F445891

General Info

Members Datasets Scaffolds Average Seq Length
447 200 894 96

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10169541|Ga0070709_101695411
Length 113
Sequence VLGHRIEILIYRRSEEAMAVRLVVTITAAPGKGSELAQVYKARCEECMREPGCEQFEIFQSALNPDKLTLLERWSDQAALDAHAKLNATRPALRPELRIGSGEREDYEYKRTR

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
82 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
118 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
121 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
122 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
123 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
156 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
157 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
165 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
184 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
196 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
200 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.11
Metatranscriptomes 0.89
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 95.97
Stem 0
Stem Tuber 0
Unclassified 26.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10169541 3300005434 Bacteria 1524
2 Ga0065707_10250825 3300005295 Bacteria 1126
3 Ga0070690_100147304 3300005330 Bacteria 1603
4 Ga0070690_101482880 3300005330 Unclassified 548
5 Ga0070666_11513523 3300005335 Bacteria 502
6 Ga0070680_102008088 3300005336 Unclassified 501
7 Ga0068868_100533177 3300005338 Unclassified 1032
8 Ga0070689_100230538 3300005340 Bacteria 1522
9 Ga0070689_100760085 3300005340 Bacteria 850
10 Ga0070692_10977170 3300005345 Bacteria 590
11 Ga0070675_101174051 3300005354 Unclassified 706
12 Ga0070671_100031588 3300005355 Bacteria 4375
13 Ga0070674_100347233 3300005356 Bacteria 1197
14 Ga0070688_101432859 3300005365 Bacteria 560
15 Ga0070667_101449447 3300005367 Unclassified 644
16 Ga0070714_100262847 3300005435 Bacteria 1598
17 Ga0070714_100566900 3300005435 Unclassified 1088
18 Ga0070713_100034030 3300005436 Bacteria 4089
19 Ga0070713_100294821 3300005436 Unclassified 1492
20 Ga0070713_102149565 3300005436 Unclassified 541
21 Ga0070710_10047326 3300005437 Bacteria 2398
22 Ga0070710_10162006 3300005437 Bacteria 1388
23 Ga0070701_10152548 3300005438 Bacteria 1332
24 Ga0070701_10618639 3300005438 Bacteria 719
25 Ga0070711_100123481 3300005439 Bacteria 1919
26 Ga0070711_100141378 3300005439 Bacteria 1805
27 Ga0070711_100193708 3300005439 Bacteria 1564
28 Ga0070711_100265454 3300005439 Bacteria 1352
29 Ga0070711_101616040 3300005439 Unclassified 567
30 Ga0070711_101630784 3300005439 Unclassified 564
31 Ga0070705_100267249 3300005440 Bacteria 1209
32 Ga0070705_100918358 3300005440 Unclassified 705
33 Ga0070700_100732045 3300005441 Unclassified 789
34 Ga0070708_100029017 3300005445 Bacteria 4767
35 Ga0070708_100038625 3300005445 Bacteria 4172
36 Ga0070708_100039563 3300005445 Unclassified 4126
37 Ga0070708_100076068 3300005445 Bacteria 3031
38 Ga0070708_100137536 3300005445 Unclassified 2264
39 Ga0070708_100350441 3300005445 Bacteria 1391
40 Ga0070708_100621268 3300005445 Bacteria 1018
41 Ga0070681_11567574 3300005458 Bacteria 584
42 Ga0068867_101018787 3300005459 Bacteria 752
43 Ga0070706_100005665 3300005467 Bacteria 11884
44 Ga0070706_100041740 3300005467 Bacteria 4236
45 Ga0070706_100140335 3300005467 Bacteria 2256
46 Ga0070706_100186479 3300005467 Bacteria 1938
47 Ga0070706_100268479 3300005467 Bacteria 1592
48 Ga0070706_100751029 3300005467 Bacteria 904
49 Ga0070706_101178598 3300005467 Unclassified 704
50 Ga0070706_101719627 3300005467 Unclassified 571
51 Ga0070706_101805983 3300005467 Bacteria 556
52 Ga0070707_100077659 3300005468 Plasmid 3204
53 Ga0070707_100078899 3300005468 Bacteria 3177
54 Ga0070707_100107048 3300005468 Unclassified 2712
55 Ga0070707_100107927 3300005468 Bacteria 2701
56 Ga0070707_100147481 3300005468 Bacteria 2290
57 Ga0070707_100204684 3300005468 Bacteria 1924
58 Ga0070707_100206059 3300005468 Bacteria 1917
59 Ga0070707_100240649 3300005468 Bacteria 1761
60 Ga0070707_100956026 3300005468 Bacteria 822
61 Ga0070707_102067847 3300005468 Unclassified 537
62 Ga0070698_100000939 3300005471 Bacteria 31911
63 Ga0070698_100084340 3300005471 Bacteria 3165
64 Ga0070698_100153327 3300005471 Bacteria 2250
65 Ga0070698_100199536 3300005471 Bacteria 1937
66 Ga0070698_100457789 3300005471 Bacteria 1211
67 Ga0070698_100676518 3300005471 Bacteria 974
68 Ga0070698_101636398 3300005471 Unclassified 596
69 Ga0070698_102168160 3300005471 Bacteria 509
70 Ga0070699_100102662 3300005518 Bacteria 2507
71 Ga0070699_100289923 3300005518 Bacteria 1467
72 Ga0070699_100337419 3300005518 Unclassified 1356
73 Ga0070699_100952085 3300005518 Bacteria 787
74 Ga0070699_101096732 3300005518 Unclassified 730
75 Ga0070699_102114663 3300005518 Unclassified 514
76 Ga0070697_100009513 3300005536 Bacteria 7597
77 Ga0070697_100158130 3300005536 Bacteria 1914
78 Ga0070697_100260174 3300005536 Bacteria 1485
79 Ga0070697_100274754 3300005536 Bacteria 1445
80 Ga0070697_100295352 3300005536 Unclassified 1392
81 Ga0070697_100367898 3300005536 Bacteria 1244
82 Ga0070697_100458130 3300005536 Unclassified 1111
83 Ga0070697_100599271 3300005536 Unclassified 968
84 Ga0070697_101466778 3300005536 Bacteria 610
85 Ga0070672_100766033 3300005543 Bacteria 848
86 Ga0070686_100954756 3300005544 Unclassified 701
87 Ga0070695_100171064 3300005545 Bacteria 1532
88 Ga0070696_100024374 3300005546 Bacteria 4112
89 Ga0070693_100436681 3300005547 Unclassified 916
90 Ga0070693_101583678 3300005547 Bacteria 514
91 Ga0070704_100009078 3300005549 Bacteria 5999
92 Ga0070704_100055256 3300005549 Bacteria 2814
93 Ga0070704_100115067 3300005549 Unclassified 2054
94 Ga0068857_100471440 3300005577 Bacteria 1176
95 Ga0068857_101021210 3300005577 Bacteria 796
96 Ga0070702_100745623 3300005615 Bacteria 751
97 Ga0070702_101512545 3300005615 Unclassified 552
98 Ga0068859_100280043 3300005617 Bacteria 1760
99 Ga0068859_102483891 3300005617 Unclassified 571
100 Ga0068864_100734429 3300005618 Bacteria 967
101 Ga0068861_102106626 3300005719 Unclassified 564
102 Ga0068863_100527865 3300005841 Unclassified 1164
103 Ga0068863_102644220 3300005841 Unclassified 511
104 Ga0068858_101564447 3300005842 Unclassified 650
105 Ga0068860_100160491 3300005843 Unclassified 2168
106 Ga0068860_101118367 3300005843 Bacteria 807
107 Ga0068862_100090204 3300005844 Unclassified 2668
108 Ga0068862_100308614 3300005844 Bacteria 1457
109 Ga0068862_101677502 3300005844 Unclassified 643
110 Ga0081455_10175768 3300005937 Bacteria 1626
111 Ga0081538_10007785 3300005981 Bacteria 9202
112 Ga0081540_1003326 3300005983 Bacteria 12747
113 Ga0081540_1047111 3300005983 Bacteria 2170
114 Ga0070717_10004350 3300006028 Bacteria 10217
115 Ga0070717_10395032 3300006028 Bacteria 1242
116 Ga0075432_10051987 3300006058 Bacteria 1447
117 Ga0075432_10139018 3300006058 Unclassified 925
118 Ga0070716_101056570 3300006173 Unclassified 645
119 Ga0070712_100292012 3300006175 Bacteria 1316
120 Ga0070712_100758809 3300006175 Unclassified 830
121 Ga0070712_101398031 3300006175 Unclassified 611
122 Ga0075428_100001744 3300006844 Bacteria 23202
123 Ga0075428_100002701 3300006844 Bacteria 19310
124 Ga0075428_100123333 3300006844 Bacteria 2820
125 Ga0075428_100451138 3300006844 Bacteria 1378
126 Ga0075428_100519957 3300006844 Bacteria 1273
127 Ga0075428_101299889 3300006844 Unclassified 765
128 Ga0075428_102077314 3300006844 Unclassified 588
129 Ga0075430_100008765 3300006846 Bacteria 8535
130 Ga0075430_100312373 3300006846 Bacteria 1300
131 Ga0075431_100028251 3300006847 Bacteria 5760
132 Ga0075431_100048860 3300006847 Bacteria 4363
133 Ga0075431_100058301 3300006847 Bacteria 3984
134 Ga0075431_100189169 3300006847 Bacteria 2110
135 Ga0075431_100723474 3300006847 Bacteria 972
136 Ga0075431_100800932 3300006847 Bacteria 915
137 Ga0075431_101712519 3300006847 Bacteria 585
138 Ga0075433_10005142 3300006852 Bacteria 10263
139 Ga0075433_10079200 3300006852 Unclassified 2895
140 Ga0075433_10118628 3300006852 Bacteria 2348
141 Ga0075433_10274991 3300006852 Bacteria 1493
142 Ga0075433_10275924 3300006852 Unclassified 1490
143 Ga0075433_10313593 3300006852 Bacteria 1388
144 Ga0075433_10475052 3300006852 Bacteria 1101
145 Ga0075433_10540943 3300006852 Unclassified 1024
146 Ga0075433_11247233 3300006852 Bacteria 645
147 Ga0075434_100000331 3300006871 Bacteria 34017
148 Ga0075434_100035424 3300006871 Bacteria 4934
149 Ga0075434_100273354 3300006871 Bacteria 1709
150 Ga0075434_100375283 3300006871 Bacteria 1443
151 Ga0075434_100516817 3300006871 Bacteria 1214
152 Ga0075434_100589903 3300006871 Bacteria 1130
153 Ga0075434_101356396 3300006871 Bacteria 721
154 Ga0075434_102422395 3300006871 Unclassified 527
155 Ga0075429_100007163 3300006880 Bacteria 9677
156 Ga0075429_100032293 3300006880 Bacteria 4550
157 Ga0075429_100044301 3300006880 Bacteria 3871
158 Ga0075429_100077871 3300006880 Bacteria 2889
159 Ga0075429_100079220 3300006880 Bacteria 2864
160 Ga0075429_100163333 3300006880 Bacteria 1950
161 Ga0075429_100245871 3300006880 Bacteria 1566
162 Ga0068865_102083542 3300006881 Unclassified 515
163 Ga0075436_100028799 3300006914 Bacteria 3821
164 Ga0075436_100236919 3300006914 Bacteria 1297
165 Ga0075436_100240129 3300006914 Bacteria 1288
166 Ga0097620_100280033 3300006931 Bacteria 1760
167 Ga0097620_102483950 3300006931 Unclassified 571
168 Ga0075435_100014724 3300007076 Bacteria 5861
169 Ga0075435_100059083 3300007076 Bacteria 3108
170 Ga0075435_100201757 3300007076 Unclassified 1685
171 Ga0075435_100339827 3300007076 Bacteria 1286
172 Ga0075435_101064997 3300007076 Bacteria 707
173 Ga0075435_101081519 3300007076 Bacteria 701
174 Ga0099794_10157577 3300007265 Unclassified 1154
175 Ga0099795_10022834 3300007788 Unclassified 2070
176 Ga0099795_10284220 3300007788 Bacteria 723
177 Ga0099795_10596165 3300007788 Unclassified 525
178 Ga0105250_10107595 3300009092 Bacteria 1140
179 Ga0111539_10002440 3300009094 Bacteria 24721
180 Ga0111539_10003294 3300009094 Bacteria 21343
181 Ga0111539_10016820 3300009094 Bacteria 9059
182 Ga0111539_10724851 3300009094 Bacteria 1157
183 Ga0111539_10959760 3300009094 Unclassified 994
184 Ga0114129_10008345 3300009147 Bacteria 14773
185 Ga0114129_10051695 3300009147 Bacteria 5768
186 Ga0114129_10089216 3300009147 Bacteria 4274
187 Ga0114129_10154321 3300009147 Bacteria 3141
188 Ga0114129_10223950 3300009147 Bacteria 2536
189 Ga0114129_10699649 3300009147 Bacteria 1303
190 Ga0114129_13199532 3300009147 Unclassified 532
191 Ga0105243_11851250 3300009148 Bacteria 635
192 Ga0105243_12242305 3300009148 Unclassified 583
193 Ga0105241_11363232 3300009174 Unclassified 678
194 Ga0105248_11701648 3300009177 Bacteria 715
195 Ga0105237_12343390 3300009545 Bacteria 544
196 Ga0105249_10074889 3300009553 Unclassified 3134
197 Ga0105249_10175791 3300009553 Bacteria 2080
198 Ga0105249_10325346 3300009553 Bacteria 1549
199 Ga0099796_10003109 3300010159 Bacteria 3786
200 Ga0099796_10020420 3300010159 Bacteria 2024
201 Ga0099796_10042285 3300010159 Bacteria 1547
202 Ga0105239_11461987 3300010375 Bacteria 789
203 Ga0157373_11444268 3300013100 Unclassified 524
204 Ga0163162_10304056 3300013306 Bacteria 1727
205 Ga0157375_12510219 3300013308 Bacteria 615
206 Ga0157380_12261926 3300014326 Unclassified 608
207 Ga0157377_10857887 3300014745 Unclassified 675
208 Ga0157379_10330580 3300014968 Unclassified 1393
209 Ga0157379_10709595 3300014968 Bacteria 944
210 Ga0184601_102578 3300019183 Bacteria 546
211 Ga0184600_148126 3300019190 Bacteria 1131
212 Ga0213873_10006778 3300021358 Bacteria 2266
213 Ga0213874_10360724 3300021377 Unclassified 559
214 Ga0213876_10090062 3300021384 Bacteria 1625
215 Ga0213876_10160698 3300021384 Bacteria 1195
216 Ga0213875_10000552 3300021388 Bacteria 30617
217 Ga0213875_10001029 3300021388 Bacteria 19798
218 Ga0213875_10440001 3300021388 Bacteria 624
219 Ga0213875_10583594 3300021388 Unclassified 539
220 Ga0207692_10287848 3300025898 Unclassified 996
221 Ga0207692_10329445 3300025898 Bacteria 936
222 Ga0207699_10167447 3300025906 Bacteria 1468
223 Ga0207699_10229019 3300025906 Unclassified 1272
224 Ga0207684_10003590 3300025910 Bacteria 15103
225 Ga0207684_10035313 3300025910 Bacteria 4245
226 Ga0207684_10087161 3300025910 Bacteria 2659
227 Ga0207684_10107741 3300025910 Bacteria 2384
228 Ga0207684_10183884 3300025910 Bacteria 1802
229 Ga0207684_10233372 3300025910 Bacteria 1587
230 Ga0207684_10302658 3300025910 Bacteria 1379
231 Ga0207684_11675016 3300025910 Bacteria 513
232 Ga0207693_10057404 3300025915 Bacteria 3051
233 Ga0207693_10099244 3300025915 Bacteria 2283
234 Ga0207693_10268128 3300025915 Bacteria 1338
235 Ga0207693_10537728 3300025915 Unclassified 912
236 Ga0207663_10688584 3300025916 Bacteria 809
237 Ga0207663_11291021 3300025916 Bacteria 588
238 Ga0207646_10023474 3300025922 Bacteria 5665
239 Ga0207646_10199279 3300025922 Bacteria 1808
240 Ga0207646_10323586 3300025922 Bacteria 1393
241 Ga0207646_11096857 3300025922 Unclassified 701
242 Ga0207681_10818375 3300025923 Bacteria 778
243 Ga0207650_10813806 3300025925 Bacteria 792
244 Ga0207650_11880971 3300025925 Unclassified 506
245 Ga0207700_10518081 3300025928 Bacteria 1056
246 Ga0207700_11553408 3300025928 Unclassified 586
247 Ga0207664_10555616 3300025929 Bacteria 1030
248 Ga0207644_10158665 3300025931 Bacteria 1756
249 Ga0207644_11741346 3300025931 Unclassified 522
250 Ga0207665_11052029 3300025939 Unclassified 648
251 Ga0207665_11652976 3300025939 Unclassified 507
252 Ga0207691_10631337 3300025940 Bacteria 906
253 Ga0207711_10298160 3300025941 Bacteria 1486
254 Ga0207712_10234523 3300025961 Bacteria 1475
255 Ga0207712_10238495 3300025961 Bacteria 1464
256 Ga0207668_10735815 3300025972 Bacteria 869
257 Ga0207677_11451050 3300026023 Bacteria 633
258 Ga0207703_11209044 3300026035 Bacteria 727
259 Ga0207708_10444845 3300026075 Bacteria 1078
260 Ga0207641_10308507 3300026088 Unclassified 1497
261 Ga0207641_12096574 3300026088 Unclassified 566
262 Ga0207648_11149405 3300026089 Bacteria 729
263 Ga0207676_10108057 3300026095 Bacteria 2322
264 Ga0207676_10860069 3300026095 Unclassified 887
265 Ga0207674_10397015 3300026116 Bacteria 1333
266 Ga0207675_100252097 3300026118 Bacteria 1709
267 Ga0207428_10000190 3300027907 Bacteria 85215
268 Ga0207428_10001023 3300027907 Bacteria 30966
269 Ga0207428_10024226 3300027907 Bacteria 5098
270 Ga0207428_10504474 3300027907 Bacteria 878
271 Ga0268265_10020236 3300028380 Bacteria 4643
272 Ga0268265_10063643 3300028380 Bacteria 2838
273 Ga0268264_10280469 3300028381 Bacteria 1561
274 Ga0268264_11191148 3300028381 Bacteria 771
275 Ga0265764_102312 3300030882 Bacteria 925
276 Ga0265320_10079903 3300031240 Bacteria 1528
277 Ga0307408_100210183 3300031548 Unclassified 1581
278 Ga0307411_10164766 3300032005 Bacteria 1665
279 Ga0316053_102826 3300032120 Bacteria 1003
280 Ga0373940_0056371 3300035088 Unclassified 1114
281 Ga0373923_0185698 3300035111 Bacteria 957
282 Ga0373936_0053700 3300035113 Bacteria 1634
283 Ga0373953_0041909 3300035117 Bacteria 1823
284 Ga0373954_0011498 3300035118 Bacteria 3924
285 Ga0373956_0020528 3300035119 Bacteria 2812
286 Ga0373956_0026484 3300035119 Bacteria 2512
287 Ga0373957_0005024 3300035120 Bacteria 4080
288 Ga0373955_0011928 3300035172 Bacteria 4163
289 Ga0373955_0293455 3300035172 Bacteria 980
290 Ga0373924_0023256 3300035410 Bacteria 2429
291 Ga0373935_0129869 3300035692 Unclassified 1692
292 Ga0373933_0014340 3300035724 Bacteria 4406
293 Ga0373933_0032836 3300035724 Bacteria 3018
294 Ga0373947_0101128 3300035725 Bacteria 1812
295 Ga0373937_0007342 3300036401 Bacteria 9542
296 Ga0373937_0112157 3300036401 Bacteria 2536
297 Ga0373937_0136088 3300036401 Bacteria 2297
298 Ga0373937_0526587 3300036401 Bacteria 1123
299 Ga0373925_0038926 3300037068 Plasmid 3517
300 Ga0436364_0393226 3300037853 Bacteria 35432
301 Ga0436364_1284200 3300037853 Bacteria 100206
302 Ga0436364_1291972 3300037853 Unclassified 2168
303 Ga0436364_1421881 3300037853 Unclassified 599
304 Ga0436365_0475562 3300039437 Unclassified 537
305 Ga0436365_0553851 3300039437 Bacteria 1154
306 Ga0436365_0555968 3300039437 Bacteria 2579
307 Ga0436365_0975887 3300039437 Bacteria 1166
308 Ga0436365_1909668 3300039437 Bacteria 1831
309 Ga0436360_0564934 3300039438 Bacteria 909
310 Ga0436363_1020221 3300039450 Unclassified 3850
311 Ga0436363_1652362 3300039450 Bacteria 1260
312 Ga0436362_0104642 3300039453 Unclassified 2125
313 Ga0436362_0229672 3300039453 Bacteria 680
314 Ga0436362_1118228 3300039453 Bacteria 3222
315 Ga0451577_0188548 3300042876 Unclassified 1860
316 Ga0451577_0744162 3300042876 Bacteria 887
317 Ga0453683_0127027 3300044673 Bacteria 1606
318 Ga0453683_0681925 3300044673 Bacteria 673
319 Ga0451576_0281629 3300045051 Bacteria 1738
320 Ga0451576_0282206 3300045051 Unclassified 1736
321 Ga0495592_0029551 3300046454 Bacteria 4150
322 Ga0495592_0102630 3300046454 Unclassified 2036
323 Ga0495629_0636683 3300046459 Bacteria 711
324 Ga0495651_0010436 3300046462 Bacteria 7137
325 Ga0495651_0386339 3300046462 Bacteria 917
326 Ga0495653_0434272 3300046463 Bacteria 829
327 Ga0495580_0000240 3300046472 Bacteria 43439
328 Ga0495639_0337628 3300046475 Bacteria 755
329 Ga0495662_0103994 3300046476 Bacteria 1389
330 Ga0495628_0187030 3300046516 Bacteria 1565
331 Ga0495628_0233753 3300046516 Bacteria 1377
332 Ga0495642_0393149 3300046528 Bacteria 611
333 Ga0495652_0086276 3300046529 Plasmid 2578
334 Ga0495667_0009781 3300046559 Bacteria 6495
335 Ga0495667_0029454 3300046559 Bacteria 3696
336 Ga0495634_0150663 3300046642 Bacteria 1471
337 Ga0495635_0136771 3300046663 Bacteria 1670
338 Ga0495635_0379527 3300046663 Bacteria 941
339 Ga0495659_0012466 3300046664 Bacteria 2754
340 Ga0495659_0080829 3300046664 Bacteria 1233
341 Ga0495659_0494444 3300046664 Unclassified 536
342 Ga0495657_0608400 3300046675 Bacteria 632
343 Ga0495599_0086019 3300046678 Bacteria 1963
344 Ga0495623_0425449 3300046679 Unclassified 711
345 Ga0495646_0158241 3300046680 Bacteria 1256
346 Ga0495647_0305550 3300046681 Bacteria 718
347 Ga0495658_0261718 3300046683 Bacteria 1089
348 Ga0495600_0309315 3300046809 Bacteria 995
349 Ga0495604_0639839 3300047317 Unclassified 679
350 Ga0495636_0651672 3300047318 Bacteria 517
351 Ga0495674_0264510 3300047319 Bacteria 1412
352 Ga0495680_0088124 3300047322 Unclassified 2333
353 Ga0495680_0129319 3300047322 Bacteria 1857
354 Ga0495680_0174593 3300047322 Bacteria 1554
355 Ga0495675_0156573 3300047444 Bacteria 1405
356 Ga0495684_0309600 3300047471 Bacteria 1132
357 Ga0495602_0143762 3300048088 Unclassified 1885
358 Ga0495602_0324760 3300048088 Bacteria 1118
359 Ga0501301_016258 3300049524 Bacteria 672
360 Ga0501033_0620021 3300049570 Unclassified 741
361 Ga0501036_1092121 3300049572 Bacteria 652
362 Ga0501039_0525437 3300049575 Bacteria 929
363 Ga0501040_0004396 3300049576 Bacteria 9156
364 Ga0501040_0087519 3300049576 Bacteria 2163
365 Ga0501041_1109968 3300049577 Bacteria 510
366 Ga0501042_0182040 3300049578 Unclassified 1516
367 Ga0501042_0349284 3300049578 Bacteria 1070
368 Ga0501046_1024838 3300049580 Unclassified 572
369 Ga0501048_0216039 3300049582 Bacteria 1360
370 Ga0501071_0528188 3300049587 Bacteria 906
371 Ga0501071_0735329 3300049587 Unclassified 760
372 Ga0501072_0113154 3300049588 Unclassified 2161
373 Ga0501072_0217208 3300049588 Bacteria 1524
374 Ga0501075_0036704 3300049591 Bacteria 3659
375 Ga0501075_0135844 3300049591 Unclassified 1874
376 Ga0501075_0221955 3300049591 Bacteria 1442
377 Ga0501076_0006317 3300049592 Bacteria 8587
378 Ga0501076_0252702 3300049592 Bacteria 1443
379 Ga0501076_1521688 3300049592 Unclassified 549
380 Ga0501077_0209242 3300049593 Bacteria 1239
381 Ga0501079_0203318 3300049741 Bacteria 1547
382 Ga0501079_0693385 3300049741 Unclassified 801
383 Ga0501079_0962463 3300049741 Unclassified 672
384 Ga0501080_0041926 3300049742 Bacteria 4264
385 Ga0501081_0017726 3300049743 Bacteria 4719
386 Ga0501081_0054605 3300049743 Unclassified 2760
387 Ga0501081_0126237 3300049743 Bacteria 1825
388 Ga0501083_0152722 3300049744 Bacteria 1512
389 Ga0501045_0151872 3300049824 Bacteria 1723
390 Ga0501045_1439414 3300049824 Unclassified 500
391 nmdc:mga05p37_152947_c1 3300050507 Bacteria 2821
392 nmdc:mga05p37_171419_c1 3300050507 Bacteria 2646
393 nmdc:mga05p37_27128_c1 3300050507 Bacteria 6972
394 nmdc:mga05p37_353469_c1 3300050507 Unclassified 1730
395 nmdc:mga05p37_47996_c1 3300050507 Bacteria 5252
396 nmdc:mga09592_110746_c1 3300050508 Bacteria 2355
397 nmdc:mga09592_1136127_c1 3300050508 Bacteria 648
398 nmdc:mga09592_18145_c1 3300050508 Bacteria 5771
399 nmdc:mga09592_20884_c2 3300050508 Bacteria 3588
400 nmdc:mga09592_44592_c1 3300050508 Bacteria 3734
401 nmdc:mga09592_94211_c1 3300050508 Unclassified 2561
402 nmdc:mga0qj67_48802_c1 3300050509 Bacteria 3345
403 nmdc:mga0qj67_560013_c1 3300050509 Bacteria 916
404 nmdc:mga06r32_201785_c1 3300050510 Bacteria 1976
405 nmdc:mga06r32_344197_c1 3300050510 Bacteria 1476
406 nmdc:mga06r32_39279_c1 3300050510 Bacteria 4490
407 nmdc:mga06r32_695552_c1 3300050510 Bacteria 983
408 nmdc:mga08y16_11159_c1 3300050511 Bacteria 9436
409 nmdc:mga08y16_19520_c1 3300050511 Bacteria 7147
410 nmdc:mga08y16_385751_c1 3300050511 Unclassified 1436
411 nmdc:mga08y16_535730_c1 3300050511 Bacteria 1186
412 nmdc:mga08y16_540701_c1 3300050511 Unclassified 1180
413 nmdc:mga0n895_1281310_c1 3300050512 Unclassified 704
414 nmdc:mga0n895_16671_c1 3300050512 Bacteria 6749
415 nmdc:mga0n895_2146052_c1 3300050512 Unclassified 515
416 nmdc:mga0n895_335972_c1 3300050512 Bacteria 1530
417 nmdc:mga0n895_359175_c1 3300050512 Bacteria 1475
418 nmdc:mga0n895_507511_c1 3300050512 Bacteria 1214
419 nmdc:mga0n895_9499_c1 3300050512 Bacteria 8512
420 nmdc:mga0rr50_1554499_c1 3300050513 Unclassified 559
421 nmdc:mga0rr50_207777_c1 3300050513 Bacteria 1612
422 nmdc:mga0rr50_615690_c1 3300050513 Unclassified 926
423 nmdc:mga0rr50_655981_c1 3300050513 Unclassified 895
424 nmdc:mga08x19_195837_c1 3300050514 Bacteria 1384
425 nmdc:mga08x19_246338_c1 3300050514 Bacteria 1233
426 nmdc:mga08x19_869963_c1 3300050514 Unclassified 640
427 nmdc:mga0a205_16858_c2 3300050515 Bacteria 4953
428 nmdc:mga0a205_484625_c1 3300050515 Unclassified 1095
429 nmdc:mga0a205_666_c1 3300050515 Bacteria 27379
430 nmdc:mga0a205_692913_c1 3300050515 Unclassified 869
431 nmdc:mga0a205_81476_c1 3300050515 Bacteria 2834
432 Ga0495601_0023364 3300053077 Bacteria 3798
433 Ga0495601_0023527 3300053077 Bacteria 3786
434 Ga0495595_0015409 3300053084 Bacteria 3261
435 Ga0495595_0098319 3300053084 Bacteria 1410
436 Ga0495595_0312352 3300053084 Bacteria 791
437 Ga0495619_0006325 3300053085 Bacteria 7512
438 Ga0495619_0226070 3300053085 Bacteria 1296
439 Ga0495619_1156976 3300053085 Bacteria 513
440 Ga0501084_0762673 3300054114 Unclassified 815
441 Ga0501082_0256653 3300060353 Unclassified 1521
442 Ga0501082_0385690 3300060353 Bacteria 1223
443 Ga0501082_0962723 3300060353 Bacteria 746
444 Ga0530510_0093857 3300061734 Bacteria 2191
445 Ga0530510_0343850 3300061734 Unclassified 1120
446 Ga0530510_0792326 3300061734 Unclassified 723
447 Ga0530510_1426059 3300061734 Unclassified 531
448 Ga0070709_10169541
449 Ga0065707_10250825
450 Ga0070690_100147304
451 Ga0070690_101482880
452 Ga0070666_11513523
453 Ga0070680_102008088
454 Ga0068868_100533177
455 Ga0070689_100230538
456 Ga0070689_100760085
457 Ga0070692_10977170
458 Ga0070675_101174051
459 Ga0070671_100031588
460 Ga0070674_100347233
461 Ga0070688_101432859
462 Ga0070667_101449447
463 Ga0070714_100262847
464 Ga0070714_100566900
465 Ga0070713_100034030
466 Ga0070713_100294821
467 Ga0070713_102149565
468 Ga0070710_10047326
469 Ga0070710_10162006
470 Ga0070701_10152548
471 Ga0070701_10618639
472 Ga0070711_100123481
473 Ga0070711_100141378
474 Ga0070711_100193708
475 Ga0070711_100265454
476 Ga0070711_101616040
477 Ga0070711_101630784
478 Ga0070705_100267249
479 Ga0070705_100918358
480 Ga0070700_100732045
481 Ga0070708_100029017
482 Ga0070708_100038625
483 Ga0070708_100039563
484 Ga0070708_100076068
485 Ga0070708_100137536
486 Ga0070708_100350441
487 Ga0070708_100621268
488 Ga0070681_11567574
489 Ga0068867_101018787
490 Ga0070706_100005665
491 Ga0070706_100041740
492 Ga0070706_100140335
493 Ga0070706_100186479
494 Ga0070706_100268479
495 Ga0070706_100751029
496 Ga0070706_101178598
497 Ga0070706_101719627
498 Ga0070706_101805983
499 Ga0070707_100077659
500 Ga0070707_100078899
501 Ga0070707_100107048
502 Ga0070707_100107927
503 Ga0070707_100147481
504 Ga0070707_100204684
505 Ga0070707_100206059
506 Ga0070707_100240649
507 Ga0070707_100956026
508 Ga0070707_102067847
509 Ga0070698_100000939
510 Ga0070698_100084340
511 Ga0070698_100153327
512 Ga0070698_100199536
513 Ga0070698_100457789
514 Ga0070698_100676518
515 Ga0070698_101636398
516 Ga0070698_102168160
517 Ga0070699_100102662
518 Ga0070699_100289923
519 Ga0070699_100337419
520 Ga0070699_100952085
521 Ga0070699_101096732
522 Ga0070699_102114663
523 Ga0070697_100009513
524 Ga0070697_100158130
525 Ga0070697_100260174
526 Ga0070697_100274754
527 Ga0070697_100295352
528 Ga0070697_100367898
529 Ga0070697_100458130
530 Ga0070697_100599271
531 Ga0070697_101466778
532 Ga0070672_100766033
533 Ga0070686_100954756
534 Ga0070695_100171064
535 Ga0070696_100024374
536 Ga0070693_100436681
537 Ga0070693_101583678
538 Ga0070704_100009078
539 Ga0070704_100055256
540 Ga0070704_100115067
541 Ga0068857_100471440
542 Ga0068857_101021210
543 Ga0070702_100745623
544 Ga0070702_101512545
545 Ga0068859_100280043
546 Ga0068859_102483891
547 Ga0068864_100734429
548 Ga0068861_102106626
549 Ga0068863_100527865
550 Ga0068863_102644220
551 Ga0068858_101564447
552 Ga0068860_100160491
553 Ga0068860_101118367
554 Ga0068862_100090204
555 Ga0068862_100308614
556 Ga0068862_101677502
557 Ga0081455_10175768
558 Ga0081538_10007785
559 Ga0081540_1003326
560 Ga0081540_1047111
561 Ga0070717_10004350
562 Ga0070717_10395032
563 Ga0075432_10051987
564 Ga0075432_10139018
565 Ga0070716_101056570
566 Ga0070712_100292012
567 Ga0070712_100758809
568 Ga0070712_101398031
569 Ga0075428_100001744
570 Ga0075428_100002701
571 Ga0075428_100123333
572 Ga0075428_100451138
573 Ga0075428_100519957
574 Ga0075428_101299889
575 Ga0075428_102077314
576 Ga0075430_100008765
577 Ga0075430_100312373
578 Ga0075431_100028251
579 Ga0075431_100048860
580 Ga0075431_100058301
581 Ga0075431_100189169
582 Ga0075431_100723474
583 Ga0075431_100800932
584 Ga0075431_101712519
585 Ga0075433_10005142
586 Ga0075433_10079200
587 Ga0075433_10118628
588 Ga0075433_10274991
589 Ga0075433_10275924
590 Ga0075433_10313593
591 Ga0075433_10475052
592 Ga0075433_10540943
593 Ga0075433_11247233
594 Ga0075434_100000331
595 Ga0075434_100035424
596 Ga0075434_100273354
597 Ga0075434_100375283
598 Ga0075434_100516817
599 Ga0075434_100589903
600 Ga0075434_101356396
601 Ga0075434_102422395
602 Ga0075429_100007163
603 Ga0075429_100032293
604 Ga0075429_100044301
605 Ga0075429_100077871
606 Ga0075429_100079220
607 Ga0075429_100163333
608 Ga0075429_100245871
609 Ga0068865_102083542
610 Ga0075436_100028799
611 Ga0075436_100236919
612 Ga0075436_100240129
613 Ga0097620_100280033
614 Ga0097620_102483950
615 Ga0075435_100014724
616 Ga0075435_100059083
617 Ga0075435_100201757
618 Ga0075435_100339827
619 Ga0075435_101064997
620 Ga0075435_101081519
621 Ga0099794_10157577
622 Ga0099795_10022834
623 Ga0099795_10284220
624 Ga0099795_10596165
625 Ga0105250_10107595
626 Ga0111539_10002440
627 Ga0111539_10003294
628 Ga0111539_10016820
629 Ga0111539_10724851
630 Ga0111539_10959760
631 Ga0114129_10008345
632 Ga0114129_10051695
633 Ga0114129_10089216
634 Ga0114129_10154321
635 Ga0114129_10223950
636 Ga0114129_10699649
637 Ga0114129_13199532
638 Ga0105243_11851250
639 Ga0105243_12242305
640 Ga0105241_11363232
641 Ga0105248_11701648
642 Ga0105237_12343390
643 Ga0105249_10074889
644 Ga0105249_10175791
645 Ga0105249_10325346
646 Ga0099796_10003109
647 Ga0099796_10020420
648 Ga0099796_10042285
649 Ga0105239_11461987
650 Ga0157373_11444268
651 Ga0163162_10304056
652 Ga0157375_12510219
653 Ga0157380_12261926
654 Ga0157377_10857887
655 Ga0157379_10330580
656 Ga0157379_10709595
657 Ga0184601_102578
658 Ga0184600_148126
659 Ga0213873_10006778
660 Ga0213874_10360724
661 Ga0213876_10090062
662 Ga0213876_10160698
663 Ga0213875_10000552
664 Ga0213875_10001029
665 Ga0213875_10440001
666 Ga0213875_10583594
667 Ga0207692_10287848
668 Ga0207692_10329445
669 Ga0207699_10167447
670 Ga0207699_10229019
671 Ga0207684_10003590
672 Ga0207684_10035313
673 Ga0207684_10087161
674 Ga0207684_10107741
675 Ga0207684_10183884
676 Ga0207684_10233372
677 Ga0207684_10302658
678 Ga0207684_11675016
679 Ga0207693_10057404
680 Ga0207693_10099244
681 Ga0207693_10268128
682 Ga0207693_10537728
683 Ga0207663_10688584
684 Ga0207663_11291021
685 Ga0207646_10023474
686 Ga0207646_10199279
687 Ga0207646_10323586
688 Ga0207646_11096857
689 Ga0207681_10818375
690 Ga0207650_10813806
691 Ga0207650_11880971
692 Ga0207700_10518081
693 Ga0207700_11553408
694 Ga0207664_10555616
695 Ga0207644_10158665
696 Ga0207644_11741346
697 Ga0207665_11052029
698 Ga0207665_11652976
699 Ga0207691_10631337
700 Ga0207711_10298160
701 Ga0207712_10234523
702 Ga0207712_10238495
703 Ga0207668_10735815
704 Ga0207677_11451050
705 Ga0207703_11209044
706 Ga0207708_10444845
707 Ga0207641_10308507
708 Ga0207641_12096574
709 Ga0207648_11149405
710 Ga0207676_10108057
711 Ga0207676_10860069
712 Ga0207674_10397015
713 Ga0207675_100252097
714 Ga0207428_10000190
715 Ga0207428_10001023
716 Ga0207428_10024226
717 Ga0207428_10504474
718 Ga0268265_10020236
719 Ga0268265_10063643
720 Ga0268264_10280469
721 Ga0268264_11191148
722 Ga0265764_102312
723 Ga0265320_10079903
724 Ga0307408_100210183
725 Ga0307411_10164766
726 Ga0316053_102826
727 Ga0373940_0056371
728 Ga0373923_0185698
729 Ga0373936_0053700
730 Ga0373953_0041909
731 Ga0373954_0011498
732 Ga0373956_0020528
733 Ga0373956_0026484
734 Ga0373957_0005024
735 Ga0373955_0011928
736 Ga0373955_0293455
737 Ga0373924_0023256
738 Ga0373935_0129869
739 Ga0373933_0014340
740 Ga0373933_0032836
741 Ga0373947_0101128
742 Ga0373937_0007342
743 Ga0373937_0112157
744 Ga0373937_0136088
745 Ga0373937_0526587
746 Ga0373925_0038926
747 Ga0436364_0393226
748 Ga0436364_1284200
749 Ga0436364_1291972
750 Ga0436364_1421881
751 Ga0436365_0475562
752 Ga0436365_0553851
753 Ga0436365_0555968
754 Ga0436365_0975887
755 Ga0436365_1909668
756 Ga0436360_0564934
757 Ga0436363_1020221
758 Ga0436363_1652362
759 Ga0436362_0104642
760 Ga0436362_0229672
761 Ga0436362_1118228
762 Ga0451577_0188548
763 Ga0451577_0744162
764 Ga0453683_0127027
765 Ga0453683_0681925
766 Ga0451576_0281629
767 Ga0451576_0282206
768 Ga0495592_0029551
769 Ga0495592_0102630
770 Ga0495629_0636683
771 Ga0495651_0010436
772 Ga0495651_0386339
773 Ga0495653_0434272
774 Ga0495580_0000240
775 Ga0495639_0337628
776 Ga0495662_0103994
777 Ga0495628_0187030
778 Ga0495628_0233753
779 Ga0495642_0393149
780 Ga0495652_0086276
781 Ga0495667_0009781
782 Ga0495667_0029454
783 Ga0495634_0150663
784 Ga0495635_0136771
785 Ga0495635_0379527
786 Ga0495659_0012466
787 Ga0495659_0080829
788 Ga0495659_0494444
789 Ga0495657_0608400
790 Ga0495599_0086019
791 Ga0495623_0425449
792 Ga0495646_0158241
793 Ga0495647_0305550
794 Ga0495658_0261718
795 Ga0495600_0309315
796 Ga0495604_0639839
797 Ga0495636_0651672
798 Ga0495674_0264510
799 Ga0495680_0088124
800 Ga0495680_0129319
801 Ga0495680_0174593
802 Ga0495675_0156573
803 Ga0495684_0309600
804 Ga0495602_0143762
805 Ga0495602_0324760
806 Ga0501301_016258
807 Ga0501033_0620021
808 Ga0501036_1092121
809 Ga0501039_0525437
810 Ga0501040_0004396
811 Ga0501040_0087519
812 Ga0501041_1109968
813 Ga0501042_0182040
814 Ga0501042_0349284
815 Ga0501046_1024838
816 Ga0501048_0216039
817 Ga0501071_0528188
818 Ga0501071_0735329
819 Ga0501072_0113154
820 Ga0501072_0217208
821 Ga0501075_0036704
822 Ga0501075_0135844
823 Ga0501075_0221955
824 Ga0501076_0006317
825 Ga0501076_0252702
826 Ga0501076_1521688
827 Ga0501077_0209242
828 Ga0501079_0203318
829 Ga0501079_0693385
830 Ga0501079_0962463
831 Ga0501080_0041926
832 Ga0501081_0017726
833 Ga0501081_0054605
834 Ga0501081_0126237
835 Ga0501083_0152722
836 Ga0501045_0151872
837 Ga0501045_1439414
838 nmdc:mga05p37_152947_c1
839 nmdc:mga05p37_171419_c1
840 nmdc:mga05p37_27128_c1
841 nmdc:mga05p37_353469_c1
842 nmdc:mga05p37_47996_c1
843 nmdc:mga09592_110746_c1
844 nmdc:mga09592_1136127_c1
845 nmdc:mga09592_18145_c1
846 nmdc:mga09592_20884_c2
847 nmdc:mga09592_44592_c1
848 nmdc:mga09592_94211_c1
849 nmdc:mga0qj67_48802_c1
850 nmdc:mga0qj67_560013_c1
851 nmdc:mga06r32_201785_c1
852 nmdc:mga06r32_344197_c1
853 nmdc:mga06r32_39279_c1
854 nmdc:mga06r32_695552_c1
855 nmdc:mga08y16_11159_c1
856 nmdc:mga08y16_19520_c1
857 nmdc:mga08y16_385751_c1
858 nmdc:mga08y16_535730_c1
859 nmdc:mga08y16_540701_c1
860 nmdc:mga0n895_1281310_c1
861 nmdc:mga0n895_16671_c1
862 nmdc:mga0n895_2146052_c1
863 nmdc:mga0n895_335972_c1
864 nmdc:mga0n895_359175_c1
865 nmdc:mga0n895_507511_c1
866 nmdc:mga0n895_9499_c1
867 nmdc:mga0rr50_1554499_c1
868 nmdc:mga0rr50_207777_c1
869 nmdc:mga0rr50_615690_c1
870 nmdc:mga0rr50_655981_c1
871 nmdc:mga08x19_195837_c1
872 nmdc:mga08x19_246338_c1
873 nmdc:mga08x19_869963_c1
874 nmdc:mga0a205_16858_c2
875 nmdc:mga0a205_484625_c1
876 nmdc:mga0a205_666_c1
877 nmdc:mga0a205_692913_c1
878 nmdc:mga0a205_81476_c1
879 Ga0495601_0023364
880 Ga0495601_0023527
881 Ga0495595_0015409
882 Ga0495595_0098319
883 Ga0495595_0312352
884 Ga0495619_0006325
885 Ga0495619_0226070
886 Ga0495619_1156976
887 Ga0501084_0762673
888 Ga0501082_0256653
889 Ga0501082_0385690
890 Ga0501082_0962723
891 Ga0530510_0093857
892 Ga0530510_0343850
893 Ga0530510_0792326
894 Ga0530510_1426059

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03992

ABM

Antibiotic biosynthesis monooxygenase

19

94

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ecx-assembly1.cif.gz_B pa0709 with glyoxal and bme modifications 0.9137 1 68
3fgv-assembly1.cif.gz_B crystal structure of a putative antibiotic biosynthesis monooxygenase (spo2313) from silicibacter pomeroyi dss-3 at 1.30 a resolution 0.8784 1 93
3fgv-assembly1.cif.gz_B crystal structure of a putative antibiotic biosynthesis monooxygenase (spo2313) from silicibacter pomeroyi dss-3 at 1.30 a resolution 0.8606 1 93
4zos-assembly2.cif.gz_B 2.20 angstrom resolution crystal structure of protein ye0340 of unidentified function from yersinia enterocolitica subsp. enterocolitica 8081] 0.8462 2 94
1x7v-assembly3.cif.gz_C crystal structure of pa3566 from pseudomonas aeruginosa 0.8388 2 94
ID Description Score Start End Superfamily
af_O06569_1_91_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8537 3 90 3.30.70.100
4zosB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8462 2 94 3.30.70.100
3fgvB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.836 3 93 3.30.70.100
3e8oA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8315 3 95 3.30.70.100
af_O06569_1_91_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.82 3 90 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A537MPS9-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.975 1 96 GO:0004497
AF-A0A521TMG3-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9581 2 93 GO:0004497
AF-A0A2V6ZYV7-F1-model_v4 ABM domain-containing protein 0.9577 1 96
AF-A0A2V7B7D4-F1-model_v4 ABM domain-containing protein 0.9572 1 96 GO:0005829
GO:0016491
AF-A0A534N448-F1-model_v4 ABM domain-containing protein 0.9513 1 96

Map