F445958

General Info

Members Datasets Scaffolds Average Seq Length
447 304 894 123

Family's Representative Sequence

Representative Sequence 3300025898|Ga0207692_10290331|Ga0207692_102903312
Length 133
Sequence VANIETSMKEAMAIEGAIGVALVDYTSGLTLGVMGGGATMDMNVAAAGNTDVIRAKVRTLEMLGLNDTIEDILITLDSQYHLIRLIQGRRGGEALFLYLSLSKSRANLGLARHLRRDREEGHRRRRPHHRAAR

Samples

Sample ID Description Type Environment
1 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
113 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
114 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
115 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
116 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
117 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
118 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
128 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
129 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
130 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
131 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
132 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
133 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
134 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
135 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
136 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
137 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
138 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
139 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
140 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
141 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
142 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
143 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
144 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
145 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
148 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
149 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
167 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
168 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
171 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
172 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
173 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
180 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
181 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
182 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
189 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
190 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
197 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
198 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
199 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
200 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
204 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
205 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
206 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
207 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
208 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
209 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
216 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
217 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
218 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
219 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
220 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
221 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
222 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
223 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
224 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
225 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
236 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
237 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
238 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
239 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
242 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
243 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
244 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
245 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
246 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
247 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
248 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
249 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
250 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
251 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
252 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
253 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
254 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
255 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
256 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
257 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
258 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
259 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
260 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
261 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
262 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
263 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
264 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
265 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
266 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
267 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
268 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
269 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
270 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
271 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
273 2501939600 Micromonospora sp. L5 Isolate Unclassified
274 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
275 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
276 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
277 2643221670 Streptomyces sp. Root431 Isolate Unclassified
278 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
279 2643221714 Streptomyces sp. Root264 Isolate Unclassified
280 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
281 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
282 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
283 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
284 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
285 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
286 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
287 2855683550 Micromonospora sp. RP3T Isolate Unclassified
288 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
289 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
290 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
291 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
292 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
293 2891562705 Microbispora tritici MT50 Isolate Unclassified
294 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
295 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
296 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
297 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
298 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
299 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
300 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
301 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
302 649633069 Micromonospora sp. L5 Isolate Unclassified
303 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
304 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.95
Metatranscriptomes 0.67
Isolates 7.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.74
Nodule 0
Rhizoplane 1.57
Rhizosphere 70.69
Stem 0
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207692_10290331 3300025898 Bacteria 992
2 JGI25406J46586_10020905 3300003203 Bacteria 2636
3 rootH2_10200957 3300003320 Bacteria 1651
4 rootH2_10212049 3300003320 Bacteria 2041
5 rootL2_10061623 3300003322 Bacteria 7639
6 rootL2_10297040 3300003322 Bacteria 2473
7 rootH1_10253179 3300003323 Bacteria 1668
8 Ga0006562J51391_1081732 3300003578 Bacteria 2640
9 Ga0070658_10940188 3300005327 Bacteria 752
10 Ga0070658_11902199 3300005327 Bacteria 514
11 Ga0070676_10027865 3300005328 Bacteria 3207
12 Ga0070683_100023318 3300005329 Bacteria 5535
13 Ga0070683_100473558 3300005329 Bacteria 1196
14 Ga0070670_100184027 3300005331 Bacteria 1814
15 Ga0070670_100189436 3300005331 Bacteria 1787
16 Ga0068869_100001362 3300005334 Bacteria 14490
17 Ga0068869_100658117 3300005334 Bacteria 890
18 Ga0070666_11416857 3300005335 Unclassified 519
19 Ga0070680_100093122 3300005336 Bacteria 2496
20 Ga0068868_100002517 3300005338 Bacteria 12732
21 Ga0070660_100113603 3300005339 Bacteria 2157
22 Ga0070661_100088582 3300005344 Bacteria 2291
23 Ga0070668_100000177 3300005347 Bacteria 41076
24 Ga0070668_100290765 3300005347 Bacteria 1368
25 Ga0070668_100681467 3300005347 Bacteria 905
26 Ga0070669_100359027 3300005353 Bacteria 1184
27 Ga0070675_100000671 3300005354 Bacteria 23731
28 Ga0070675_101546060 3300005354 Bacteria 612
29 Ga0070659_100017376 3300005366 Bacteria 5412
30 Ga0070667_100150272 3300005367 Bacteria 2046
31 Ga0070711_100225700 3300005439 Bacteria 1458
32 Ga0070700_100009780 3300005441 Bacteria 5272
33 Ga0070663_100033635 3300005455 Bacteria 3543
34 Ga0070663_100433550 3300005455 Bacteria 1080
35 Ga0070678_100026036 3300005456 Bacteria 3948
36 Ga0070678_101342158 3300005456 Bacteria 666
37 Ga0070662_100098949 3300005457 Bacteria 2204
38 Ga0070679_100428936 3300005530 Bacteria 1267
39 Ga0070679_100662734 3300005530 Bacteria 986
40 Ga0070679_100954998 3300005530 Bacteria 801
41 Ga0070684_100158986 3300005535 Bacteria 2049
42 Ga0068853_100005498 3300005539 Bacteria 9933
43 Ga0068853_100027011 3300005539 Bacteria 4823
44 Ga0070672_100019820 3300005543 Bacteria 4892
45 Ga0070695_100581217 3300005545 Bacteria 877
46 Ga0070693_100749907 3300005547 Bacteria 719
47 Ga0070665_100090765 3300005548 Bacteria 3061
48 Ga0070665_101138103 3300005548 Bacteria 792
49 Ga0068855_100055580 3300005563 Bacteria 4648
50 Ga0068855_102124841 3300005563 Bacteria 565
51 Ga0070664_100000813 3300005564 Bacteria 24029
52 Ga0068857_100073416 3300005577 Bacteria 3048
53 Ga0068854_100202229 3300005578 Bacteria 1562
54 Ga0070702_100937834 3300005615 Bacteria 680
55 Ga0068852_100007488 3300005616 Bacteria 7968
56 Ga0068852_100801613 3300005616 Unclassified 956
57 Ga0068859_100198242 3300005617 Bacteria 2092
58 Ga0068864_101810266 3300005618 Bacteria 616
59 Ga0068861_100152325 3300005719 Bacteria 1898
60 Ga0068861_100190760 3300005719 Bacteria 1713
61 Ga0068870_10023424 3300005840 Bacteria 3044
62 Ga0068863_100167389 3300005841 Bacteria 2108
63 Ga0068863_100367515 3300005841 Bacteria 1403
64 Ga0068858_100149029 3300005842 Bacteria 2199
65 Ga0068858_100414298 3300005842 Bacteria 1295
66 Ga0068860_100047948 3300005843 Bacteria 4071
67 Ga0068862_100072606 3300005844 Bacteria 2973
68 Ga0068862_100152164 3300005844 Bacteria 2060
69 Ga0068862_101030306 3300005844 Bacteria 815
70 Ga0081455_10035547 3300005937 Bacteria 4450
71 Ga0081455_10091215 3300005937 Bacteria 2468
72 Ga0081455_10428313 3300005937 Bacteria 910
73 Ga0081539_10000109 3300005985 Bacteria 193696
74 Ga0075368_10004717 3300006042 Bacteria 4637
75 Ga0075363_100289818 3300006048 Bacteria 948
76 Ga0075367_10264805 3300006178 Bacteria 1079
77 Ga0075370_10115396 3300006353 Bacteria 1561
78 Ga0068871_100963491 3300006358 Bacteria 793
79 Ga0068871_101831107 3300006358 Bacteria 576
80 Ga0075430_101016687 3300006846 Bacteria 683
81 Ga0097620_100198240 3300006931 Bacteria 2092
82 Ga0105251_10032595 3300009011 Bacteria 2595
83 Ga0105245_10892208 3300009098 Bacteria 930
84 Ga0105245_11543906 3300009098 Bacteria 715
85 Ga0105248_12366934 3300009177 Bacteria 605
86 Ga0105237_10889040 3300009545 Bacteria 898
87 Ga0105238_10794706 3300009551 Bacteria 962
88 Ga0105249_11397861 3300009553 Bacteria 772
89 Ga0105239_10023088 3300010375 Bacteria 6856
90 Ga0105239_10818299 3300010375 Bacteria 1067
91 Ga0105246_10220422 3300011119 Bacteria 1487
92 Ga0157369_12664880 3300013105 Bacteria 504
93 Ga0157374_10667850 3300013296 Bacteria 1051
94 Ga0157378_10274971 3300013297 Bacteria 1621
95 Ga0163162_10926384 3300013306 Bacteria 983
96 Ga0157372_11904186 3300013307 Bacteria 683
97 Ga0157372_12877391 3300013307 Bacteria 551
98 Ga0157375_10161762 3300013308 Bacteria 2381
99 Ga0157375_10902297 3300013308 Bacteria 1028
100 Ga0163163_10489926 3300014325 Bacteria 1291
101 Ga0157377_10000588 3300014745 Bacteria 15132
102 Ga0157379_10024627 3300014968 Bacteria 5342
103 Ga0206356_11567243 3300020070 Bacteria 580
104 Ga0207426_1016642 3300025302 Bacteria 2633
105 Ga0209051_1061965 3300025303 Bacteria 1172
106 Ga0209257_1079991 3300025304 Bacteria 841
107 Ga0207688_10033403 3300025901 Bacteria 2846
108 Ga0207643_10030774 3300025908 Bacteria 2990
109 Ga0207657_10291370 3300025919 Bacteria 1294
110 Ga0207649_10065700 3300025920 Bacteria 2297
111 Ga0207681_10584102 3300025923 Bacteria 922
112 Ga0207694_10359105 3300025924 Bacteria 1207
113 Ga0207650_10265570 3300025925 Bacteria 1393
114 Ga0207650_10517743 3300025925 Bacteria 998
115 Ga0207687_10015236 3300025927 Bacteria 5036
116 Ga0207690_10144943 3300025932 Bacteria 1755
117 Ga0207706_10044067 3300025933 Bacteria 3954
118 Ga0207689_10004664 3300025942 Bacteria 12390
119 Ga0207689_10659956 3300025942 Bacteria 881
120 Ga0207689_10837908 3300025942 Bacteria 776
121 Ga0207661_10008115 3300025944 Bacteria 7491
122 Ga0207661_10417884 3300025944 Bacteria 1218
123 Ga0207679_10135087 3300025945 Bacteria 1985
124 Ga0207667_10497885 3300025949 Bacteria 1236
125 Ga0207712_10876443 3300025961 Bacteria 792
126 Ga0207668_10024706 3300025972 Bacteria 3881
127 Ga0207668_10236193 3300025972 Bacteria 1476
128 Ga0207668_10277047 3300025972 Bacteria 1374
129 Ga0207640_10123322 3300025981 Bacteria 1861
130 Ga0207658_10059045 3300025986 Bacteria 2857
131 Ga0207677_10035121 3300026023 Bacteria 3252
132 Ga0207677_10177387 3300026023 Bacteria 1673
133 Ga0207703_10027674 3300026035 Bacteria 4464
134 Ga0207703_10133201 3300026035 Bacteria 2149
135 Ga0207639_10016479 3300026041 Bacteria 5231
136 Ga0207678_10019545 3300026067 Bacteria 5952
137 Ga0207678_10785090 3300026067 Unclassified 840
138 Ga0207708_10004619 3300026075 Bacteria 10134
139 Ga0207641_10820419 3300026088 Bacteria 921
140 Ga0207674_10076344 3300026116 Bacteria 3359
141 Ga0207674_10203531 3300026116 Bacteria 1929
142 Ga0207675_100181348 3300026118 Bacteria 2016
143 Ga0207675_100329007 3300026118 Bacteria 1493
144 Ga0207683_10124059 3300026121 Bacteria 2320
145 Ga0207683_11084678 3300026121 Bacteria 743
146 Ga0207698_10887566 3300026142 Bacteria 898
147 Ga0207428_10096052 3300027907 Bacteria 2295
148 Ga0268266_10069288 3300028379 Bacteria 3056
149 Ga0268266_10121498 3300028379 Bacteria 2325
150 Ga0268265_10053192 3300028380 Bacteria 3067
151 Ga0268265_11195498 3300028380 Bacteria 758
152 Ga0268264_10268745 3300028381 Bacteria 1592
153 Ga0307517_10023868 3300028786 Bacteria 7573
154 Ga0307517_10183441 3300028786 Bacteria 1345
155 Ga0307515_10000060 3300028794 Bacteria 254768
156 Ga0307515_10020972 3300028794 Bacteria 11613
157 Ga0307515_10026647 3300028794 Bacteria 9933
158 Ga0307515_10071304 3300028794 Bacteria 4710
159 Ga0307515_10312790 3300028794 Bacteria 1244
160 Ga0307511_10165073 3300030521 Bacteria 1231
161 Ga0307511_10176303 3300030521 Bacteria 1162
162 Ga0307512_10012544 3300030522 Bacteria 7996
163 Ga0307512_10040542 3300030522 Bacteria 3883
164 Ga0307512_10050047 3300030522 Bacteria 3360
165 Ga0307512_10234760 3300030522 Bacteria 937
166 Ga0307512_10282271 3300030522 Bacteria 792
167 Ga0307513_10008567 3300031456 Bacteria 13067
168 Ga0307513_10025328 3300031456 Bacteria 6877
169 Ga0307513_10037188 3300031456 Bacteria 5420
170 Ga0307513_10218772 3300031456 Bacteria 1728
171 Ga0307509_10008570 3300031507 Bacteria 12989
172 Ga0307509_10079206 3300031507 Bacteria 3402
173 Ga0307509_10186765 3300031507 Bacteria 1930
174 Ga0307508_10006596 3300031616 Bacteria 10898
175 Ga0307508_10011124 3300031616 Bacteria 8228
176 Ga0307508_10013204 3300031616 Bacteria 7557
177 Ga0307508_10044890 3300031616 Bacteria 3950
178 Ga0307508_10268351 3300031616 Bacteria 1300
179 Ga0307508_10297167 3300031616 Bacteria 1208
180 Ga0307508_10414292 3300031616 Bacteria 939
181 Ga0307514_10461755 3300031649 Bacteria 620
182 Ga0307516_10004553 3300031730 Bacteria 17047
183 Ga0307516_10030946 3300031730 Bacteria 5399
184 Ga0307516_10042400 3300031730 Bacteria 4514
185 Ga0307516_10047937 3300031730 Bacteria 4206
186 Ga0307516_10140634 3300031730 Bacteria 2184
187 Ga0307516_10204822 3300031730 Bacteria 1690
188 Ga0307516_10666583 3300031730 Bacteria 696
189 Ga0307405_10046491 3300031731 Bacteria 2667
190 Ga0307413_10220376 3300031824 Bacteria 1385
191 Ga0307518_10131444 3300031838 Bacteria 1759
192 Ga0307518_10147708 3300031838 Bacteria 1630
193 Ga0307410_10236633 3300031852 Bacteria 1413
194 Ga0307407_10462178 3300031903 Bacteria 923
195 Ga0307409_100158482 3300031995 Bacteria 1976
196 Ga0307416_100704380 3300032002 Bacteria 1099
197 Ga0307415_100053848 3300032126 Bacteria 2744
198 Ga0307415_100401575 3300032126 Bacteria 1170
199 Ga0307507_10010250 3300033179 Bacteria 12180
200 Ga0307507_10077756 3300033179 Bacteria 2948
201 Ga0307507_10331122 3300033179 Bacteria 909
202 Ga0307510_10586019 3300033180 Bacteria 565
203 Ga0307510_10651852 3300033180 Bacteria 511
204 Ga0373948_0049518 3300034817 Bacteria 899
205 Ga0373938_0006488 3300034957 Bacteria 2022
206 Ga0373928_0137888 3300035084 Bacteria 666
207 Ga0373940_0001835 3300035088 Bacteria 3975
208 Ga0373942_0000459 3300035207 Bacteria 11495
209 Ga0373962_0015962 3300035242 Bacteria 1931
210 Ga0373962_0024622 3300035242 Bacteria 1611
211 Ga0373962_0111217 3300035242 Bacteria 864
212 Ga0439436_0003336 3300041404 Bacteria 4871
213 Ga0439439_0030530 3300041406 Bacteria 1370
214 Ga0439466_0115890 3300041411 Bacteria 829
215 Ga0451791_0264724 3300041451 Bacteria 728
216 Ga0451791_1826422 3300041451 Bacteria 839
217 Ga0451797_1338834 3300041453 Bacteria 1313
218 Ga0451800_0187590 3300041459 Bacteria 773
219 Ga0451800_0375827 3300041459 Bacteria 524
220 Ga0451807_1101180 3300041486 Bacteria 532
221 Ga0451807_1157307 3300041486 Bacteria 626
222 Ga0451833_0160190 3300041491 Bacteria 840
223 Ga0451841_0131111 3300041498 Bacteria 559
224 Ga0451845_0054992 3300041501 Bacteria 631
225 Ga0451845_0930044 3300041501 Bacteria 775
226 Ga0451843_0484620 3300041509 Bacteria 1306
227 Ga0451843_1608908 3300041509 Bacteria 761
228 Ga0451853_0074330 3300041512 Bacteria 1310
229 Ga0451853_0239689 3300041512 Bacteria 4150
230 Ga0451853_0471592 3300041512 Bacteria 931
231 Ga0439449_0052375 3300042007 Bacteria 1509
232 Ga0439457_005200 3300042014 Bacteria 3302
233 Ga0439462_0013389 3300042015 Bacteria 2101
234 Ga0451577_0002744 3300042876 Bacteria 20405
235 Ga0466969_0026330 3300044656 Bacteria 2983
236 Ga0466966_0066377 3300044684 Bacteria 2267
237 Ga0466961_0070274 3300044693 Bacteria 2222
238 Ga0466963_0055575 3300044694 Bacteria 2633
239 Ga0466963_0455433 3300044694 Bacteria 903
240 Ga0466963_1079844 3300044694 Bacteria 565
241 Ga0466964_0764724 3300044706 Bacteria 543
242 Ga0453684_0531185 3300044712 Bacteria 1298
243 Ga0466971_0115728 3300044719 Bacteria 1239
244 Ga0466957_1225955 3300044842 Bacteria 543
245 Ga0466959_0016635 3300045049 Bacteria 5378
246 Ga0495592_0262724 3300046454 Bacteria 1136
247 Ga0495592_0307057 3300046454 Bacteria 1029
248 Ga0495629_0035359 3300046459 Bacteria 3531
249 Ga0495629_0070016 3300046459 Bacteria 2447
250 Ga0495629_0202665 3300046459 Bacteria 1371
251 Ga0495629_0244063 3300046459 Bacteria 1236
252 Ga0495638_0374474 3300046460 Bacteria 745
253 Ga0495641_0247528 3300046461 Bacteria 801
254 Ga0495651_0001490 3300046462 Bacteria 18109
255 Ga0495651_0004405 3300046462 Bacteria 10786
256 Ga0495580_0222133 3300046472 Bacteria 1298
257 Ga0495639_0176419 3300046475 Bacteria 1039
258 Ga0495662_0003408 3300046476 Bacteria 8059
259 Ga0495662_0023467 3300046476 Bacteria 2978
260 Ga0495664_0111424 3300046477 Bacteria 1652
261 Ga0495594_0072287 3300046499 Bacteria 1918
262 Ga0495596_0195672 3300046500 Bacteria 786
263 Ga0495607_0073448 3300046501 Bacteria 1901
264 Ga0495583_0010140 3300046506 Bacteria 5532
265 Ga0495606_0218458 3300046507 Bacteria 1076
266 Ga0495608_0324572 3300046511 Bacteria 951
267 Ga0495608_0333861 3300046511 Bacteria 935
268 Ga0495618_0798766 3300046514 Bacteria 549
269 Ga0495620_0007737 3300046515 Bacteria 5804
270 Ga0495628_0081404 3300046516 Bacteria 2515
271 Ga0495628_0360541 3300046516 Bacteria 1067
272 Ga0495630_0168291 3300046517 Bacteria 1669
273 Ga0495632_0040503 3300046519 Bacteria 2346
274 Ga0495632_0102881 3300046519 Bacteria 1345
275 Ga0495632_0209874 3300046519 Bacteria 884
276 Ga0495643_0002522 3300046522 Bacteria 14367
277 Ga0495643_0005377 3300046522 Bacteria 8664
278 Ga0495648_0224054 3300046524 Bacteria 925
279 Ga0495642_0208723 3300046528 Bacteria 852
280 Ga0495652_0123365 3300046529 Bacteria 2062
281 Ga0495652_0318604 3300046529 Bacteria 1124
282 Ga0495640_0058192 3300046533 Bacteria 2636
283 Ga0495586_0069668 3300046535 Bacteria 1920
284 Ga0495587_0017011 3300046536 Bacteria 4521
285 Ga0495645_0029670 3300046543 Bacteria 3979
286 Ga0495633_0153244 3300046558 Bacteria 1064
287 Ga0495667_0308908 3300046559 Bacteria 1001
288 Ga0495667_0492094 3300046559 Bacteria 769
289 Ga0495656_0185032 3300046615 Bacteria 1026
290 Ga0495668_0014724 3300046616 Bacteria 4580
291 Ga0495634_0004085 3300046642 Bacteria 11559
292 Ga0495634_0011481 3300046642 Bacteria 6445
293 Ga0495611_0331064 3300046648 Bacteria 700
294 Ga0495625_0180107 3300046660 Bacteria 1406
295 Ga0495625_0457584 3300046660 Bacteria 787
296 Ga0495635_0017965 3300046663 Bacteria 4938
297 Ga0495635_0265377 3300046663 Bacteria 1155
298 Ga0495661_0111511 3300046665 Bacteria 1524
299 Ga0495588_0007075 3300046674 Bacteria 5085
300 Ga0495588_0015820 3300046674 Bacteria 3637
301 Ga0495588_0041321 3300046674 Bacteria 2354
302 Ga0495588_0084386 3300046674 Bacteria 1660
303 Ga0495657_0001328 3300046675 Bacteria 21524
304 Ga0495657_0028140 3300046675 Bacteria 3957
305 Ga0495657_0060969 3300046675 Bacteria 2497
306 Ga0495657_0115773 3300046675 Bacteria 1693
307 Ga0495623_0720470 3300046679 Bacteria 510
308 Ga0495646_0000134 3300046680 Bacteria 37358
309 Ga0495658_0038672 3300046683 Bacteria 2643
310 Ga0495658_0880714 3300046683 Bacteria 572
311 Ga0495613_0001594 3300046689 Bacteria 17192
312 Ga0495613_0060332 3300046689 Bacteria 2778
313 Ga0495613_0111706 3300046689 Bacteria 1968
314 Ga0495613_0670742 3300046689 Bacteria 684
315 Ga0495624_0014717 3300046690 Bacteria 5298
316 Ga0495624_0125298 3300046690 Bacteria 1577
317 Ga0495624_0907499 3300046690 Bacteria 518
318 Ga0495670_0228347 3300046691 Bacteria 989
319 Ga0495671_0598412 3300046692 Bacteria 524
320 Ga0495649_0163304 3300046694 Bacteria 1167
321 Ga0495589_0012496 3300046794 Bacteria 4397
322 Ga0495589_0074297 3300046794 Bacteria 1659
323 Ga0495600_0032114 3300046809 Bacteria 3405
324 Ga0495600_0055981 3300046809 Bacteria 2576
325 Ga0495600_0064748 3300046809 Bacteria 2389
326 Ga0495660_0059431 3300046810 Bacteria 2056
327 Ga0495660_0130320 3300046810 Bacteria 1262
328 Ga0495581_0006559 3300047315 Bacteria 6744
329 Ga0495581_0008192 3300047315 Bacteria 6055
330 Ga0495581_0052179 3300047315 Bacteria 2362
331 Ga0495604_0016371 3300047317 Bacteria 5928
332 Ga0495604_0356009 3300047317 Bacteria 972
333 Ga0495636_0004752 3300047318 Bacteria 5329
334 Ga0495636_0019019 3300047318 Bacteria 2758
335 Ga0495674_0622660 3300047319 Bacteria 853
336 Ga0495676_0005153 3300047321 Bacteria 11970
337 Ga0495676_0008400 3300047321 Bacteria 9464
338 Ga0495676_0118138 3300047321 Bacteria 1934
339 Ga0495683_0035740 3300047323 Bacteria 2525
340 Ga0495687_008428 3300047443 Bacteria 5904
341 Ga0495687_025236 3300047443 Bacteria 2813
342 Ga0495687_052662 3300047443 Bacteria 1719
343 Ga0495675_0163649 3300047444 Bacteria 1369
344 Ga0495679_032177 3300047446 Bacteria 1685
345 Ga0495685_000493 3300047447 Bacteria 12203
346 Ga0495685_015486 3300047447 Bacteria 2601
347 Ga0495681_0015332 3300047470 Bacteria 4340
348 Ga0495686_0050042 3300047472 Bacteria 2627
349 Ga0495593_0002098 3300047673 Bacteria 11928
350 Ga0495593_0012480 3300047673 Bacteria 4856
351 Ga0495593_0020361 3300047673 Bacteria 3715
352 Ga0495614_0009584 3300048089 Bacteria 4279
353 Ga0495614_0012613 3300048089 Bacteria 3707
354 Ga0495614_0153409 3300048089 Bacteria 1028
355 Ga0495614_0329036 3300048089 Bacteria 709
356 Ga0495626_0285110 3300048091 Bacteria 655
357 Ga0495678_044478 3300049459 Bacteria 1756
358 Ga0501034_0034833 3300049571 Bacteria 5105
359 Ga0501034_1303791 3300049571 Bacteria 603
360 Ga0501036_0304775 3300049572 Bacteria 1332
361 Ga0501038_0009506 3300049574 Bacteria 8921
362 Ga0501039_1040393 3300049575 Bacteria 635
363 Ga0501043_0405130 3300049579 Bacteria 1030
364 Ga0501047_0635764 3300049581 Bacteria 887
365 Ga0501071_0900824 3300049587 Bacteria 682
366 Ga0501035_0139027 3300049822 Bacteria 2112
367 Ga0501044_0035322 3300049823 Bacteria 5235
368 nmdc:mga03n38_26315_c1 3300050490 Bacteria 2401
369 nmdc:mga06z11_936762_c1 3300050494 Bacteria 528
370 nmdc:mga07m45_130391_c1 3300050496 Bacteria 1454
371 Ga0495612_0243019 3300053078 Bacteria 800
372 Ga0495655_0005450 3300053083 Bacteria 2247
373 Ga0495619_0299960 3300053085 Bacteria 1113
374 Ga0500578_0022206 3300053086 Bacteria 4073
375 Ga0500646_0022088 3300053090 Bacteria 1700
376 Ga0500646_0046977 3300053090 Bacteria 1233
377 Ga0500646_0343452 3300053090 Bacteria 543
378 Ga0500583_0130828 3300053092 Bacteria 1245
379 Ga0500583_0430718 3300053092 Bacteria 629
380 Ga0500651_0039668 3300053093 Bacteria 2965
381 Ga0500651_0663294 3300053093 Bacteria 561
382 Ga0500640_107520 3300053095 Bacteria 1141
383 Ga0500641_0335869 3300053096 Bacteria 611
384 Ga0500650_0466357 3300053098 Bacteria 540
385 Ga0500654_061644 3300053099 Bacteria 1914
386 Ga0500553_007887 3300053101 Bacteria 5305
387 Ga0500558_285862 3300053106 Bacteria 522
388 Ga0500560_024045 3300053107 Bacteria 1774
389 Ga0500560_033017 3300053107 Bacteria 1578
390 Ga0500569_003895 3300053109 Bacteria 3093
391 Ga0500572_007094 3300053111 Bacteria 2585
392 Ga0500594_0008732 3300053118 Bacteria 2316
393 Ga0500618_123419 3300053125 Bacteria 587
394 Ga0500628_003895 3300053129 Bacteria 2463
395 Ga0500652_046502 3300053131 Bacteria 1761
396 Ga0500652_235708 3300053131 Bacteria 730
397 Ga0500658_0003531 3300053134 Bacteria 5900
398 Ga0500559_0089642 3300053136 Bacteria 1407
399 Ga0500561_0001337 3300053137 Bacteria 4010
400 Ga0500573_0042740 3300053140 Bacteria 2617
401 Ga0500573_0225282 3300053140 Bacteria 981
402 Ga0500579_067317 3300053143 Bacteria 2088
403 Ga0500579_089682 3300053143 Bacteria 1669
404 Ga0500586_247327 3300053145 Bacteria 561
405 Ga0500590_325092 3300053148 Bacteria 564
406 Ga0500600_0023115 3300053149 Bacteria 3716
407 Ga0500616_0118296 3300053153 Bacteria 1269
408 Ga0500633_0001313 3300053160 Bacteria 4604
409 Ga0500634_0044128 3300053161 Bacteria 2414
410 Ga0500656_016503 3300053732 Bacteria 875
411 Ga0500587_000986 3300053739 Bacteria 3839
412 Ga0587106_108079 3300059605 Bacteria 576
413 Ga0466962_0002288 3300061719 Bacteria 9079
414 Ga0466962_0225214 3300061719 Bacteria 919
415 2501943951 2501939600 Bacteria 6907073
416 2554258155 2554235005 Bacteria 6457341
417 2585318162 2582581314 Bacteria 11452267
418 2616698664 2616644814 Bacteria 11555299
419 2644388898 2643221670 Bacteria 6497041
420 2644441047 2643221678 Bacteria 9540101
421 2644630406 2643221714 Bacteria 9015452
422 2676488780 2675903060 Bacteria 10051191
423 2753269899 2751185782 Bacteria 11227053
424 2808846695 2808606359 Bacteria 9866990
425 2808915700 2808606375 Bacteria 9466072
426 2811848715 2808606982 Bacteria 7791042
427 2831936442 2831935698 Bacteria 5963223
428 2832005596 2832004796 Bacteria 6538017
429 2855687800 2855683550 Bacteria 7134265
430 2856745002 2856741275 Bacteria 8096094
431 2856864649 2856858025 Bacteria 7255264
432 2862282210 2862281513 Bacteria 9621493
433 2866066157 2866065130 Bacteria 6518152
434 2867510951 2867507094 Bacteria 6506033
435 2891563689 2891562705 Bacteria 8039471
436 2912760402 2912757875 Bacteria 7940295
437 2918504254 2918501144 Bacteria 8668083
438 2919468862 2919468124 Bacteria 9133025
439 2946072040 2946064051 Bacteria 8957905
440 2946072906 2946072368 Bacteria 8999607
441 2997607252 2997600082 Bacteria 9896405
442 3006487475 3006486233 Bacteria 8157040
443 3006489843 3006486233 Bacteria 8157040
444 3006499138 3006493962 Bacteria 8825450
445 649813827 649633069 Bacteria 6962533
446 8055179261 8055172936 Bacteria 9305943
447 8056669982 8056667051 Bacteria 6953971
448 Ga0207692_10290331
449 JGI25406J46586_10020905
450 rootH2_10200957
451 rootH2_10212049
452 rootL2_10061623
453 rootL2_10297040
454 rootH1_10253179
455 Ga0006562J51391_1081732
456 Ga0070658_10940188
457 Ga0070658_11902199
458 Ga0070676_10027865
459 Ga0070683_100023318
460 Ga0070683_100473558
461 Ga0070670_100184027
462 Ga0070670_100189436
463 Ga0068869_100001362
464 Ga0068869_100658117
465 Ga0070666_11416857
466 Ga0070680_100093122
467 Ga0068868_100002517
468 Ga0070660_100113603
469 Ga0070661_100088582
470 Ga0070668_100000177
471 Ga0070668_100290765
472 Ga0070668_100681467
473 Ga0070669_100359027
474 Ga0070675_100000671
475 Ga0070675_101546060
476 Ga0070659_100017376
477 Ga0070667_100150272
478 Ga0070711_100225700
479 Ga0070700_100009780
480 Ga0070663_100033635
481 Ga0070663_100433550
482 Ga0070678_100026036
483 Ga0070678_101342158
484 Ga0070662_100098949
485 Ga0070679_100428936
486 Ga0070679_100662734
487 Ga0070679_100954998
488 Ga0070684_100158986
489 Ga0068853_100005498
490 Ga0068853_100027011
491 Ga0070672_100019820
492 Ga0070695_100581217
493 Ga0070693_100749907
494 Ga0070665_100090765
495 Ga0070665_101138103
496 Ga0068855_100055580
497 Ga0068855_102124841
498 Ga0070664_100000813
499 Ga0068857_100073416
500 Ga0068854_100202229
501 Ga0070702_100937834
502 Ga0068852_100007488
503 Ga0068852_100801613
504 Ga0068859_100198242
505 Ga0068864_101810266
506 Ga0068861_100152325
507 Ga0068861_100190760
508 Ga0068870_10023424
509 Ga0068863_100167389
510 Ga0068863_100367515
511 Ga0068858_100149029
512 Ga0068858_100414298
513 Ga0068860_100047948
514 Ga0068862_100072606
515 Ga0068862_100152164
516 Ga0068862_101030306
517 Ga0081455_10035547
518 Ga0081455_10091215
519 Ga0081455_10428313
520 Ga0081539_10000109
521 Ga0075368_10004717
522 Ga0075363_100289818
523 Ga0075367_10264805
524 Ga0075370_10115396
525 Ga0068871_100963491
526 Ga0068871_101831107
527 Ga0075430_101016687
528 Ga0097620_100198240
529 Ga0105251_10032595
530 Ga0105245_10892208
531 Ga0105245_11543906
532 Ga0105248_12366934
533 Ga0105237_10889040
534 Ga0105238_10794706
535 Ga0105249_11397861
536 Ga0105239_10023088
537 Ga0105239_10818299
538 Ga0105246_10220422
539 Ga0157369_12664880
540 Ga0157374_10667850
541 Ga0157378_10274971
542 Ga0163162_10926384
543 Ga0157372_11904186
544 Ga0157372_12877391
545 Ga0157375_10161762
546 Ga0157375_10902297
547 Ga0163163_10489926
548 Ga0157377_10000588
549 Ga0157379_10024627
550 Ga0206356_11567243
551 Ga0207426_1016642
552 Ga0209051_1061965
553 Ga0209257_1079991
554 Ga0207688_10033403
555 Ga0207643_10030774
556 Ga0207657_10291370
557 Ga0207649_10065700
558 Ga0207681_10584102
559 Ga0207694_10359105
560 Ga0207650_10265570
561 Ga0207650_10517743
562 Ga0207687_10015236
563 Ga0207690_10144943
564 Ga0207706_10044067
565 Ga0207689_10004664
566 Ga0207689_10659956
567 Ga0207689_10837908
568 Ga0207661_10008115
569 Ga0207661_10417884
570 Ga0207679_10135087
571 Ga0207667_10497885
572 Ga0207712_10876443
573 Ga0207668_10024706
574 Ga0207668_10236193
575 Ga0207668_10277047
576 Ga0207640_10123322
577 Ga0207658_10059045
578 Ga0207677_10035121
579 Ga0207677_10177387
580 Ga0207703_10027674
581 Ga0207703_10133201
582 Ga0207639_10016479
583 Ga0207678_10019545
584 Ga0207678_10785090
585 Ga0207708_10004619
586 Ga0207641_10820419
587 Ga0207674_10076344
588 Ga0207674_10203531
589 Ga0207675_100181348
590 Ga0207675_100329007
591 Ga0207683_10124059
592 Ga0207683_11084678
593 Ga0207698_10887566
594 Ga0207428_10096052
595 Ga0268266_10069288
596 Ga0268266_10121498
597 Ga0268265_10053192
598 Ga0268265_11195498
599 Ga0268264_10268745
600 Ga0307517_10023868
601 Ga0307517_10183441
602 Ga0307515_10000060
603 Ga0307515_10020972
604 Ga0307515_10026647
605 Ga0307515_10071304
606 Ga0307515_10312790
607 Ga0307511_10165073
608 Ga0307511_10176303
609 Ga0307512_10012544
610 Ga0307512_10040542
611 Ga0307512_10050047
612 Ga0307512_10234760
613 Ga0307512_10282271
614 Ga0307513_10008567
615 Ga0307513_10025328
616 Ga0307513_10037188
617 Ga0307513_10218772
618 Ga0307509_10008570
619 Ga0307509_10079206
620 Ga0307509_10186765
621 Ga0307508_10006596
622 Ga0307508_10011124
623 Ga0307508_10013204
624 Ga0307508_10044890
625 Ga0307508_10268351
626 Ga0307508_10297167
627 Ga0307508_10414292
628 Ga0307514_10461755
629 Ga0307516_10004553
630 Ga0307516_10030946
631 Ga0307516_10042400
632 Ga0307516_10047937
633 Ga0307516_10140634
634 Ga0307516_10204822
635 Ga0307516_10666583
636 Ga0307405_10046491
637 Ga0307413_10220376
638 Ga0307518_10131444
639 Ga0307518_10147708
640 Ga0307410_10236633
641 Ga0307407_10462178
642 Ga0307409_100158482
643 Ga0307416_100704380
644 Ga0307415_100053848
645 Ga0307415_100401575
646 Ga0307507_10010250
647 Ga0307507_10077756
648 Ga0307507_10331122
649 Ga0307510_10586019
650 Ga0307510_10651852
651 Ga0373948_0049518
652 Ga0373938_0006488
653 Ga0373928_0137888
654 Ga0373940_0001835
655 Ga0373942_0000459
656 Ga0373962_0015962
657 Ga0373962_0024622
658 Ga0373962_0111217
659 Ga0439436_0003336
660 Ga0439439_0030530
661 Ga0439466_0115890
662 Ga0451791_0264724
663 Ga0451791_1826422
664 Ga0451797_1338834
665 Ga0451800_0187590
666 Ga0451800_0375827
667 Ga0451807_1101180
668 Ga0451807_1157307
669 Ga0451833_0160190
670 Ga0451841_0131111
671 Ga0451845_0054992
672 Ga0451845_0930044
673 Ga0451843_0484620
674 Ga0451843_1608908
675 Ga0451853_0074330
676 Ga0451853_0239689
677 Ga0451853_0471592
678 Ga0439449_0052375
679 Ga0439457_005200
680 Ga0439462_0013389
681 Ga0451577_0002744
682 Ga0466969_0026330
683 Ga0466966_0066377
684 Ga0466961_0070274
685 Ga0466963_0055575
686 Ga0466963_0455433
687 Ga0466963_1079844
688 Ga0466964_0764724
689 Ga0453684_0531185
690 Ga0466971_0115728
691 Ga0466957_1225955
692 Ga0466959_0016635
693 Ga0495592_0262724
694 Ga0495592_0307057
695 Ga0495629_0035359
696 Ga0495629_0070016
697 Ga0495629_0202665
698 Ga0495629_0244063
699 Ga0495638_0374474
700 Ga0495641_0247528
701 Ga0495651_0001490
702 Ga0495651_0004405
703 Ga0495580_0222133
704 Ga0495639_0176419
705 Ga0495662_0003408
706 Ga0495662_0023467
707 Ga0495664_0111424
708 Ga0495594_0072287
709 Ga0495596_0195672
710 Ga0495607_0073448
711 Ga0495583_0010140
712 Ga0495606_0218458
713 Ga0495608_0324572
714 Ga0495608_0333861
715 Ga0495618_0798766
716 Ga0495620_0007737
717 Ga0495628_0081404
718 Ga0495628_0360541
719 Ga0495630_0168291
720 Ga0495632_0040503
721 Ga0495632_0102881
722 Ga0495632_0209874
723 Ga0495643_0002522
724 Ga0495643_0005377
725 Ga0495648_0224054
726 Ga0495642_0208723
727 Ga0495652_0123365
728 Ga0495652_0318604
729 Ga0495640_0058192
730 Ga0495586_0069668
731 Ga0495587_0017011
732 Ga0495645_0029670
733 Ga0495633_0153244
734 Ga0495667_0308908
735 Ga0495667_0492094
736 Ga0495656_0185032
737 Ga0495668_0014724
738 Ga0495634_0004085
739 Ga0495634_0011481
740 Ga0495611_0331064
741 Ga0495625_0180107
742 Ga0495625_0457584
743 Ga0495635_0017965
744 Ga0495635_0265377
745 Ga0495661_0111511
746 Ga0495588_0007075
747 Ga0495588_0015820
748 Ga0495588_0041321
749 Ga0495588_0084386
750 Ga0495657_0001328
751 Ga0495657_0028140
752 Ga0495657_0060969
753 Ga0495657_0115773
754 Ga0495623_0720470
755 Ga0495646_0000134
756 Ga0495658_0038672
757 Ga0495658_0880714
758 Ga0495613_0001594
759 Ga0495613_0060332
760 Ga0495613_0111706
761 Ga0495613_0670742
762 Ga0495624_0014717
763 Ga0495624_0125298
764 Ga0495624_0907499
765 Ga0495670_0228347
766 Ga0495671_0598412
767 Ga0495649_0163304
768 Ga0495589_0012496
769 Ga0495589_0074297
770 Ga0495600_0032114
771 Ga0495600_0055981
772 Ga0495600_0064748
773 Ga0495660_0059431
774 Ga0495660_0130320
775 Ga0495581_0006559
776 Ga0495581_0008192
777 Ga0495581_0052179
778 Ga0495604_0016371
779 Ga0495604_0356009
780 Ga0495636_0004752
781 Ga0495636_0019019
782 Ga0495674_0622660
783 Ga0495676_0005153
784 Ga0495676_0008400
785 Ga0495676_0118138
786 Ga0495683_0035740
787 Ga0495687_008428
788 Ga0495687_025236
789 Ga0495687_052662
790 Ga0495675_0163649
791 Ga0495679_032177
792 Ga0495685_000493
793 Ga0495685_015486
794 Ga0495681_0015332
795 Ga0495686_0050042
796 Ga0495593_0002098
797 Ga0495593_0012480
798 Ga0495593_0020361
799 Ga0495614_0009584
800 Ga0495614_0012613
801 Ga0495614_0153409
802 Ga0495614_0329036
803 Ga0495626_0285110
804 Ga0495678_044478
805 Ga0501034_0034833
806 Ga0501034_1303791
807 Ga0501036_0304775
808 Ga0501038_0009506
809 Ga0501039_1040393
810 Ga0501043_0405130
811 Ga0501047_0635764
812 Ga0501071_0900824
813 Ga0501035_0139027
814 Ga0501044_0035322
815 nmdc:mga03n38_26315_c1
816 nmdc:mga06z11_936762_c1
817 nmdc:mga07m45_130391_c1
818 Ga0495612_0243019
819 Ga0495655_0005450
820 Ga0495619_0299960
821 Ga0500578_0022206
822 Ga0500646_0022088
823 Ga0500646_0046977
824 Ga0500646_0343452
825 Ga0500583_0130828
826 Ga0500583_0430718
827 Ga0500651_0039668
828 Ga0500651_0663294
829 Ga0500640_107520
830 Ga0500641_0335869
831 Ga0500650_0466357
832 Ga0500654_061644
833 Ga0500553_007887
834 Ga0500558_285862
835 Ga0500560_024045
836 Ga0500560_033017
837 Ga0500569_003895
838 Ga0500572_007094
839 Ga0500594_0008732
840 Ga0500618_123419
841 Ga0500628_003895
842 Ga0500652_046502
843 Ga0500652_235708
844 Ga0500658_0003531
845 Ga0500559_0089642
846 Ga0500561_0001337
847 Ga0500573_0042740
848 Ga0500573_0225282
849 Ga0500579_067317
850 Ga0500579_089682
851 Ga0500586_247327
852 Ga0500590_325092
853 Ga0500600_0023115
854 Ga0500616_0118296
855 Ga0500633_0001313
856 Ga0500634_0044128
857 Ga0500656_016503
858 Ga0500587_000986
859 Ga0587106_108079
860 Ga0466962_0002288
861 Ga0466962_0225214
862 2501943951
863 2554258155
864 2585318162
865 2616698664
866 2644388898
867 2644441047
868 2644630406
869 2676488780
870 2753269899
871 2808846695
872 2808915700
873 2811848715
874 2831936442
875 2832005596
876 2855687800
877 2856745002
878 2856864649
879 2862282210
880 2866066157
881 2867510951
882 2891563689
883 2912760402
884 2918504254
885 2919468862
886 2946072040
887 2946072906
888 2997607252
889 3006487475
890 3006489843
891 3006499138
892 649813827
893 8055179261
894 8056669982

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5y3a-assembly2.cif.gz_G crystal structure of ragulator complex (p18 49-161) 0.9063 4 122
5x6u-assembly1.cif.gz_B crystal structure of human heteropentameric complex 0.8924 6 122
6ehp-assembly1.cif.gz_B the crystal structure of the human lamtor complex 0.8879 5 122
7yh1-assembly2.cif.gz_C roadblock from candidatus prometheoarchaeum syntrophicum strain mk-d1 0.8795 4 123
7t3b-assembly1.cif.gz_G gator1-rag-ragulator - gap complex 0.8792 2 122
ID Description Score Start End Superfamily
af_Q58736_1_114_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.8994 4 122 3.30.450.30
af_Q9N2U6_1_121_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.8737 4 122 3.30.450.30
6b9xB00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.8731 2 122 3.30.450.30
5y39B00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.8683 6 122 3.30.450.30
af_Q58736_1_114_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.863 4 122 3.30.450.30
ID Description Score Start End GO Terms
AF-A0A511HHQ1-F1-model_v4 Roadblock/LAMTOR2 domain-containing protein 0.984 1 123
AF-A0A1H7CBT6-F1-model_v4 Roadblock/LAMTOR2 domain-containing protein 0.9836 2 123
AF-A0A1C4UHM8-F1-model_v4 Roadblock/LAMTOR2 domain-containing protein 0.9816 2 123
AF-A0A401Z2E2-F1-model_v4 Roadblock/LAMTOR2 domain-containing protein 0.9792 1 123
AF-A0A2Z5KE35-F1-model_v4 Roadblock/LC7 domain protein 0.979 2 123

Map