0501077_0028109 3300049593 Bacteria 3574
411 Ga0501079_0002666 3300049741 Bacteria 12975
412 Ga0501079_0044307 3300049741 Bacteria 3434
413 Ga0501079_0089199 3300049741 Bacteria 2388
414 Ga0501080_0133738 3300049742 Bacteria 2295
415 Ga0501081_0016911 3300049743 Bacteria 4820
416 Ga0501081_0207161 3300049743 Bacteria 1423
417 Ga0501081_0938588 3300049743 Unclassified 653
418 Ga0501081_1063653 3300049743 Bacteria 612
419 Ga0501081_1541388 3300049743 Bacteria 505
420 Ga0501083_0000131 3300049744 Bacteria 51265
421 Ga0501035_0251145 3300049822 Bacteria 1502
422 Ga0501044_0016209 3300049823 Bacteria 8011
423 Ga0501044_0432588 3300049823 Bacteria 1225
424 Ga0501045_0166772 3300049824 Bacteria 1640
425 nmdc:mga05p37_24673_c1 3300050507 Bacteria 7309
426 nmdc:mga09592_232438_c1 3300050508 Bacteria 1598
427 nmdc:mga0qj67_62562_c1 3300050509 Bacteria 2958
428 nmdc:mga06r32_2087914_c1 3300050510 Unclassified 500
429 nmdc:mga06r32_28609_c1 3300050510 Bacteria 5218
430 nmdc:mga08y16_1579210_c1 3300050511 Bacteria 614
431 nmdc:mga0n895_272711_c1 3300050512 Bacteria 1716
432 nmdc:mga0n895_27279_c1 3300050512 Bacteria 5424
433 nmdc:mga0rr50_222237_c1 3300050513 Bacteria 1560
434 nmdc:mga0rr50_42365_c1 3300050513 Bacteria 3324
435 nmdc:mga08x19_103605_c1 3300050514 Bacteria 1890
436 nmdc:mga08x19_487208_c1 3300050514 Bacteria 870
437 nmdc:mga0a205_4667_c1 3300050515 Bacteria 12288
438 Ga0495595_0104057 3300053084 Bacteria 1372
439 Ga0501084_0001486 3300054114 Bacteria 18633
440 Ga0501084_0143132 3300054114 Bacteria 2014
441 Ga0501084_1002865 3300054114 Bacteria 702
442 Ga0501082_0324098 3300060353 Bacteria 1342
443 Ga0501082_0518058 3300060353 Bacteria 1042
444 Ga0501082_1309262 3300060353 Bacteria 633
445 Ga0466962_0362803 3300061719 Bacteria 722
446 Ga0530510_0001984 3300061734 Bacteria 14025
447 Ga0530510_0074356 3300061734 Bacteria 2467
448 Ga0207705_11111949
449 Ga0070658_10082559
450 Ga0070658_10090158
451 Ga0070683_100003621
452 Ga0070683_100056891
453 Ga0070683_100461823
454 Ga0070683_101349919
455 Ga0070670_101430394
456 Ga0070680_100003415
457 Ga0070680_100103389
458 Ga0070682_100012849
459 Ga0070682_100278963
460 Ga0070682_100429460
461 Ga0068868_100039911
462 Ga0068868_100054049
463 Ga0068868_101817423
464 Ga0070660_100027594
465 Ga0070660_100058860
466 Ga0070660_100408784
467 Ga0070660_100533505
468 Ga0070689_102186167
469 Ga0070691_10303432
470 Ga0070661_100049597
471 Ga0070661_100188268
472 Ga0070661_100367961
473 Ga0070692_10105543
474 Ga0070669_101922423
475 Ga0070675_101560032
476 Ga0070671_100045699
477 Ga0070671_100798201
478 Ga0070674_100194526
479 Ga0070674_100376501
480 Ga0070673_100850739
481 Ga0070659_100006764
482 Ga0070659_100056832
483 Ga0070659_100754843
484 Ga0070659_101667180
485 Ga0070709_10396906
486 Ga0070701_10101590
487 Ga0070708_100192442
488 Ga0070663_100244466
489 Ga0070663_102044545
490 Ga0070678_100022189
491 Ga0070678_100365569
492 Ga0070662_100024962
493 Ga0070662_101663368
494 Ga0070681_10022109
495 Ga0070681_10045833
496 Ga0068867_100241383
497 Ga0070698_100364068
498 Ga0070679_100002150
499 Ga0070684_100023662
500 Ga0070684_100078924
501 Ga0070684_100167338
502 Ga0070684_101367423
503 Ga0068853_100057840
504 Ga0070695_101080209
505 Ga0070696_100484851
506 Ga0070693_100019768
507 Ga0070665_100642026
508 Ga0070665_102546486
509 Ga0070704_100613586
510 Ga0070704_100907158
511 Ga0068855_100213622
512 Ga0068855_100241803
513 Ga0068855_101534316
514 Ga0068855_101751560
515 Ga0070664_100144751
516 Ga0070664_100985351
517 Ga0070664_101688552
518 Ga0068857_100051164
519 Ga0068857_101273098
520 Ga0068854_100130249
521 Ga0068854_101159365
522 Ga0068856_100009418
523 Ga0068856_100021475
524 Ga0068856_100033286
525 Ga0068856_100688473
526 Ga0068856_101301660
527 Ga0068856_102160844
528 Ga0070702_100262738
529 Ga0068852_100068943
530 Ga0068852_102778065
531 Ga0068866_10069062
532 Ga0068866_10518049
533 Ga0068870_11419385
534 Ga0068858_101152292
535 Ga0081455_10652108
536 Ga0070717_11928166
537 Ga0075365_10413512
538 Ga0097621_101614143
539 Ga0068871_100691113
540 Ga0068871_101295546
541 Ga0075428_100047777
542 Ga0075428_100180049
543 Ga0075431_100288236
544 Ga0075431_101627410
545 Ga0075433_10014517
546 Ga0075433_11323507
547 Ga0075434_100001863
548 Ga0075434_100103671
549 Ga0075429_100008446
550 Ga0068865_100601301
551 Ga0068865_101970612
552 Ga0075436_100523850
553 Ga0075435_100098814
554 Ga0075435_100246603
555 Ga0105240_10041148
556 Ga0111539_11926884
557 Ga0111539_12135804
558 Ga0111539_12469640
559 Ga0105245_10021874
560 Ga0105245_10046322
561 Ga0105245_10092427
562 Ga0105245_10232823
563 Ga0105245_10255417
564 Ga0105245_12487116
565 Ga0105247_11675107
566 Ga0114129_10050703
567 Ga0114129_11309481
568 Ga0105243_10279975
569 Ga0105243_10556711
570 Ga0105243_10968847
571 Ga0105241_10412102
572 Ga0105241_10698814
573 Ga0105241_11096082
574 Ga0105242_10122464
575 Ga0105242_10825763
576 Ga0105242_11012136
577 Ga0105248_11704800
578 Ga0105248_13035681
579 Ga0105237_10027799
580 Ga0105238_10213984
581 Ga0105238_10368880
582 Ga0105249_10858369
583 Ga0105249_11032946
584 Ga0105239_10033768
585 Ga0105239_10786550
586 Ga0105239_10820105
587 Ga0105239_10851621
588 Ga0105246_10138531
589 Ga0105246_11199687
590 Ga0157373_10269610
591 Ga0157370_10018556
592 Ga0157369_10016496
593 Ga0157369_11421141
594 Ga0157374_11456127
595 Ga0157374_11740222
596 Ga0163162_10206844
597 Ga0163162_10752954
598 Ga0157372_10049674
599 Ga0157372_10156004
600 Ga0157372_11856937
601 Ga0157372_12950831
602 Ga0157375_10774670
603 Ga0157375_10791056
604 Ga0157375_10895707
605 Ga0157375_10987427
606 Ga0157375_11993199
607 Ga0157375_12366591
608 Ga0163163_10427516
609 Ga0163163_10571355
610 Ga0163163_11768004
611 Ga0182008_10668695
612 Ga0157377_10143041
613 Ga0157377_10485896
614 Ga0157377_11282856
615 Ga0157376_10830456
616 Ga0206355_1025735
617 Ga0206354_10307361
618 Ga0206354_10731697
619 Ga0206353_10048157
620 Ga0224712_10072606
621 Ga0224712_10430289
622 Ga0207642_10655735
623 Ga0207645_10475863
624 Ga0207643_10869630
625 Ga0207705_10054438
626 Ga0207654_10658756
627 Ga0207707_10021680
628 Ga0207707_10021744
629 Ga0207707_10167272
630 Ga0207695_10202036
631 Ga0207671_10068945
632 Ga0207663_11388978
633 Ga0207660_10023243
634 Ga0207660_10567376
635 Ga0207660_10575834
636 Ga0207662_10606798
637 Ga0207657_10015881
638 Ga0207657_10020097
639 Ga0207657_10216625
640 Ga0207649_10069476
641 Ga0207649_10348164
642 Ga0207652_10011603
643 Ga0207652_10068266
644 Ga0207652_10280525
645 Ga0207694_10027678
646 Ga0207694_10444734
647 Ga0207659_10907369
648 Ga0207659_11144900
649 Ga0207659_11370940
650 Ga0207659_11680280
651 Ga0207687_10002078
652 Ga0207687_10046293
653 Ga0207687_10095983
654 Ga0207687_10195474
655 Ga0207687_10316999
656 Ga0207687_10334757
657 Ga0207687_10580819
658 Ga0207644_10384277
659 Ga0207644_11440745
660 Ga0207644_11572149
661 Ga0207690_10131763
662 Ga0207690_10204031
663 Ga0207690_10796470
664 Ga0207706_10040807
665 Ga0207706_11494070
666 Ga0207686_10265916
667 Ga0207686_10338792
668 Ga0207686_11005486
669 Ga0207709_10007090
670 Ga0207709_10082415
671 Ga0207709_10367598
672 Ga0207670_11770427
673 Ga0207669_10165527
674 Ga0207669_10181945
675 Ga0207704_10491078
676 Ga0207704_11456837
677 Ga0207704_11755828
678 Ga0207689_10319844
679 Ga0207661_10038281
680 Ga0207661_10276883
681 Ga0207661_10306758
682 Ga0207661_11478161
683 Ga0207679_10147652
684 Ga0207679_11326430
685 Ga0207667_10357458
686 Ga0207667_10434398
687 Ga0207667_12141254
688 Ga0207667_12156147
689 Ga0207651_11152401
690 Ga0207712_10825561
691 Ga0207712_11192311
692 Ga0207640_10242013
693 Ga0207640_10638117
694 Ga0207677_10066267
695 Ga0207677_10789265
696 Ga0207677_10988439
697 Ga0207703_10569891
698 Ga0207639_10152794
699 Ga0207639_12216124
700 Ga0207708_10049375
701 Ga0207702_10009830
702 Ga0207702_10012177
703 Ga0207702_10096339
704 Ga0207702_10142670
705 Ga0207702_10817478
706 Ga0207648_10204987
707 Ga0207674_10080917
708 Ga0207683_10063908
709 Ga0207683_10084618
710 Ga0207698_10075405
711 Ga0268266_11098262
712 Ga0268266_12052610
713 Ga0307406_10061391
714 Ga0307409_101032562
715 Ga0395900_0005305
716 Ga0395900_0188780
717 Ga0395900_0610270
718 Ga0395900_0700275
719 Ga0395898_0003605
720 Ga0395898_0007873
721 Ga0395898_0020775
722 Ga0395898_0106985
723 Ga0395898_0275358
724 Ga0395898_0489794
725 Ga0395898_1352014
726 Ga0395898_1574323
727 Ga0395898_1643296
728 Ga0395905_0073506
729 Ga0395905_0116160
730 Ga0395905_0252734
731 Ga0395905_0384691
732 Ga0395905_1806388
733 Ga0395901_0007441
734 Ga0395901_0023245
735 Ga0395901_0114450
736 Ga0395901_0201706
737 Ga0395901_0672541
738 Ga0395901_0939559
739 Ga0451835_1201720
740 Ga0451839_0497042
741 Ga0451851_0169916
742 Ga0451853_0815237
743 Ga0451853_1172985
744 Ga0439464_0121199
745 Ga0466966_0085649
746 Ga0466966_0617491
747 Ga0466961_0120875
748 Ga0466963_0002359
749 Ga0466963_0293497
750 Ga0466964_0525004
751 Ga0466971_0061863
752 Ga0466970_0147852
753 Ga0466970_0493065
754 Ga0466957_0104776
755 Ga0466958_0052757
756 Ga0466967_0000750
757 Ga0466967_0089479
758 Ga0466967_0441182
759 Ga0466967_0684905
760 Ga0466967_0908941
761 Ga0466967_1148942
762 Ga0466967_1607338
763 Ga0466967_1821170
764 Ga0495641_0125334
765 Ga0495616_0285300
766 Ga0495616_0341345
767 Ga0495656_0063056
768 Ga0495656_0165010
769 Ga0495613_1117157
770 Ga0495589_0135174
771 Ga0495581_0487227
772 Ga0495677_0286991
773 Ga0495679_115032
774 Ga0496100_0359522
775 Ga0496100_0712578
776 Ga0496100_1056219
777 Ga0496100_1425201
778 Ga0496101_0006408
779 Ga0496101_0013118
780 Ga0496101_0815047
781 Ga0496101_0859730
782 Ga0496101_1218933
783 Ga0496102_0001583
784 Ga0496102_0064428
785 Ga0496102_0222192
786 Ga0496102_0516859
787 Ga0496103_0001717
788 Ga0496103_0018737
789 Ga0496104_0020974
790 Ga0496105_0000376
791 Ga0496106_0248836
792 Ga0496106_0482187
793 Ga0496106_0700506
794 Ga0496107_0534396
795 Ga0496107_0675209
796 Ga0496108_0023582
797 Ga0496108_0116680
798 Ga0496109_0000890
799 Ga0496109_0173063
800 Ga0496109_0262948
801 Ga0496109_1094176
802 Ga0496110_0008944
803 Ga0496110_0022055
804 Ga0496110_0038349
805 Ga0496110_0086302
806 Ga0496110_0220238
807 Ga0496111_0008565
808 Ga0496111_0024268
809 Ga0496112_0052993
810 Ga0496112_0485635
811 Ga0496112_0911309
812 Ga0496113_0125684
813 Ga0496113_0417533
814 Ga0496113_0529913
815 Ga0496114_0003361
816 Ga0496114_0006099
817 Ga0496114_0037919
818 Ga0496114_0067095
819 Ga0496114_0234672
820 Ga0496115_0055443
821 Ga0496115_0333573
822 Ga0501031_0001912
823 Ga0501032_0026846
824 Ga0501033_0047200
825 Ga0501036_0001080
826 Ga0501038_0001400
827 Ga0501040_0078386
828 Ga0501040_0183979
829 Ga0501041_0001022
830 Ga0501041_0608809
831 Ga0501042_0067248
832 Ga0501046_0773507
833 Ga0501048_0001360
834 Ga0501048_0672680
835 Ga0501048_0942587
836 Ga0501067_0125929
837 Ga0501067_0347397
838 Ga0501068_0000338
839 Ga0501070_0014105
840 Ga0501070_1226000
841 Ga0501071_0000079
842 Ga0501071_0739385
843 Ga0501071_1151953
844 Ga0501072_0000403
845 Ga0501072_0011062
846 Ga0501072_0676144
847 Ga0501072_1099123
848 Ga0501072_1111963
849 Ga0501073_0147161
850 Ga0501074_0000475
851 Ga0501074_0156268
852 Ga0501075_0336650
853 Ga0501075_0823595
854 Ga0501076_0265372
855 Ga0501076_0909874
856 Ga0501076_1481549
857 Ga0501077_0028109
858 Ga0501079_0002666
859 Ga0501079_0044307
860 Ga0501079_0089199
861 Ga0501080_0133738
862 Ga0501081_0016911
863 Ga0501081_0207161
864 Ga0501081_0938588
865 Ga0501081_1063653
866 Ga0501081_1541388
867 Ga0501083_0000131
868 Ga0501035_0251145
869 Ga0501044_0016209
870 Ga0501044_0432588
871 Ga0501045_0166772
872 nmdc:mga05p37_24673_c1
873 nmdc:mga09592_232438_c1
874 nmdc:mga0qj67_62562_c1
875 nmdc:mga06r32_2087914_c1
876 nmdc:mga06r32_28609_c1
877 nmdc:mga08y16_1579210_c1
878 nmdc:mga0n895_272711_c1
879 nmdc:mga0n895_27279_c1
880 nmdc:mga0rr50_222237_c1
881 nmdc:mga0rr50_42365_c1
882 nmdc:mga08x19_103605_c1
883 nmdc:mga08x19_487208_c1
884 nmdc:mga0a205_4667_c1
885 Ga0495595_0104057
886 Ga0501084_0001486
887 Ga0501084_0143132
888 Ga0501084_1002865
889 Ga0501082_0324098
890 Ga0501082_0518058
891 Ga0501082_1309262
892 Ga0466962_0362803
893 Ga0530510_0001984
894 Ga0530510_0074356

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hug-assembly6.cif.gz_F crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.7401 26 70
5wuq-assembly2.cif.gz_D crystal structure of sigw in complex with its anti-sigma rsiw, a zinc binding form 0.6483 28 71
3hug-assembly6.cif.gz_F crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.5635 26 70
2ouw-assembly1.cif.gz_B crystal structure of alkylhydroperoxidase ahpd core (yp_425393.1) from rhodospirillum rubrum atcc 11170 at 1.95 a resolution 0.5077 8 71
5wuq-assembly2.cif.gz_D crystal structure of sigw in complex with its anti-sigma rsiw, a zinc binding form 0.4646 28 71
ID Description Score Start End Superfamily
3hugD00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.5643 29 70 1.10.10.1320
3hugL00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.5596 29 68 1.10.10.1320
3hugH00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.5515 28 68 1.10.10.1320
af_Q2G2H5_351_453_1.10.1750.10 Mainly Alpha;Orthogonal Bundle;Chromosomal Replication Initiator Protein Dnaa; Chain: A;;DnaA protein, C-terminal DNA-binding domain 0.5011 7 69 1.10.1750.10
2ouwA00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.4906 8 71 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A538CRS3-F1-model_v4 Zf-HC2 domain-containing protein 0.9522 20 71
AF-A0A7W1YN45-F1-model_v4 Zinc-finger domain-containing protein 0.9264 28 71
AF-A0A2D6LCD1-F1-model_v4 Zf-HC2 domain-containing protein 0.9231 20 71
AF-A0A1F8U7R0-F1-model_v4 Zinc-finger domain-containing protein 0.9198 20 70
AF-A0A7J9YXC1-F1-model_v4 Zf-HC2 domain-containing protein 0.9186 13 71

Map