F445930

General Info

Members Datasets Scaffolds Average Seq Length
447 212 894 237

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10846180|Ga0114129_108461801
Length 251
Sequence MAMNARPTSRRRAIAAGLVVLVGAATAAGLALGSDHQDTPFVELNPKSDLTDVYAFPGSTAGRIVLAMDTRAFLTPAGAQDPDQGSFDHNLLYQFKIDNNGDAKEDKVIQVSFTGEGAAQQVEVRGPIAPPVQGAMNNEISDATPAVSGALKTVLGSASGIQVFAGPRDDPFFIDLEAAFCILPDRKPVGGALSQPCALQANPPGSNHYFRNPGVNYVSGFNVNSIVIELPSSMLENGTPGKLGIWGTISQ

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
147 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
148 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
149 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
150 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
154 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
161 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
162 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
193 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.72
Rhizosphere 91.05
Stem 0
Stem Tuber 0
Unclassified 20.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10846180 3300009147 Bacteria 1163
2 rootL2_10136143 3300003322 Bacteria 1782
3 Ga0070676_10002510 3300005328 Bacteria 9418
4 Ga0070690_100041576 3300005330 Unclassified 2911
5 Ga0070670_100299764 3300005331 Bacteria 1406
6 Ga0070677_10052671 3300005333 Bacteria 1652
7 Ga0068869_100006941 3300005334 Bacteria 7208
8 Ga0070666_10012446 3300005335 Bacteria 5367
9 Ga0070680_100013197 3300005336 Bacteria 6431
10 Ga0070691_10110550 3300005341 Bacteria 1374
11 Ga0070668_100143112 3300005347 Unclassified 1928
12 Ga0070668_100177773 3300005347 Bacteria 1737
13 Ga0070669_100193036 3300005353 Unclassified 1598
14 Ga0070675_100008973 3300005354 Bacteria 7767
15 Ga0070671_100001315 3300005355 Bacteria 18658
16 Ga0070674_100000069 3300005356 Bacteria 47131
17 Ga0070674_100061882 3300005356 Bacteria 2614
18 Ga0070673_100149031 3300005364 Bacteria 1980
19 Ga0070659_100075796 3300005366 Bacteria 2681
20 Ga0070659_100160439 3300005366 Unclassified 1838
21 Ga0070659_100544879 3300005366 Unclassified 993
22 Ga0070703_10027897 3300005406 Unclassified 1685
23 Ga0070703_10029929 3300005406 Bacteria 1638
24 Ga0070709_10016900 3300005434 Unclassified 4175
25 Ga0070709_10353160 3300005434 Bacteria 1087
26 Ga0070714_100318349 3300005435 Bacteria 1454
27 Ga0070713_100401488 3300005436 Bacteria 1280
28 Ga0070701_10050197 3300005438 Bacteria 2159
29 Ga0070701_10059508 3300005438 Bacteria 2009
30 Ga0070711_100000132 3300005439 Bacteria 39959
31 Ga0070705_100018049 3300005440 Bacteria 3692
32 Ga0070705_100034276 3300005440 Bacteria 2837
33 Ga0070705_100044803 3300005440 Unclassified 2542
34 Ga0070705_100115193 3300005440 Bacteria 1725
35 Ga0070705_100124866 3300005440 Bacteria 1668
36 Ga0070700_100027600 3300005441 Bacteria 3367
37 Ga0070694_100012928 3300005444 Bacteria 5205
38 Ga0070694_100064724 3300005444 Unclassified 2503
39 Ga0070694_100419101 3300005444 Bacteria 1051
40 Ga0070694_100655458 3300005444 Unclassified 850
41 Ga0070708_100002610 3300005445 Bacteria 13948
42 Ga0070708_100016970 3300005445 Bacteria 6058
43 Ga0070708_100026120 3300005445 Bacteria 4996
44 Ga0070708_100144571 3300005445 Unclassified 2208
45 Ga0070708_100144841 3300005445 Bacteria 2206
46 Ga0070708_100146974 3300005445 Unclassified 2190
47 Ga0070708_100155341 3300005445 Bacteria 2130
48 Ga0070708_100260083 3300005445 Unclassified 1631
49 Ga0070708_100279577 3300005445 Bacteria 1571
50 Ga0070708_100371403 3300005445 Unclassified 1348
51 Ga0070708_100928344 3300005445 Unclassified 817
52 Ga0070678_100147654 3300005456 Bacteria 1890
53 Ga0070662_100002742 3300005457 Bacteria 10889
54 Ga0070662_100230216 3300005457 Bacteria 1482
55 Ga0070662_100653697 3300005457 Unclassified 887
56 Ga0070681_10132039 3300005458 Bacteria 2429
57 Ga0068867_100002961 3300005459 Bacteria 11958
58 Ga0070706_100004664 3300005467 Bacteria 13147
59 Ga0070706_100217525 3300005467 Bacteria 1783
60 Ga0070706_100522388 3300005467 Unclassified 1104
61 Ga0070707_100000266 3300005468 Bacteria 51948
62 Ga0070707_100003729 3300005468 Bacteria 14376
63 Ga0070707_100135488 3300005468 Bacteria 2396
64 Ga0070707_100252844 3300005468 Bacteria 1715
65 Ga0070707_100413882 3300005468 Unclassified 1308
66 Ga0070707_100497446 3300005468 Bacteria 1181
67 Ga0070698_100000668 3300005471 Bacteria 36568
68 Ga0070698_100001479 3300005471 Bacteria 26097
69 Ga0070698_100005927 3300005471 Bacteria 13328
70 Ga0070698_100027989 3300005471 Bacteria 5857
71 Ga0070698_100033433 3300005471 Bacteria 5327
72 Ga0070698_100057333 3300005471 Bacteria 3941
73 Ga0070698_100262119 3300005471 Bacteria 1661
74 Ga0070699_100000723 3300005518 Bacteria 30601
75 Ga0070699_100001235 3300005518 Bacteria 23564
76 Ga0070699_100001479 3300005518 Bacteria 21520
77 Ga0070699_100006406 3300005518 Bacteria 10250
78 Ga0070699_100007572 3300005518 Bacteria 9441
79 Ga0070699_100013698 3300005518 Bacteria 6976
80 Ga0070699_100019219 3300005518 Bacteria 5879
81 Ga0070699_100153121 3300005518 Bacteria 2040
82 Ga0070699_100196451 3300005518 Bacteria 1793
83 Ga0070699_100579351 3300005518 Unclassified 1022
84 Ga0070679_100079114 3300005530 Bacteria 3277
85 Ga0070697_100013007 3300005536 Bacteria 6523
86 Ga0070697_100097296 3300005536 Unclassified 2442
87 Ga0070697_100180997 3300005536 Bacteria 1786
88 Ga0070697_100205410 3300005536 Unclassified 1675
89 Ga0070697_100219388 3300005536 Bacteria 1621
90 Ga0070697_100259590 3300005536 Bacteria 1487
91 Ga0070697_100461833 3300005536 Bacteria 1107
92 Ga0070697_100575749 3300005536 Unclassified 988
93 Ga0070697_100737680 3300005536 Bacteria 870
94 Ga0070672_100381324 3300005543 Unclassified 1206
95 Ga0070686_100316302 3300005544 Unclassified 1162
96 Ga0070695_100002531 3300005545 Bacteria 10557
97 Ga0070695_100004641 3300005545 Bacteria 8074
98 Ga0070696_100000241 3300005546 Bacteria 32915
99 Ga0070696_100009848 3300005546 Bacteria 6392
100 Ga0070696_100056404 3300005546 Bacteria 2740
101 Ga0070696_100219043 3300005546 Unclassified 1427
102 Ga0070693_100142100 3300005547 Unclassified 1512
103 Ga0070665_100266609 3300005548 Bacteria 1714
104 Ga0070704_100000123 3300005549 Bacteria 28063
105 Ga0070704_100001634 3300005549 Bacteria 12152
106 Ga0070704_100010065 3300005549 Bacteria 5745
107 Ga0070704_100067131 3300005549 Bacteria 2589
108 Ga0070704_100242061 3300005549 Bacteria 1477
109 Ga0070704_100482890 3300005549 Bacteria 1072
110 Ga0070664_100147983 3300005564 Bacteria 2072
111 Ga0070664_100239997 3300005564 Bacteria 1627
112 Ga0068857_100011807 3300005577 Bacteria 7597
113 Ga0068854_100003232 3300005578 Bacteria 10161
114 Ga0068854_100337964 3300005578 Unclassified 1229
115 Ga0070702_100004555 3300005615 Bacteria 6343
116 Ga0068859_100005282 3300005617 Bacteria 13129
117 Ga0068859_100028194 3300005617 Bacteria 5629
118 Ga0068859_100107453 3300005617 Bacteria 2851
119 Ga0068859_100228033 3300005617 Bacteria 1951
120 Ga0068859_101015681 3300005617 Unclassified 911
121 Ga0068864_100000669 3300005618 Bacteria 28600
122 Ga0068864_100133797 3300005618 Bacteria 2231
123 Ga0068864_100201232 3300005618 Bacteria 1830
124 Ga0068864_100312947 3300005618 Bacteria 1473
125 Ga0068866_10000619 3300005718 Bacteria 16200
126 Ga0068861_100021579 3300005719 Bacteria 4629
127 Ga0068861_100262118 3300005719 Unclassified 1480
128 Ga0068861_100308421 3300005719 Bacteria 1374
129 Ga0068870_10011991 3300005840 Bacteria 4036
130 Ga0068863_100075913 3300005841 Bacteria 3179
131 Ga0068863_100428241 3300005841 Bacteria 1297
132 Ga0068858_100045418 3300005842 Bacteria 4071
133 Ga0068858_100111478 3300005842 Bacteria 2555
134 Ga0068858_100576395 3300005842 Unclassified 1090
135 Ga0068860_100092183 3300005843 Bacteria 2887
136 Ga0068860_100439734 3300005843 Unclassified 1295
137 Ga0068862_100017050 3300005844 Bacteria 6043
138 Ga0068862_100080608 3300005844 Bacteria 2822
139 Ga0070712_100251248 3300006175 Unclassified 1413
140 Ga0097621_100025205 3300006237 Bacteria 4651
141 Ga0097621_100222514 3300006237 Bacteria 1645
142 Ga0068871_100193658 3300006358 Unclassified 1752
143 Ga0075428_100051464 3300006844 Unclassified 4516
144 Ga0075428_100207017 3300006844 Unclassified 2120
145 Ga0075428_100417940 3300006844 Bacteria 1437
146 Ga0075430_100169709 3300006846 Unclassified 1815
147 Ga0075430_100263151 3300006846 Bacteria 1428
148 Ga0075430_100267905 3300006846 Bacteria 1414
149 Ga0075430_100324009 3300006846 Unclassified 1274
150 Ga0075431_100018830 3300006847 Bacteria 7033
151 Ga0075431_100034262 3300006847 Bacteria 5232
152 Ga0075431_100119368 3300006847 Bacteria 2721
153 Ga0075431_100582639 3300006847 Bacteria 1104
154 Ga0075431_100713610 3300006847 Bacteria 980
155 Ga0075433_10000784 3300006852 Bacteria 21949
156 Ga0075433_10005515 3300006852 Bacteria 9934
157 Ga0075433_10018554 3300006852 Bacteria 5786
158 Ga0075433_10161570 3300006852 Unclassified 1994
159 Ga0075433_10435120 3300006852 Bacteria 1156
160 Ga0075434_100001037 3300006871 Bacteria 22656
161 Ga0075434_100004576 3300006871 Bacteria 12496
162 Ga0075434_100010075 3300006871 Bacteria 8851
163 Ga0075434_100030607 3300006871 Bacteria 5301
164 Ga0075434_100289021 3300006871 Bacteria 1659
165 Ga0075434_100777805 3300006871 Bacteria 974
166 Ga0075429_100001536 3300006880 Bacteria 18919
167 Ga0075429_100058713 3300006880 Bacteria 3351
168 Ga0075429_100087881 3300006880 Bacteria 2709
169 Ga0075436_100001795 3300006914 Bacteria 14706
170 Ga0075436_100059024 3300006914 Bacteria 2650
171 Ga0075436_100080497 3300006914 Bacteria 2257
172 Ga0075436_100091126 3300006914 Bacteria 2119
173 Ga0075436_100117699 3300006914 Bacteria 1857
174 Ga0097620_100005282 3300006931 Bacteria 13129
175 Ga0097620_100028194 3300006931 Bacteria 5629
176 Ga0097620_100107453 3300006931 Bacteria 2851
177 Ga0097620_100228021 3300006931 Bacteria 1951
178 Ga0097620_101015750 3300006931 Unclassified 911
179 Ga0075435_100018185 3300007076 Bacteria 5337
180 Ga0075435_100638261 3300007076 Unclassified 924
181 Ga0105240_10005769 3300009093 Bacteria 18361
182 Ga0111539_10076984 3300009094 Bacteria 3927
183 Ga0111539_10174664 3300009094 Unclassified 2509
184 Ga0105245_10046580 3300009098 Bacteria 3875
185 Ga0105247_10228017 3300009101 Bacteria 1264
186 Ga0114129_10000136 3300009147 Bacteria 76070
187 Ga0114129_10091419 3300009147 Bacteria 4217
188 Ga0114129_10096117 3300009147 Bacteria 4102
189 Ga0114129_10525393 3300009147 Bacteria 1542
190 Ga0105243_10003139 3300009148 Bacteria 13569
191 Ga0105243_10148662 3300009148 Bacteria 2007
192 Ga0105241_10001507 3300009174 Bacteria 17870
193 Ga0105241_10129310 3300009174 Unclassified 2043
194 Ga0105242_10002497 3300009176 Bacteria 14419
195 Ga0105248_10028363 3300009177 Bacteria 6237
196 Ga0105248_10085886 3300009177 Bacteria 3540
197 Ga0105248_10119059 3300009177 Unclassified 2979
198 Ga0105249_10013776 3300009553 Bacteria 7143
199 Ga0105239_10011262 3300010375 Bacteria 9976
200 Ga0105246_10058252 3300011119 Bacteria 2676
201 Ga0157371_10177590 3300013102 Bacteria 1522
202 Ga0157378_10000788 3300013297 Bacteria 29413
203 Ga0157372_10416481 3300013307 Bacteria 1566
204 Ga0163163_10123834 3300014325 Bacteria 2621
205 Ga0157380_10157101 3300014326 Bacteria 1972
206 Ga0157380_10589357 3300014326 Bacteria 1098
207 Ga0157379_10098598 3300014968 Unclassified 2623
208 Ga0157376_10118045 3300014969 Bacteria 2347
209 Ga0163161_10076579 3300017792 Unclassified 2455
210 Ga0207697_10060321 3300025315 Bacteria 1577
211 Ga0207653_10005217 3300025885 Bacteria 4060
212 Ga0207653_10020986 3300025885 Bacteria 2070
213 Ga0207653_10052812 3300025885 Bacteria 1356
214 Ga0207682_10053351 3300025893 Bacteria 1677
215 Ga0207692_10237577 3300025898 Bacteria 1087
216 Ga0207642_10001673 3300025899 Bacteria 6844
217 Ga0207647_10155162 3300025904 Bacteria 1337
218 Ga0207685_10174041 3300025905 Bacteria 993
219 Ga0207699_10075192 3300025906 Bacteria 2077
220 Ga0207645_10002871 3300025907 Bacteria 13343
221 Ga0207643_10003297 3300025908 Bacteria 8717
222 Ga0207684_10024903 3300025910 Bacteria 5100
223 Ga0207684_10028775 3300025910 Bacteria 4733
224 Ga0207684_10098987 3300025910 Bacteria 2490
225 Ga0207684_10187273 3300025910 Bacteria 1785
226 Ga0207684_10416050 3300025910 Unclassified 1155
227 Ga0207654_10005096 3300025911 Bacteria 6629
228 Ga0207707_10201455 3300025912 Bacteria 1735
229 Ga0207695_10022752 3300025913 Bacteria 7102
230 Ga0207693_10358123 3300025915 Bacteria 1141
231 Ga0207663_10000034 3300025916 Bacteria 88414
232 Ga0207660_10126297 3300025917 Unclassified 1943
233 Ga0207646_10005847 3300025922 Bacteria 12859
234 Ga0207646_10014096 3300025922 Bacteria 7603
235 Ga0207646_10027461 3300025922 Bacteria 5190
236 Ga0207646_10079758 3300025922 Bacteria 2927
237 Ga0207646_10167735 3300025922 Unclassified 1982
238 Ga0207646_10368682 3300025922 Bacteria 1297
239 Ga0207646_10505365 3300025922 Bacteria 1089
240 Ga0207681_10019368 3300025923 Bacteria 4299
241 Ga0207681_10291919 3300025923 Unclassified 1287
242 Ga0207659_10126322 3300025926 Bacteria 1967
243 Ga0207687_10093116 3300025927 Bacteria 2202
244 Ga0207644_10044278 3300025931 Bacteria 3161
245 Ga0207690_10142461 3300025932 Unclassified 1768
246 Ga0207690_10153329 3300025932 Unclassified 1710
247 Ga0207690_10159025 3300025932 Bacteria 1682
248 Ga0207706_10000005 3300025933 Bacteria 224460
249 Ga0207706_10316669 3300025933 Bacteria 1358
250 Ga0207686_10000129 3300025934 Bacteria 61050
251 Ga0207709_10004559 3300025935 Bacteria 7984
252 Ga0207669_10262721 3300025937 Unclassified 1292
253 Ga0207669_10419813 3300025937 Bacteria 1052
254 Ga0207704_10000234 3300025938 Bacteria 27372
255 Ga0207704_10154127 3300025938 Bacteria 1626
256 Ga0207665_10037617 3300025939 Unclassified 3221
257 Ga0207665_10499615 3300025939 Bacteria 939
258 Ga0207691_10091429 3300025940 Bacteria 2727
259 Ga0207691_10368890 3300025940 Unclassified 1226
260 Ga0207711_10000854 3300025941 Bacteria 29448
261 Ga0207711_10103969 3300025941 Bacteria 2516
262 Ga0207711_10110926 3300025941 Bacteria 2440
263 Ga0207711_10997384 3300025941 Unclassified 777
264 Ga0207689_10007761 3300025942 Bacteria 9389
265 Ga0207679_10380008 3300025945 Bacteria 1238
266 Ga0207651_10064995 3300025960 Unclassified 2556
267 Ga0207712_10002537 3300025961 Bacteria 11743
268 Ga0207668_10016197 3300025972 Bacteria 4647
269 Ga0207668_10142096 3300025972 Bacteria 1847
270 Ga0207640_10002079 3300025981 Bacteria 10782
271 Ga0207658_10045388 3300025986 Bacteria 3203
272 Ga0207658_10196767 3300025986 Bacteria 1680
273 Ga0207639_10261571 3300026041 Bacteria 1514
274 Ga0207678_10364132 3300026067 Bacteria 1248
275 Ga0207708_10053860 3300026075 Bacteria 3066
276 Ga0207641_10059718 3300026088 Bacteria 3248
277 Ga0207648_10000021 3300026089 Bacteria 139257
278 Ga0207676_10012912 3300026095 Bacteria 5999
279 Ga0207676_10029099 3300026095 Bacteria 4133
280 Ga0207674_10007225 3300026116 Bacteria 12959
281 Ga0207674_10923511 3300026116 Bacteria 841
282 Ga0207675_100025136 3300026118 Bacteria 5542
283 Ga0207683_10003172 3300026121 Bacteria 14354
284 Ga0207428_10242401 3300027907 Unclassified 1346
285 Ga0268265_10004810 3300028380 Bacteria 9310
286 Ga0268265_10018198 3300028380 Bacteria 4866
287 Ga0268265_10161151 3300028380 Bacteria 1906
288 Ga0307408_100466670 3300031548 Bacteria 1098
289 Ga0307413_10164617 3300031824 Bacteria 1562
290 Ga0307410_10038000 3300031852 Unclassified 3150
291 Ga0307410_10200281 3300031852 Bacteria 1524
292 Ga0307406_10290995 3300031901 Bacteria 1250
293 Ga0307406_10411212 3300031901 Unclassified 1075
294 Ga0307412_10766255 3300031911 Bacteria 834
295 Ga0307409_100025765 3300031995 Bacteria 4133
296 Ga0307409_100128758 3300031995 Bacteria 2159
297 Ga0307409_100346304 3300031995 Bacteria 1400
298 Ga0307416_100245646 3300032002 Unclassified 1738
299 Ga0307416_100335883 3300032002 Bacteria 1521
300 Ga0307416_100400355 3300032002 Bacteria 1410
301 Ga0307411_10014487 3300032005 Bacteria 4390
302 Ga0307411_10069529 3300032005 Bacteria 2378
303 Ga0307411_10180673 3300032005 Bacteria 1601
304 Ga0373930_0023236 3300034816 Bacteria 1232
305 Ga0373940_0042313 3300035088 Bacteria 1255
306 Ga0373940_0068173 3300035088 Bacteria 1031
307 Ga0373939_0101348 3300035114 Bacteria 989
308 Ga0373941_0109564 3300035115 Bacteria 972
309 Ga0373960_0119964 3300035121 Bacteria 872
310 Ga0373931_0114454 3300035691 Bacteria 1534
311 Ga0395905_0193605 3300037471 Bacteria 1907
312 Ga0395905_0522927 3300037471 Bacteria 1087
313 Ga0439448_0004606 3300042005 Bacteria 3900
314 Ga0439455_0017648 3300042012 Unclassified 1666
315 Ga0451577_0205976 3300042876 Bacteria 1776
316 Ga0451577_0230242 3300042876 Bacteria 1676
317 Ga0453683_0094728 3300044673 Bacteria 1873
318 Ga0453684_0325359 3300044712 Bacteria 1740
319 Ga0453684_0668066 3300044712 Unclassified 1132
320 Ga0451576_0108496 3300045051 Bacteria 2888
321 Ga0451576_0444641 3300045051 Bacteria 1360
322 Ga0495603_0009207 3300046455 Bacteria 5968
323 Ga0495603_0043549 3300046455 Bacteria 2680
324 Ga0495585_0097972 3300046492 Bacteria 1572
325 Ga0495594_0023646 3300046499 Bacteria 3294
326 Ga0495594_0055646 3300046499 Bacteria 2182
327 Ga0495659_0035337 3300046664 Bacteria 1761
328 Ga0496100_0121494 3300048903 Bacteria 1828
329 Ga0496100_0203852 3300048903 Bacteria 1443
330 Ga0496100_0474256 3300048903 Unclassified 962
331 Ga0496101_0077047 3300048904 Bacteria 2457
332 Ga0496101_0097277 3300048904 Bacteria 2198
333 Ga0496102_0022191 3300048905 Bacteria 5622
334 Ga0496102_0062843 3300048905 Unclassified 3400
335 Ga0496102_0171967 3300048905 Bacteria 2039
336 Ga0496102_0845242 3300048905 Bacteria 837
337 Ga0496104_0101016 3300048907 Bacteria 2761
338 Ga0496104_0113858 3300048907 Bacteria 2594
339 Ga0496104_0133954 3300048907 Unclassified 2380
340 Ga0496106_0103182 3300048909 Unclassified 2213
341 Ga0496106_0187454 3300048909 Unclassified 1644
342 Ga0496106_0355357 3300048909 Bacteria 1177
343 Ga0496106_0631656 3300048909 Bacteria 856
344 Ga0496107_0088559 3300048910 Unclassified 2260
345 Ga0496107_0155148 3300048910 Bacteria 1695
346 Ga0496107_0766582 3300048910 Unclassified 707
347 Ga0496108_0002786 3300048911 Bacteria 14010
348 Ga0496108_0005189 3300048911 Bacteria 10528
349 Ga0496108_0008684 3300048911 Bacteria 8238
350 Ga0496108_0028973 3300048911 Unclassified 4581
351 Ga0496109_0020704 3300048912 Bacteria 5809
352 Ga0496109_0101112 3300048912 Unclassified 2675
353 Ga0496109_0523558 3300048912 Bacteria 1119
354 Ga0496110_0005207 3300048913 Bacteria 10177
355 Ga0496110_0095736 3300048913 Unclassified 2659
356 Ga0496110_0187300 3300048913 Bacteria 1879
357 Ga0496110_0364529 3300048913 Unclassified 1316
358 Ga0496111_0061680 3300048914 Unclassified 2718
359 Ga0496111_0066139 3300048914 Bacteria 2624
360 Ga0496111_0094256 3300048914 Unclassified 2195
361 Ga0496112_0000607 3300048915 Bacteria 24660
362 Ga0496113_0000097 3300048916 Bacteria 36693
363 Ga0496113_0043813 3300048916 Unclassified 3313
364 Ga0496113_0082323 3300048916 Unclassified 2468
365 Ga0496113_0218538 3300048916 Bacteria 1518
366 Ga0496115_0180918 3300048918 Bacteria 1743
367 Ga0501031_0484600 3300049568 Bacteria 798
368 Ga0501033_0119309 3300049570 Bacteria 1915
369 Ga0501033_0208554 3300049570 Bacteria 1394
370 Ga0501033_0341984 3300049570 Bacteria 1049
371 Ga0501037_0031644 3300049573 Bacteria 3907
372 Ga0501038_0120447 3300049574 Bacteria 2165
373 Ga0501040_0287559 3300049576 Bacteria 1174
374 Ga0501041_0069608 3300049577 Bacteria 2159
375 Ga0501042_0047291 3300049578 Bacteria 3068
376 Ga0501042_0210839 3300049578 Bacteria 1401
377 Ga0501042_0298182 3300049578 Bacteria 1164
378 Ga0501043_0228505 3300049579 Bacteria 1438
379 Ga0501046_0083246 3300049580 Bacteria 2470
380 Ga0501048_0218437 3300049582 Bacteria 1352
381 Ga0501048_0273266 3300049582 Bacteria 1201
382 Ga0501067_0027395 3300049583 Bacteria 3157
383 Ga0501068_0271933 3300049584 Unclassified 1082
384 Ga0501069_0072124 3300049585 Unclassified 1936
385 Ga0501069_0199094 3300049585 Unclassified 1160
386 Ga0501070_0319582 3300049586 Bacteria 1263
387 Ga0501071_0029450 3300049587 Bacteria 3875
388 Ga0501072_0042981 3300049588 Bacteria 3551
389 Ga0501072_0051131 3300049588 Bacteria 3254
390 Ga0501072_0114675 3300049588 Bacteria 2145
391 Ga0501073_0337115 3300049589 Bacteria 1041
392 Ga0501073_0382875 3300049589 Bacteria 972
393 Ga0501075_0030735 3300049591 Bacteria 3980
394 Ga0501076_0052061 3300049592 Bacteria 3242
395 Ga0501076_0101316 3300049592 Bacteria 2321
396 Ga0501077_0002212 3300049593 Bacteria 11726
397 Ga0501077_0008022 3300049593 Bacteria 6528
398 Ga0501077_0070007 3300049593 Bacteria 2223
399 Ga0501079_0017367 3300049741 Bacteria 5495
400 Ga0501079_0115536 3300049741 Bacteria 2086
401 Ga0501079_0273507 3300049741 Bacteria 1320
402 Ga0501080_0143579 3300049742 Bacteria 2206
403 Ga0501081_0032825 3300049743 Bacteria 3524
404 Ga0501081_0143171 3300049743 Bacteria 1714
405 Ga0501083_0242245 3300049744 Bacteria 1174
406 Ga0501035_0302268 3300049822 Bacteria 1348
407 Ga0501045_0012248 3300049824 Bacteria 6042
408 Ga0501045_0087336 3300049824 Bacteria 2303
409 nmdc:mga05p37_10437_c1 3300050507 Bacteria 11023
410 nmdc:mga05p37_1288520_c1 3300050507 Unclassified 746
411 nmdc:mga05p37_14676_c2 3300050507 Bacteria 8563
412 nmdc:mga05p37_292992_c1 3300050507 Bacteria 1936
413 nmdc:mga05p37_325795_c1 3300050507 Unclassified 1816
414 nmdc:mga05p37_565338_c1 3300050507 Bacteria 1291
415 nmdc:mga05p37_582830_c1 3300050507 Bacteria 1266
416 nmdc:mga09592_18295_c1 3300050508 Bacteria 5745
417 nmdc:mga09592_48140_c1 3300050508 Bacteria 3594
418 nmdc:mga0qj67_34254_c1 3300050509 Bacteria 3966
419 nmdc:mga06r32_108242_c1 3300050510 Unclassified 1970
420 nmdc:mga06r32_591660_c1 3300050510 Bacteria 1081
421 nmdc:mga08y16_472222_c1 3300050511 Bacteria 1277
422 nmdc:mga0n895_317843_c1 3300050512 Bacteria 1578
423 nmdc:mga0n895_388_c1 3300050512 Bacteria 29481
424 nmdc:mga0n895_3949_c1 3300050512 Bacteria 12054
425 nmdc:mga0n895_5118_c1 3300050512 Bacteria 10897
426 nmdc:mga0n895_60118_c1 3300050512 Bacteria 3749
427 nmdc:mga0n895_6534_c1 3300050512 Bacteria 9921
428 nmdc:mga0n895_657644_c1 3300050512 Bacteria 1046
429 nmdc:mga0n895_8257_c1 3300050512 Bacteria 9006
430 nmdc:mga0rr50_103441_c1 3300050513 Bacteria 2241
431 nmdc:mga0rr50_67198_c1 3300050513 Bacteria 2722
432 nmdc:mga08x19_18583_c1 3300050514 Unclassified 4259
433 nmdc:mga08x19_26296_c1 3300050514 Bacteria 3631
434 nmdc:mga08x19_80349_c1 3300050514 Unclassified 2140
435 nmdc:mga08x19_85444_c1 3300050514 Bacteria 2076
436 nmdc:mga0a205_194610_c1 3300050515 Unclassified 1919
437 nmdc:mga0a205_21115_c1 3300050515 Bacteria 6157
438 nmdc:mga0a205_283731_c1 3300050515 Unclassified 1531
439 nmdc:mga0a205_480793_c1 3300050515 Unclassified 1100
440 nmdc:mga0a205_493_c1 3300050515 Bacteria 30906
441 nmdc:mga0a205_57286_c1 3300050515 Unclassified 3763
442 nmdc:mga0a205_628210_c1 3300050515 Unclassified 926
443 Ga0501084_0004696 3300054114 Bacteria 11158
444 Ga0501084_0048705 3300054114 Bacteria 3547
445 Ga0501082_0029276 3300060353 Bacteria 4743
446 Ga0501082_0225590 3300060353 Bacteria 1630
447 Ga0501082_0347542 3300060353 Bacteria 1293
448 Ga0114129_10846180
449 rootL2_10136143
450 Ga0070676_10002510
451 Ga0070690_100041576
452 Ga0070670_100299764
453 Ga0070677_10052671
454 Ga0068869_100006941
455 Ga0070666_10012446
456 Ga0070680_100013197
457 Ga0070691_10110550
458 Ga0070668_100143112
459 Ga0070668_100177773
460 Ga0070669_100193036
461 Ga0070675_100008973
462 Ga0070671_100001315
463 Ga0070674_100000069
464 Ga0070674_100061882
465 Ga0070673_100149031
466 Ga0070659_100075796
467 Ga0070659_100160439
468 Ga0070659_100544879
469 Ga0070703_10027897
470 Ga0070703_10029929
471 Ga0070709_10016900
472 Ga0070709_10353160
473 Ga0070714_100318349
474 Ga0070713_100401488
475 Ga0070701_10050197
476 Ga0070701_10059508
477 Ga0070711_100000132
478 Ga0070705_100018049
479 Ga0070705_100034276
480 Ga0070705_100044803
481 Ga0070705_100115193
482 Ga0070705_100124866
483 Ga0070700_100027600
484 Ga0070694_100012928
485 Ga0070694_100064724
486 Ga0070694_100419101
487 Ga0070694_100655458
488 Ga0070708_100002610
489 Ga0070708_100016970
490 Ga0070708_100026120
491 Ga0070708_100144571
492 Ga0070708_100144841
493 Ga0070708_100146974
494 Ga0070708_100155341
495 Ga0070708_100260083
496 Ga0070708_100279577
497 Ga0070708_100371403
498 Ga0070708_100928344
499 Ga0070678_100147654
500 Ga0070662_100002742
501 Ga0070662_100230216
502 Ga0070662_100653697
503 Ga0070681_10132039
504 Ga0068867_100002961
505 Ga0070706_100004664
506 Ga0070706_100217525
507 Ga0070706_100522388
508 Ga0070707_100000266
509 Ga0070707_100003729
510 Ga0070707_100135488
511 Ga0070707_100252844
512 Ga0070707_100413882
513 Ga0070707_100497446
514 Ga0070698_100000668
515 Ga0070698_100001479
516 Ga0070698_100005927
517 Ga0070698_100027989
518 Ga0070698_100033433
519 Ga0070698_100057333
520 Ga0070698_100262119
521 Ga0070699_100000723
522 Ga0070699_100001235
523 Ga0070699_100001479
524 Ga0070699_100006406
525 Ga0070699_100007572
526 Ga0070699_100013698
527 Ga0070699_100019219
528 Ga0070699_100153121
529 Ga0070699_100196451
530 Ga0070699_100579351
531 Ga0070679_100079114
532 Ga0070697_100013007
533 Ga0070697_100097296
534 Ga0070697_100180997
535 Ga0070697_100205410
536 Ga0070697_100219388
537 Ga0070697_100259590
538 Ga0070697_100461833
539 Ga0070697_100575749
540 Ga0070697_100737680
541 Ga0070672_100381324
542 Ga0070686_100316302
543 Ga0070695_100002531
544 Ga0070695_100004641
545 Ga0070696_100000241
546 Ga0070696_100009848
547 Ga0070696_100056404
548 Ga0070696_100219043
549 Ga0070693_100142100
550 Ga0070665_100266609
551 Ga0070704_100000123
552 Ga0070704_100001634
553 Ga0070704_100010065
554 Ga0070704_100067131
555 Ga0070704_100242061
556 Ga0070704_100482890
557 Ga0070664_100147983
558 Ga0070664_100239997
559 Ga0068857_100011807
560 Ga0068854_100003232
561 Ga0068854_100337964
562 Ga0070702_100004555
563 Ga0068859_100005282
564 Ga0068859_100028194
565 Ga0068859_100107453
566 Ga0068859_100228033
567 Ga0068859_101015681
568 Ga0068864_100000669
569 Ga0068864_100133797
570 Ga0068864_100201232
571 Ga0068864_100312947
572 Ga0068866_10000619
573 Ga0068861_100021579
574 Ga0068861_100262118
575 Ga0068861_100308421
576 Ga0068870_10011991
577 Ga0068863_100075913
578 Ga0068863_100428241
579 Ga0068858_100045418
580 Ga0068858_100111478
581 Ga0068858_100576395
582 Ga0068860_100092183
583 Ga0068860_100439734
584 Ga0068862_100017050
585 Ga0068862_100080608
586 Ga0070712_100251248
587 Ga0097621_100025205
588 Ga0097621_100222514
589 Ga0068871_100193658
590 Ga0075428_100051464
591 Ga0075428_100207017
592 Ga0075428_100417940
593 Ga0075430_100169709
594 Ga0075430_100263151
595 Ga0075430_100267905
596 Ga0075430_100324009
597 Ga0075431_100018830
598 Ga0075431_100034262
599 Ga0075431_100119368
600 Ga0075431_100582639
601 Ga0075431_100713610
602 Ga0075433_10000784
603 Ga0075433_10005515
604 Ga0075433_10018554
605 Ga0075433_10161570
606 Ga0075433_10435120
607 Ga0075434_100001037
608 Ga0075434_100004576
609 Ga0075434_100010075
610 Ga0075434_100030607
611 Ga0075434_100289021
612 Ga0075434_100777805
613 Ga0075429_100001536
614 Ga0075429_100058713
615 Ga0075429_100087881
616 Ga0075436_100001795
617 Ga0075436_100059024
618 Ga0075436_100080497
619 Ga0075436_100091126
620 Ga0075436_100117699
621 Ga0097620_100005282
622 Ga0097620_100028194
623 Ga0097620_100107453
624 Ga0097620_100228021
625 Ga0097620_101015750
626 Ga0075435_100018185
627 Ga0075435_100638261
628 Ga0105240_10005769
629 Ga0111539_10076984
630 Ga0111539_10174664
631 Ga0105245_10046580
632 Ga0105247_10228017
633 Ga0114129_10000136
634 Ga0114129_10091419
635 Ga0114129_10096117
636 Ga0114129_10525393
637 Ga0105243_10003139
638 Ga0105243_10148662
639 Ga0105241_10001507
640 Ga0105241_10129310
641 Ga0105242_10002497
642 Ga0105248_10028363
643 Ga0105248_10085886
644 Ga0105248_10119059
645 Ga0105249_10013776
646 Ga0105239_10011262
647 Ga0105246_10058252
648 Ga0157371_10177590
649 Ga0157378_10000788
650 Ga0157372_10416481
651 Ga0163163_10123834
652 Ga0157380_10157101
653 Ga0157380_10589357
654 Ga0157379_10098598
655 Ga0157376_10118045
656 Ga0163161_10076579
657 Ga0207697_10060321
658 Ga0207653_10005217
659 Ga0207653_10020986
660 Ga0207653_10052812
661 Ga0207682_10053351
662 Ga0207692_10237577
663 Ga0207642_10001673
664 Ga0207647_10155162
665 Ga0207685_10174041
666 Ga0207699_10075192
667 Ga0207645_10002871
668 Ga0207643_10003297
669 Ga0207684_10024903
670 Ga0207684_10028775
671 Ga0207684_10098987
672 Ga0207684_10187273
673 Ga0207684_10416050
674 Ga0207654_10005096
675 Ga0207707_10201455
676 Ga0207695_10022752
677 Ga0207693_10358123
678 Ga0207663_10000034
679 Ga0207660_10126297
680 Ga0207646_10005847
681 Ga0207646_10014096
682 Ga0207646_10027461
683 Ga0207646_10079758
684 Ga0207646_10167735
685 Ga0207646_10368682
686 Ga0207646_10505365
687 Ga0207681_10019368
688 Ga0207681_10291919
689 Ga0207659_10126322
690 Ga0207687_10093116
691 Ga0207644_10044278
692 Ga0207690_10142461
693 Ga0207690_10153329
694 Ga0207690_10159025
695 Ga0207706_10000005
696 Ga0207706_10316669
697 Ga0207686_10000129
698 Ga0207709_10004559
699 Ga0207669_10262721
700 Ga0207669_10419813
701 Ga0207704_10000234
702 Ga0207704_10154127
703 Ga0207665_10037617
704 Ga0207665_10499615
705 Ga0207691_10091429
706 Ga0207691_10368890
707 Ga0207711_10000854
708 Ga0207711_10103969
709 Ga0207711_10110926
710 Ga0207711_10997384
711 Ga0207689_10007761
712 Ga0207679_10380008
713 Ga0207651_10064995
714 Ga0207712_10002537
715 Ga0207668_10016197
716 Ga0207668_10142096
717 Ga0207640_10002079
718 Ga0207658_10045388
719 Ga0207658_10196767
720 Ga0207639_10261571
721 Ga0207678_10364132
722 Ga0207708_10053860
723 Ga0207641_10059718
724 Ga0207648_10000021
725 Ga0207676_10012912
726 Ga0207676_10029099
727 Ga0207674_10007225
728 Ga0207674_10923511
729 Ga0207675_100025136
730 Ga0207683_10003172
731 Ga0207428_10242401
732 Ga0268265_10004810
733 Ga0268265_10018198
734 Ga0268265_10161151
735 Ga0307408_100466670
736 Ga0307413_10164617
737 Ga0307410_10038000
738 Ga0307410_10200281
739 Ga0307406_10290995
740 Ga0307406_10411212
741 Ga0307412_10766255
742 Ga0307409_100025765
743 Ga0307409_100128758
744 Ga0307409_100346304
745 Ga0307416_100245646
746 Ga0307416_100335883
747 Ga0307416_100400355
748 Ga0307411_10014487
749 Ga0307411_10069529
750 Ga0307411_10180673
751 Ga0373930_0023236
752 Ga0373940_0042313
753 Ga0373940_0068173
754 Ga0373939_0101348
755 Ga0373941_0109564
756 Ga0373960_0119964
757 Ga0373931_0114454
758 Ga0395905_0193605
759 Ga0395905_0522927
760 Ga0439448_0004606
761 Ga0439455_0017648
762 Ga0451577_0205976
763 Ga0451577_0230242
764 Ga0453683_0094728
765 Ga0453684_0325359
766 Ga0453684_0668066
767 Ga0451576_0108496
768 Ga0451576_0444641
769 Ga0495603_0009207
770 Ga0495603_0043549
771 Ga0495585_0097972
772 Ga0495594_0023646
773 Ga0495594_0055646
774 Ga0495659_0035337
775 Ga0496100_0121494
776 Ga0496100_0203852
777 Ga0496100_0474256
778 Ga0496101_0077047
779 Ga0496101_0097277
780 Ga0496102_0022191
781 Ga0496102_0062843
782 Ga0496102_0171967
783 Ga0496102_0845242
784 Ga0496104_0101016
785 Ga0496104_0113858
786 Ga0496104_0133954
787 Ga0496106_0103182
788 Ga0496106_0187454
789 Ga0496106_0355357
790 Ga0496106_0631656
791 Ga0496107_0088559
792 Ga0496107_0155148
793 Ga0496107_0766582
794 Ga0496108_0002786
795 Ga0496108_0005189
796 Ga0496108_0008684
797 Ga0496108_0028973
798 Ga0496109_0020704
799 Ga0496109_0101112
800 Ga0496109_0523558
801 Ga0496110_0005207
802 Ga0496110_0095736
803 Ga0496110_0187300
804 Ga0496110_0364529
805 Ga0496111_0061680
806 Ga0496111_0066139
807 Ga0496111_0094256
808 Ga0496112_0000607
809 Ga0496113_0000097
810 Ga0496113_0043813
811 Ga0496113_0082323
812 Ga0496113_0218538
813 Ga0496115_0180918
814 Ga0501031_0484600
815 Ga0501033_0119309
816 Ga0501033_0208554
817 Ga0501033_0341984
818 Ga0501037_0031644
819 Ga0501038_0120447
820 Ga0501040_0287559
821 Ga0501041_0069608
822 Ga0501042_0047291
823 Ga0501042_0210839
824 Ga0501042_0298182
825 Ga0501043_0228505
826 Ga0501046_0083246
827 Ga0501048_0218437
828 Ga0501048_0273266
829 Ga0501067_0027395
830 Ga0501068_0271933
831 Ga0501069_0072124
832 Ga0501069_0199094
833 Ga0501070_0319582
834 Ga0501071_0029450
835 Ga0501072_0042981
836 Ga0501072_0051131
837 Ga0501072_0114675
838 Ga0501073_0337115
839 Ga0501073_0382875
840 Ga0501075_0030735
841 Ga0501076_0052061
842 Ga0501076_0101316
843 Ga0501077_0002212
844 Ga0501077_0008022
845 Ga0501077_0070007
846 Ga0501079_0017367
847 Ga0501079_0115536
848 Ga0501079_0273507
849 Ga0501080_0143579
850 Ga0501081_0032825
851 Ga0501081_0143171
852 Ga0501083_0242245
853 Ga0501035_0302268
854 Ga0501045_0012248
855 Ga0501045_0087336
856 nmdc:mga05p37_10437_c1
857 nmdc:mga05p37_1288520_c1
858 nmdc:mga05p37_14676_c2
859 nmdc:mga05p37_292992_c1
860 nmdc:mga05p37_325795_c1
861 nmdc:mga05p37_565338_c1
862 nmdc:mga05p37_582830_c1
863 nmdc:mga09592_18295_c1
864 nmdc:mga09592_48140_c1
865 nmdc:mga0qj67_34254_c1
866 nmdc:mga06r32_108242_c1
867 nmdc:mga06r32_591660_c1
868 nmdc:mga08y16_472222_c1
869 nmdc:mga0n895_317843_c1
870 nmdc:mga0n895_388_c1
871 nmdc:mga0n895_3949_c1
872 nmdc:mga0n895_5118_c1
873 nmdc:mga0n895_60118_c1
874 nmdc:mga0n895_6534_c1
875 nmdc:mga0n895_657644_c1
876 nmdc:mga0n895_8257_c1
877 nmdc:mga0rr50_103441_c1
878 nmdc:mga0rr50_67198_c1
879 nmdc:mga08x19_18583_c1
880 nmdc:mga08x19_26296_c1
881 nmdc:mga08x19_80349_c1
882 nmdc:mga08x19_85444_c1
883 nmdc:mga0a205_194610_c1
884 nmdc:mga0a205_21115_c1
885 nmdc:mga0a205_283731_c1
886 nmdc:mga0a205_480793_c1
887 nmdc:mga0a205_493_c1
888 nmdc:mga0a205_57286_c1
889 nmdc:mga0a205_628210_c1
890 Ga0501084_0004696
891 Ga0501084_0048705
892 Ga0501082_0029276
893 Ga0501082_0225590
894 Ga0501082_0347542

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14224

DUF4331

Domain of unknown function (DUF4331)

131

251

0.86

PF14224

DUF4331

Domain of unknown function (DUF4331)

34

142

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oyc-assembly1.cif.gz_r1 cryo-em structure of the xenopus egg 80s ribosome 0.7179 50 71
4zel-assembly1.cif.gz_B human dopamine beta-hydroxylase 0.5241 43 114
6i6u-assembly1.cif.gz_A circular permutant of ribosomal protein s6, adding 9aa to n terminal of p81-82, l75a mutant 0.5214 47 76
6i6y-assembly1.cif.gz_A-2 circular permutant of ribosomal protein s6, swap helix 2 0.5145 47 76
4zel-assembly1.cif.gz_A human dopamine beta-hydroxylase 0.5122 43 122
ID Description Score Start End Superfamily
af_Q9JIA7_1_128_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6233 45 68 2.30.29.30
af_Q9LMG7_144_249_2.60.40.380 Mainly Beta;Sandwich;Immunoglobulin-like;Purple acid phosphatase-like, N-terminal 0.5702 48 112 2.60.40.380
af_A0A0R0JVS6_754_835_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.5693 48 70 3.30.200.20
af_K7MYK9_1_69_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.5398 93 129 3.40.630.30
af_Q9SFU3_63_179_2.60.40.380 Mainly Beta;Sandwich;Immunoglobulin-like;Purple acid phosphatase-like, N-terminal 0.521 47 112 2.60.40.380
ID Description Score Start End GO Terms
AF-A0A2V7PSJ8-F1-model_v4 DUF4331 domain-containing protein 0.7721 25 153
AF-A0A2V7PSJ8-F1-model_v4 DUF4331 domain-containing protein 0.648 25 153
AF-A0A2V7G935-F1-model_v4 Molecular chaperone DnaK 0.6279 24 232
AF-A0A317I9B8-F1-model_v4 Molecular chaperone DnaK 0.6274 31 232
AF-A0A1H8XKN5-F1-model_v4 DUF4331 domain-containing protein 0.6219 45 232

Map