F445888

General Info

Members Datasets Scaffolds Average Seq Length
447 255 446 261

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100029785|Ga0070659_1000297855
Length 285
Sequence VRSVTWARKASRRRFNRMPAAPMYGRLPIVKMLLVTIAATAVISAVMLSINWDGQEASTAAPKIDDLLNVMIVLSSFVFSLVCVMLFYALWKFKAKPGDESDGEPIHGNTKLEIAWTLIPTIIVLFGGGYSWKVLNEIEEKQPNPLTVDVFSQQYAWSFAYPGKGYKYVEGEFHVPVDRQIVFKMHAQDVIHSFWVPEWRIKKDNVPGITTTAVVTPDVPGTYQLICTELCGFGHATMRAKVVVESPSKFKKWVDSLEQETPPELMESVKQDTQANPVNLGAGGA

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
127 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
128 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
129 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
130 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
133 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
134 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
135 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
136 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
142 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
143 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
144 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
148 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
157 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
158 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
159 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
160 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
163 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
186 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
187 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
194 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
214 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
217 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
233 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
248 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
249 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
250 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
251 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
252 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
253 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.67
Nodule 0
Rhizoplane 10.29
Rhizosphere 86.58
Stem 0
Stem Tuber 0
Unclassified 2.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1007531 3300000546 Bacteria 1173
2 JGI24740J21852_10007432 3300001979 Bacteria 4456
3 JGI24748J21848_1012516 3300002074 Bacteria 1001
4 JGI24034J26672_10000115 3300002239 Bacteria 12949
5 JGI24742J22300_10013599 3300002244 Bacteria 1362
6 Ga0070658_10122027 3300005327 Bacteria 2166
7 Ga0070683_100007793 3300005329 Bacteria 9067
8 Ga0070683_100135050 3300005329 Bacteria 2336
9 Ga0070683_100144319 3300005329 Bacteria 2255
10 Ga0070670_100018846 3300005331 Bacteria 5918
11 Ga0070677_10000521 3300005333 Bacteria 13187
12 Ga0070666_10120319 3300005335 Bacteria 1820
13 Ga0070680_100164345 3300005336 Bacteria 1866
14 Ga0070682_100000023 3300005337 Bacteria 206016
15 Ga0070682_100000026 3300005337 Bacteria 191388
16 Ga0068868_100000351 3300005338 Bacteria 31294
17 Ga0070691_10000004 3300005341 Bacteria 80156
18 Ga0070661_100000004 3300005344 Bacteria 243876
19 Ga0070692_10077332 3300005345 Bacteria 1785
20 Ga0070668_100083713 3300005347 Bacteria 2504
21 Ga0070668_100098913 3300005347 Bacteria 2309
22 Ga0070675_100000050 3300005354 Bacteria 72016
23 Ga0070674_100000002 3300005356 Bacteria 271088
24 Ga0070674_100000205 3300005356 Bacteria 28334
25 Ga0070674_100066311 3300005356 Bacteria 2536
26 Ga0070673_100078818 3300005364 Bacteria 2666
27 Ga0070688_100000010 3300005365 Bacteria 84103
28 Ga0070688_100000161 3300005365 Bacteria 35812
29 Ga0070659_100029785 3300005366 Bacteria 4220
30 Ga0070667_100001110 3300005367 Bacteria 24556
31 Ga0070667_100153489 3300005367 Bacteria 2024
32 Ga0070667_100453067 3300005367 Bacteria 1172
33 Ga0070714_100154429 3300005435 Bacteria 2071
34 Ga0070713_100000503 3300005436 Bacteria 24991
35 Ga0070711_100042995 3300005439 Bacteria 3057
36 Ga0070711_100193794 3300005439 Bacteria 1563
37 Ga0070700_100101282 3300005441 Bacteria 1898
38 Ga0070663_100005786 3300005455 Bacteria 7380
39 Ga0070678_100084275 3300005456 Bacteria 2419
40 Ga0070678_100394544 3300005456 Bacteria 1201
41 Ga0070681_10208275 3300005458 Bacteria 1872
42 Ga0070681_10269558 3300005458 Bacteria 1614
43 Ga0068867_100000078 3300005459 Bacteria 59729
44 Ga0070685_10000010 3300005466 Bacteria 146946
45 Ga0070685_10000061 3300005466 Bacteria 63408
46 Ga0070679_100000424 3300005530 Bacteria 35927
47 Ga0070679_100000471 3300005530 Bacteria 34374
48 Ga0070684_100056329 3300005535 Bacteria 3430
49 Ga0070684_100135203 3300005535 Bacteria 2226
50 Ga0068853_100007596 3300005539 Bacteria 8682
51 Ga0070672_100000031 3300005543 Bacteria 62241
52 Ga0070686_100158327 3300005544 Bacteria 1592
53 Ga0070696_100476921 3300005546 Bacteria 989
54 Ga0070693_100032067 3300005547 Bacteria 2886
55 Ga0070665_100000022 3300005548 Bacteria 379286
56 Ga0070665_100026842 3300005548 Bacteria 5801
57 Ga0070665_100068987 3300005548 Bacteria 3543
58 Ga0070665_100241863 3300005548 Bacteria 1805
59 Ga0070665_100263848 3300005548 Bacteria 1723
60 Ga0070704_100070908 3300005549 Bacteria 2530
61 Ga0068854_100000082 3300005578 Bacteria 68340
62 Ga0068854_100156760 3300005578 Bacteria 1760
63 Ga0068856_100000417 3300005614 Bacteria 46946
64 Ga0068856_100018096 3300005614 Bacteria 6831
65 Ga0068856_100027420 3300005614 Bacteria 5558
66 Ga0068852_100000966 3300005616 Bacteria 18875
67 Ga0068852_100113762 3300005616 Bacteria 2465
68 Ga0068866_10000005 3300005718 Bacteria 196339
69 Ga0068866_10000206 3300005718 Bacteria 27716
70 Ga0068861_100034640 3300005719 Bacteria 3735
71 Ga0068851_10000141 3300005834 Bacteria 38800
72 Ga0068863_100000261 3300005841 Bacteria 55053
73 Ga0068863_100020755 3300005841 Bacteria 6274
74 Ga0068858_100000046 3300005842 Bacteria 127519
75 Ga0068858_100001180 3300005842 Bacteria 27065
76 Ga0068858_100129653 3300005842 Bacteria 2363
77 Ga0068858_100131860 3300005842 Bacteria 2344
78 Ga0068860_100015233 3300005843 Bacteria 7511
79 Ga0068860_100158523 3300005843 Bacteria 2181
80 Ga0068862_100002784 3300005844 Bacteria 15326
81 Ga0081455_10004942 3300005937 Bacteria 14737
82 Ga0081540_1000557 3300005983 Bacteria 36162
83 Ga0081539_10000776 3300005985 Bacteria 62705
84 Ga0081539_10050002 3300005985 Bacteria 2368
85 Ga0070715_10000008 3300006163 Bacteria 189899
86 Ga0070712_100000841 3300006175 Bacteria 18240
87 Ga0075430_100076644 3300006846 Bacteria 2803
88 Ga0068865_100000499 3300006881 Bacteria 22000
89 Ga0105240_10507327 3300009093 Bacteria 1340
90 Ga0105245_10000040 3300009098 Bacteria 144005
91 Ga0105245_10000314 3300009098 Bacteria 46175
92 Ga0105245_10000857 3300009098 Bacteria 27591
93 Ga0105245_10002546 3300009098 Bacteria 16428
94 Ga0105247_10000131 3300009101 Bacteria 72578
95 Ga0105247_10422779 3300009101 Bacteria 954
96 Ga0105243_10161789 3300009148 Bacteria 1931
97 Ga0105242_10000063 3300009176 Bacteria 74721
98 Ga0105242_10091455 3300009176 Bacteria 2561
99 Ga0105242_10392061 3300009176 Bacteria 1293
100 Ga0105242_10422907 3300009176 Bacteria 1249
101 Ga0105248_10000037 3300009177 Bacteria 180751
102 Ga0105237_10226265 3300009545 Bacteria 1871
103 Ga0105249_10000218 3300009553 Bacteria 65480
104 Ga0105249_10074063 3300009553 Bacteria 3151
105 Ga0105249_10105682 3300009553 Bacteria 2655
106 Ga0105239_10223637 3300010375 Bacteria 2111
107 Ga0105239_10276583 3300010375 Bacteria 1889
108 Ga0105239_10506416 3300010375 Bacteria 1373
109 Ga0157371_10004888 3300013102 Bacteria 11513
110 Ga0157370_10010636 3300013104 Bacteria 9684
111 Ga0157370_10014559 3300013104 Bacteria 8039
112 Ga0157369_10001730 3300013105 Bacteria 26528
113 Ga0157374_10001797 3300013296 Bacteria 18046
114 Ga0157374_10058364 3300013296 Bacteria 3606
115 Ga0157374_10394726 3300013296 Unclassified 1379
116 Ga0157378_10219217 3300013297 Bacteria 1808
117 Ga0157378_10292773 3300013297 Bacteria 1573
118 Ga0163162_10850559 3300013306 Bacteria 1027
119 Ga0157375_10044770 3300013308 Bacteria 4303
120 Ga0157375_10273456 3300013308 Bacteria 1852
121 Ga0163163_10530542 3300014325 Bacteria 1239
122 Ga0157380_10000007 3300014326 Bacteria 157634
123 Ga0157380_10001943 3300014326 Bacteria 13750
124 Ga0157379_10015110 3300014968 Bacteria 6771
125 Ga0157379_10018096 3300014968 Bacteria 6209
126 Ga0157379_10083447 3300014968 Bacteria 2864
127 Ga0157376_10147644 3300014969 Bacteria 2117
128 Ga0157376_10685128 3300014969 Bacteria 1029
129 Ga0163161_10000064 3300017792 Bacteria 108508
130 Ga0163161_10193624 3300017792 Bacteria 1564
131 Ga0207656_10000380 3300025321 Bacteria 14901
132 Ga0207653_10022428 3300025885 Bacteria 2005
133 Ga0207682_10000769 3300025893 Bacteria 14799
134 Ga0207642_10000005 3300025899 Bacteria 401934
135 Ga0207642_10001468 3300025899 Bacteria 7292
136 Ga0207710_10000268 3300025900 Bacteria 42956
137 Ga0207685_10000012 3300025905 Bacteria 189900
138 Ga0207705_10019730 3300025909 Bacteria 4820
139 Ga0207707_10221557 3300025912 Bacteria 1647
140 Ga0207695_10074168 3300025913 Bacteria 3464
141 Ga0207693_10001350 3300025915 Bacteria 21696
142 Ga0207663_10040991 3300025916 Bacteria 2819
143 Ga0207660_10244081 3300025917 Bacteria 1416
144 Ga0207649_10000003 3300025920 Bacteria 388908
145 Ga0207652_10000232 3300025921 Bacteria 58473
146 Ga0207652_10000412 3300025921 Bacteria 44366
147 Ga0207650_10021117 3300025925 Bacteria 4602
148 Ga0207659_10000055 3300025926 Bacteria 74252
149 Ga0207687_10000040 3300025927 Bacteria 113598
150 Ga0207687_10000095 3300025927 Bacteria 64664
151 Ga0207687_10000128 3300025927 Bacteria 50603
152 Ga0207687_10082349 3300025927 Bacteria 2328
153 Ga0207700_10000003 3300025928 Bacteria 500797
154 Ga0207700_10077530 3300025928 Bacteria 2582
155 Ga0207664_10094031 3300025929 Bacteria 2463
156 Ga0207690_10014580 3300025932 Bacteria 4747
157 Ga0207686_10000230 3300025934 Bacteria 42566
158 Ga0207686_10000395 3300025934 Bacteria 30349
159 Ga0207686_10231003 3300025934 Bacteria 1341
160 Ga0207709_10101698 3300025935 Bacteria 1901
161 Ga0207669_10000003 3300025937 Bacteria 252239
162 Ga0207669_10000021 3300025937 Bacteria 100327
163 Ga0207704_10000104 3300025938 Bacteria 46614
164 Ga0207691_10000178 3300025940 Bacteria 60110
165 Ga0207711_10000011 3300025941 Bacteria 518817
166 Ga0207661_10000858 3300025944 Bacteria 19953
167 Ga0207661_10001136 3300025944 Bacteria 17743
168 Ga0207661_10006993 3300025944 Bacteria 8002
169 Ga0207661_10081293 3300025944 Bacteria 2676
170 Ga0207661_10123205 3300025944 Bacteria 2210
171 Ga0207661_10178225 3300025944 Bacteria 1854
172 Ga0207667_10054875 3300025949 Bacteria 4191
173 Ga0207651_10036181 3300025960 Bacteria 3220
174 Ga0207712_10000027 3300025961 Bacteria 263739
175 Ga0207712_10198726 3300025961 Bacteria 1588
176 Ga0207668_10008828 3300025972 Bacteria 6024
177 Ga0207640_10000054 3300025981 Bacteria 95136
178 Ga0207640_10110408 3300025981 Bacteria 1948
179 Ga0207658_10001811 3300025986 Bacteria 15995
180 Ga0207658_10155859 3300025986 Bacteria 1866
181 Ga0207677_10000304 3300026023 Bacteria 36147
182 Ga0207703_10000020 3300026035 Bacteria 251603
183 Ga0207703_10000042 3300026035 Bacteria 161459
184 Ga0207703_10148311 3300026035 Bacteria 2043
185 Ga0207678_10002172 3300026067 Bacteria 17730
186 Ga0207708_10024542 3300026075 Bacteria 4562
187 Ga0207708_10144413 3300026075 Bacteria 1869
188 Ga0207702_10000105 3300026078 Bacteria 97835
189 Ga0207702_10001788 3300026078 Bacteria 21174
190 Ga0207702_10016153 3300026078 Bacteria 6180
191 Ga0207702_10195018 3300026078 Bacteria 1874
192 Ga0207641_10000062 3300026088 Bacteria 159982
193 Ga0207641_10009398 3300026088 Bacteria 8058
194 Ga0207648_10000457 3300026089 Bacteria 45386
195 Ga0207675_100064160 3300026118 Bacteria 3433
196 Ga0207675_100100788 3300026118 Bacteria 2721
197 Ga0207683_10100169 3300026121 Bacteria 2586
198 Ga0207683_10131689 3300026121 Bacteria 2249
199 Ga0207698_10000015 3300026142 Bacteria 207368
200 Ga0268266_10000029 3300028379 Bacteria 424015
201 Ga0268266_10000526 3300028379 Bacteria 53404
202 Ga0268266_10000990 3300028379 Bacteria 35791
203 Ga0268266_10122565 3300028379 Bacteria 2315
204 Ga0268266_10235356 3300028379 Bacteria 1688
205 Ga0268265_10001768 3300028380 Bacteria 17341
206 Ga0268264_10021055 3300028381 Bacteria 5330
207 Ga0268264_10106030 3300028381 Bacteria 2452
208 Ga0265337_1000167 3300028556 Bacteria 34055
209 Ga0265326_10000452 3300028558 Bacteria 16152
210 Ga0265319_1000010 3300028563 Bacteria 188773
211 Ga0265334_10087671 3300028573 Bacteria 1139
212 Ga0265322_10000005 3300028654 Bacteria 246112
213 Ga0265338_10000287 3300028800 Bacteria 90818
214 Ga0265324_10000183 3300029957 Bacteria 48185
215 Ga0265320_10000010 3300031240 Bacteria 250501
216 Ga0265325_10025508 3300031241 Bacteria 3209
217 Ga0265329_10004243 3300031242 Bacteria 6019
218 Ga0265331_10000217 3300031250 Bacteria 69142
219 Ga0265327_10000040 3300031251 Bacteria 291052
220 Ga0265314_10000578 3300031711 Bacteria 46350
221 Ga0373954_0084024 3300035118 Bacteria 1524
222 Ga0373937_0067329 3300036401 Bacteria 3299
223 Ga0451802_1360614 3300041460 Bacteria 918
224 Ga0451807_0930195 3300041486 Unclassified 1030
225 Ga0451843_1191107 3300041509 Bacteria 1074
226 Ga0451853_1210896 3300041512 Bacteria 1543
227 Ga0451853_3534475 3300041512 Bacteria 1392
228 Ga0466963_0000233 3300044694 Bacteria 24036
229 Ga0466963_0008048 3300044694 Bacteria 6311
230 Ga0466963_0084612 3300044694 Bacteria 2152
231 Ga0466957_0001268 3300044842 Bacteria 13149
232 Ga0466960_0228555 3300044901 Unclassified 1026
233 Ga0466958_0045441 3300045836 Bacteria 2649
234 Ga0466967_0000002 3300045976 Bacteria 219994
235 Ga0466967_0180846 3300045976 Bacteria 1989
236 Ga0466967_0405145 3300045976 Bacteria 1328
237 Ga0495592_0000024 3300046454 Bacteria 136661
238 Ga0495592_0100353 3300046454 Bacteria 2064
239 Ga0495603_0000102 3300046455 Bacteria 40074
240 Ga0495603_0027208 3300046455 Bacteria 3452
241 Ga0495603_0097966 3300046455 Unclassified 1712
242 Ga0495629_0010954 3300046459 Bacteria 6593
243 Ga0495629_0029234 3300046459 Bacteria 3910
244 Ga0495638_0036473 3300046460 Bacteria 3133
245 Ga0495641_0000004 3300046461 Bacteria 210501
246 Ga0495641_0017169 3300046461 Bacteria 3781
247 Ga0495653_0064817 3300046463 Bacteria 2752
248 Ga0495582_0000003 3300046473 Bacteria 168880
249 Ga0495662_0000069 3300046476 Bacteria 36219
250 Ga0495662_0025721 3300046476 Bacteria 2842
251 Ga0495664_0275987 3300046477 Bacteria 1016
252 Ga0495594_0000009 3300046499 Bacteria 122139
253 Ga0495594_0207531 3300046499 Bacteria 1117
254 Ga0495606_0000017 3300046507 Bacteria 284549
255 Ga0495608_0000013 3300046511 Bacteria 228481
256 Ga0495608_0000754 3300046511 Bacteria 22642
257 Ga0495608_0212587 3300046511 Bacteria 1215
258 Ga0495610_0110927 3300046512 Bacteria 1215
259 Ga0495620_0000041 3300046515 Bacteria 112605
260 Ga0495628_0000794 3300046516 Bacteria 29108
261 Ga0495628_0004134 3300046516 Bacteria 12910
262 Ga0495628_0013643 3300046516 Bacteria 6829
263 Ga0495628_0176835 3300046516 Bacteria 1616
264 Ga0495628_0443786 3300046516 Bacteria 943
265 Ga0495630_0000026 3300046517 Bacteria 147084
266 Ga0495630_0000032 3300046517 Bacteria 134425
267 Ga0495630_0237385 3300046517 Bacteria 1393
268 Ga0495652_0000018 3300046529 Bacteria 201634
269 Ga0495652_0060643 3300046529 Bacteria 3196
270 Ga0495587_0017028 3300046536 Bacteria 4519
271 Ga0495587_0021994 3300046536 Bacteria 3930
272 Ga0495621_0002315 3300046539 Bacteria 5108
273 Ga0495645_0021055 3300046543 Bacteria 4712
274 Ga0495645_0125239 3300046543 Bacteria 1806
275 Ga0495645_0221247 3300046543 Bacteria 1273
276 Ga0495622_0000097 3300046557 Bacteria 76953
277 Ga0495667_0000038 3300046559 Bacteria 131349
278 Ga0495656_0022728 3300046615 Bacteria 2460
279 Ga0495668_0168905 3300046616 Unclassified 1198
280 Ga0495634_0000002 3300046642 Bacteria 247842
281 Ga0495634_0006840 3300046642 Bacteria 8627
282 Ga0495634_0070185 3300046642 Bacteria 2310
283 Ga0495634_0093614 3300046642 Bacteria 1948
284 Ga0495625_0000243 3300046660 Bacteria 85589
285 Ga0495625_0083392 3300046660 Bacteria 2222
286 Ga0495635_0046155 3300046663 Bacteria 3005
287 Ga0495588_0000073 3300046674 Bacteria 219005
288 Ga0495657_0000003 3300046675 Bacteria 279680
289 Ga0495657_0012043 3300046675 Bacteria 6435
290 Ga0495657_0065934 3300046675 Bacteria 2380
291 Ga0495599_0130511 3300046678 Bacteria 1561
292 Ga0495647_0000585 3300046681 Bacteria 10787
293 Ga0495647_0074433 3300046681 Bacteria 1365
294 Ga0495658_0000001 3300046683 Bacteria 385362
295 Ga0495658_0000947 3300046683 Bacteria 15486
296 Ga0495669_0000609 3300046684 Bacteria 15639
297 Ga0495669_0099444 3300046684 Bacteria 1350
298 Ga0495613_0000027 3300046689 Bacteria 146674
299 Ga0495613_0001632 3300046689 Bacteria 17071
300 Ga0495624_0000691 3300046690 Bacteria 26457
301 Ga0495624_0047286 3300046690 Bacteria 2734
302 Ga0495670_0008267 3300046691 Bacteria 5117
303 Ga0495671_0152244 3300046692 Bacteria 1126
304 Ga0495649_0010793 3300046694 Bacteria 5380
305 Ga0495604_0002435 3300047317 Bacteria 14888
306 Ga0495604_0037624 3300047317 Bacteria 3809
307 Ga0495674_0000039 3300047319 Bacteria 97645
308 Ga0495676_0015192 3300047321 Bacteria 6865
309 Ga0495676_0024706 3300047321 Bacteria 5195
310 Ga0495676_0025193 3300047321 Bacteria 5139
311 Ga0495676_0149426 3300047321 Bacteria 1665
312 Ga0495676_0210523 3300047321 Bacteria 1345
313 Ga0495680_0000007 3300047322 Bacteria 152053
314 Ga0495680_0000929 3300047322 Bacteria 32526
315 Ga0495680_0001001 3300047322 Bacteria 31451
316 Ga0495680_0227189 3300047322 Bacteria 1330
317 Ga0495675_0000002 3300047444 Bacteria 216469
318 Ga0495679_008360 3300047446 Bacteria 4215
319 Ga0495679_042921 3300047446 Bacteria 1393
320 Ga0495685_005973 3300047447 Bacteria 3977
321 Ga0495686_0059460 3300047472 Bacteria 2379
322 Ga0495602_0000034 3300048088 Bacteria 140722
323 Ga0495602_0009482 3300048088 Bacteria 10121
324 Ga0495602_0115818 3300048088 Bacteria 2167
325 Ga0495602_0124666 3300048088 Bacteria 2066
326 Ga0496100_0000001 3300048903 Bacteria 530179
327 Ga0496100_0000024 3300048903 Bacteria 116138
328 Ga0496100_0045865 3300048903 Bacteria 2807
329 Ga0496101_0000028 3300048904 Bacteria 198664
330 Ga0496101_0000072 3300048904 Bacteria 116138
331 Ga0496102_0000749 3300048905 Bacteria 31723
332 Ga0496103_0003112 3300048906 Bacteria 10202
333 Ga0496103_0019977 3300048906 Bacteria 4023
334 Ga0496104_0000008 3300048907 Bacteria 516976
335 Ga0496104_0000010 3300048907 Bacteria 475255
336 Ga0496104_0000230 3300048907 Bacteria 49225
337 Ga0496104_0232072 3300048907 Bacteria 1757
338 Ga0496105_0000003 3300048908 Bacteria 713251
339 Ga0496105_0000005 3300048908 Bacteria 475797
340 Ga0496105_0000051 3300048908 Bacteria 90365
341 Ga0496105_0004601 3300048908 Bacteria 10395
342 Ga0496105_0089012 3300048908 Bacteria 2550
343 Ga0496106_0000040 3300048909 Bacteria 108754
344 Ga0496106_0000218 3300048909 Bacteria 40075
345 Ga0496107_0000002 3300048910 Bacteria 320871
346 Ga0496107_0000025 3300048910 Bacteria 116138
347 Ga0496107_0064629 3300048910 Bacteria 2653
348 Ga0496108_0000004 3300048911 Bacteria 545055
349 Ga0496108_0000005 3300048911 Bacteria 535059
350 Ga0496108_0001876 3300048911 Bacteria 16829
351 Ga0496108_0040737 3300048911 Bacteria 3874
352 Ga0496109_0000002 3300048912 Bacteria 443393
353 Ga0496109_0000013 3300048912 Bacteria 227469
354 Ga0496109_0000221 3300048912 Bacteria 56054
355 Ga0496109_0004919 3300048912 Bacteria 11154
356 Ga0496110_0000052 3300048913 Bacteria 58549
357 Ga0496110_0394639 3300048913 Bacteria 1261
358 Ga0496110_0533312 3300048913 Bacteria 1067
359 Ga0496111_0000209 3300048914 Bacteria 27572
360 Ga0496111_0357213 3300048914 Bacteria 1081
361 Ga0496112_0000026 3300048915 Bacteria 144758
362 Ga0496112_0001298 3300048915 Bacteria 18986
363 Ga0496113_0000005 3300048916 Bacteria 105956
364 Ga0496113_0271913 3300048916 Bacteria 1354
365 Ga0496114_0000003 3300048917 Bacteria 630981
366 Ga0496114_0046922 3300048917 Bacteria 3591
367 Ga0496115_0000016 3300048918 Bacteria 187067
368 Ga0496115_0000827 3300048918 Bacteria 22678
369 Ga0496115_0008810 3300048918 Bacteria 7475
370 Ga0496116_0001008 3300048919 Bacteria 34374
371 Ga0496119_0007530 3300048922 Bacteria 9784
372 Ga0496119_0038448 3300048922 Bacteria 3091
373 Ga0496119_0044175 3300048922 Bacteria 2808
374 Ga0496121_0043818 3300048924 Bacteria 3869
375 Ga0496121_0252195 3300048924 Bacteria 1223
376 Ga0496125_0060081 3300048928 Bacteria 3058
377 Ga0496125_0089546 3300048928 Bacteria 2314
378 Ga0501031_0020352 3300049568 Bacteria 4325
379 Ga0501032_0003121 3300049569 Bacteria 12764
380 Ga0501033_0001901 3300049570 Bacteria 18171
381 Ga0501034_0020205 3300049571 Bacteria 6800
382 Ga0501034_0172767 3300049571 Bacteria 2127
383 Ga0501034_0444896 3300049571 Bacteria 1214
384 Ga0501036_0003397 3300049572 Bacteria 12722
385 Ga0501037_0001034 3300049573 Bacteria 20571
386 Ga0501038_0019841 3300049574 Bacteria 6051
387 Ga0501039_0014767 3300049575 Bacteria 5974
388 Ga0501040_0124216 3300049576 Bacteria 1812
389 Ga0501040_0334338 3300049576 Bacteria 1084
390 Ga0501042_0117019 3300049578 Bacteria 1919
391 Ga0501043_0010305 3300049579 Bacteria 7328
392 Ga0501046_0004349 3300049580 Bacteria 12898
393 Ga0501047_0004614 3300049581 Bacteria 12960
394 Ga0501047_0028630 3300049581 Bacteria 5372
395 Ga0501048_0003121 3300049582 Bacteria 12648
396 Ga0501067_0151440 3300049583 Bacteria 1292
397 Ga0501068_0102137 3300049584 Bacteria 1778
398 Ga0501068_0167658 3300049584 Bacteria 1385
399 Ga0501069_0009529 3300049585 Bacteria 5125
400 Ga0501069_0022233 3300049585 Bacteria 3447
401 Ga0501070_0001885 3300049586 Bacteria 18541
402 Ga0501070_0085919 3300049586 Bacteria 2604
403 Ga0501070_0652605 3300049586 Bacteria 835
404 Ga0501071_0039466 3300049587 Bacteria 3378
405 Ga0501071_0292446 3300049587 Bacteria 1234
406 Ga0501072_0056040 3300049588 Bacteria 3107
407 Ga0501073_0015928 3300049589 Bacteria 5448
408 Ga0501074_0196515 3300049590 Bacteria 1438
409 Ga0501074_0300318 3300049590 Bacteria 1140
410 Ga0501076_0065375 3300049592 Bacteria 2900
411 Ga0501079_0044164 3300049741 Bacteria 3439
412 Ga0501080_0100111 3300049742 Bacteria 2689
413 Ga0501080_0213870 3300049742 Bacteria 1766
414 Ga0501083_0004148 3300049744 Bacteria 10204
415 Ga0501083_0135065 3300049744 Bacteria 1616
416 Ga0501035_0007139 3300049822 Bacteria 10445
417 Ga0501044_0006522 3300049823 Bacteria 12889
418 Ga0501044_0103207 3300049823 Bacteria 2866
419 Ga0501044_0293120 3300049823 Bacteria 1558
420 Ga0501045_0050171 3300049824 Bacteria 3044
421 Ga0495601_0000017 3300053077 Bacteria 204209
422 Ga0495601_0004530 3300053077 Bacteria 8033
423 Ga0495601_0024345 3300053077 Bacteria 3728
424 Ga0495601_0026888 3300053077 Bacteria 3555
425 Ga0495601_0181949 3300053077 Bacteria 1374
426 Ga0495601_0269060 3300053077 Bacteria 1112
427 Ga0495612_0007191 3300053078 Bacteria 4553
428 Ga0495612_0026961 3300053078 Bacteria 2309
429 Ga0495655_0000258 3300053083 Bacteria 9877
430 Ga0495655_0019439 3300053083 Bacteria 1508
431 Ga0495595_0000007 3300053084 Bacteria 228504
432 Ga0495595_0000378 3300053084 Bacteria 16864
433 Ga0495619_0000001 3300053085 Bacteria 586054
434 Ga0495619_0000026 3300053085 Bacteria 167387
435 Ga0495619_0000088 3300053085 Bacteria 69615
436 Ga0495619_0000682 3300053085 Bacteria 22203
437 Ga0495619_0005677 3300053085 Bacteria 7913
438 Ga0495619_0009392 3300053085 Bacteria 6171
439 Ga0495619_0018618 3300053085 Bacteria 4407
440 Ga0495619_0215483 3300053085 Bacteria 1330
441 Ga0495619_0274008 3300053085 Bacteria 1169
442 Ga0500566_0011210 3300053094 Bacteria 5281
443 Ga0500641_0001015 3300053096 Bacteria 9981
444 Ga0500628_000072 3300053129 Bacteria 26251
445 Ga0501084_0166283 3300054114 Bacteria 1861
446 Ga0501082_0087473 3300060353 Bacteria 2688

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026078 Ga0207702_10195018 Ga0207702_101950181 239
2 3300041460 Ga0451802_1360614 Ga0451802_1360614_178_900 239
3 3300044901 Ga0466960_0228555 Ga0466960_0228555_11_730 239
4 3300046642 Ga0495634_0093614 Ga0495634_0093614_15_734 239
5 3300005367 Ga0070667_100453067 Ga0070667_1004530672 243
6 3300046692 Ga0495671_0152244 Ga0495671_0152244_239_1006 243
7 3300009101 Ga0105247_10422779 Ga0105247_104227791 245
8 3300046473 Ga0495582_0000003 Ga0495582_0000003_19138_19929 245
9 3300046683 Ga0495658_0000001 Ga0495658_0000001_152482_153273 245
10 3300041512 Ga0451853_1210896 Ga0451853_1210896_152_943 247
11 3300053077 Ga0495601_0024345 Ga0495601_0024345_2545_3336 248
12 3300046675 Ga0495657_0012043 Ga0495657_0012043_4826_5617 249
13 3300049588 Ga0501072_0056040 Ga0501072_0056040_1980_2732 249
14 3300046454 Ga0495592_0000024 Ga0495592_0000024_135059_135850 250
15 3300048908 Ga0496105_0089012 Ga0496105_0089012_1416_2207 251
16 3300006881 Ga0068865_100000499 Ga0068865_10000049922 252
17 3300025938 Ga0207704_10000104 Ga0207704_1000010410 252
18 3300046559 Ga0495667_0000038 Ga0495667_0000038_35701_36492 252
19 3300047322 Ga0495680_0001001 Ga0495680_0001001_10274_11065 252
20 3300005335 Ga0070666_10120319 Ga0070666_101203192 253
21 3300047321 Ga0495676_0015192 Ga0495676_0015192_1515_2303 253
22 3300048903 Ga0496100_0000001 Ga0496100_0000001_72575_73363 253
23 3300048904 Ga0496101_0000028 Ga0496101_0000028_72564_73352 253
24 3300048909 Ga0496106_0000218 Ga0496106_0000218_5578_6366 253
25 3300048910 Ga0496107_0000002 Ga0496107_0000002_175125_175913 253
26 3300005329 Ga0070683_100144319 Ga0070683_1001443191 254
27 3300005439 Ga0070711_100042995 Ga0070711_1000429952 254
28 3300009545 Ga0105237_10226265 Ga0105237_102262652 254
29 3300010375 Ga0105239_10223637 Ga0105239_102236372 254
30 3300025916 Ga0207663_10040991 Ga0207663_100409912 254
31 3300025944 Ga0207661_10123205 Ga0207661_101232052 254
32 3300041512 Ga0451853_3534475 Ga0451853_3534475_547_1311 254
33 3300045976 Ga0466967_0405145 Ga0466967_0405145_292_1059 254
34 3300046461 Ga0495641_0000004 Ga0495641_0000004_87068_87832 254
35 3300046461 Ga0495641_0017169 Ga0495641_0017169_477_1241 254
36 3300046463 Ga0495653_0064817 Ga0495653_0064817_297_1061 254
37 3300046477 Ga0495664_0275987 Ga0495664_0275987_147_914 254
38 3300046511 Ga0495608_0212587 Ga0495608_0212587_15_779 254
39 3300046516 Ga0495628_0000794 Ga0495628_0000794_1784_2548 254
40 3300046516 Ga0495628_0176835 Ga0495628_0176835_30_794 254
41 3300046529 Ga0495652_0000018 Ga0495652_0000018_94206_94970 254
42 3300046529 Ga0495652_0060643 Ga0495652_0060643_546_1310 254
43 3300046536 Ga0495587_0017028 Ga0495587_0017028_3368_4132 254
44 3300046543 Ga0495645_0021055 Ga0495645_0021055_2297_3061 254
45 3300046543 Ga0495645_0221247 Ga0495645_0221247_133_900 254
46 3300046642 Ga0495634_0006840 Ga0495634_0006840_2861_3628 254
47 3300046678 Ga0495599_0130511 Ga0495599_0130511_133_900 254
48 3300046684 Ga0495669_0099444 Ga0495669_0099444_372_1136 254
49 3300047321 Ga0495676_0024706 Ga0495676_0024706_2009_2773 254
50 3300047321 Ga0495676_0025193 Ga0495676_0025193_914_1678 254
51 3300047322 Ga0495680_0000007 Ga0495680_0000007_139306_140070 254
52 3300047472 Ga0495686_0059460 Ga0495686_0059460_1414_2205 254
53 3300048903 Ga0496100_0045865 Ga0496100_0045865_1576_2343 254
54 3300048907 Ga0496104_0000010 Ga0496104_0000010_226929_227693 254
55 3300048907 Ga0496104_0000230 Ga0496104_0000230_20691_21455 254
56 3300048907 Ga0496104_0232072 Ga0496104_0232072_351_1118 254
57 3300048908 Ga0496105_0000005 Ga0496105_0000005_226929_227693 254
58 3300048908 Ga0496105_0000051 Ga0496105_0000051_54829_55593 254
59 3300048908 Ga0496105_0004601 Ga0496105_0004601_266_1033 254
60 3300048910 Ga0496107_0064629 Ga0496107_0064629_1802_2569 254
61 3300048911 Ga0496108_0000004 Ga0496108_0000004_461547_462311 254
62 3300048912 Ga0496109_0000013 Ga0496109_0000013_143988_144752 254
63 3300048915 Ga0496112_0000026 Ga0496112_0000026_35776_36567 254
64 3300048919 Ga0496116_0001008 Ga0496116_0001008_12884_13651 254
65 3300048922 Ga0496119_0007530 Ga0496119_0007530_1179_1946 254
66 3300048922 Ga0496119_0038448 Ga0496119_0038448_832_1599 254
67 3300048922 Ga0496119_0044175 Ga0496119_0044175_712_1476 254
68 3300048924 Ga0496121_0043818 Ga0496121_0043818_1539_2306 254
69 3300048924 Ga0496121_0252195 Ga0496121_0252195_298_1065 254
70 3300048928 Ga0496125_0060081 Ga0496125_0060081_764_1528 254
71 3300048928 Ga0496125_0089546 Ga0496125_0089546_1503_2270 254
72 3300049568 Ga0501031_0020352 Ga0501031_0020352_2077_2844 254
73 3300049569 Ga0501032_0003121 Ga0501032_0003121_7748_8515 254
74 3300049570 Ga0501033_0001901 Ga0501033_0001901_1843_2610 254
75 3300049571 Ga0501034_0020205 Ga0501034_0020205_1797_2564 254
76 3300049571 Ga0501034_0172767 Ga0501034_0172767_49_816 254
77 3300049571 Ga0501034_0444896 Ga0501034_0444896_367_1134 254
78 3300049572 Ga0501036_0003397 Ga0501036_0003397_7725_8492 254
79 3300049573 Ga0501037_0001034 Ga0501037_0001034_4216_4983 254
80 3300049574 Ga0501038_0019841 Ga0501038_0019841_1801_2568 254
81 3300049575 Ga0501039_0014767 Ga0501039_0014767_1760_2527 254
82 3300049576 Ga0501040_0124216 Ga0501040_0124216_119_886 254
83 3300049576 Ga0501040_0334338 Ga0501040_0334338_22_789 254
84 3300049578 Ga0501042_0117019 Ga0501042_0117019_359_1126 254
85 3300049579 Ga0501043_0010305 Ga0501043_0010305_3487_4254 254
86 3300049580 Ga0501046_0004349 Ga0501046_0004349_7919_8686 254
87 3300049581 Ga0501047_0004614 Ga0501047_0004614_4417_5184 254
88 3300049581 Ga0501047_0028630 Ga0501047_0028630_3648_4415 254
89 3300049582 Ga0501048_0003121 Ga0501048_0003121_4226_4993 254
90 3300049583 Ga0501067_0151440 Ga0501067_0151440_369_1136 254
91 3300049584 Ga0501068_0102137 Ga0501068_0102137_239_1006 254
92 3300049584 Ga0501068_0167658 Ga0501068_0167658_606_1373 254
93 3300049585 Ga0501069_0009529 Ga0501069_0009529_2205_2972 254
94 3300049585 Ga0501069_0022233 Ga0501069_0022233_1630_2397 254
95 3300049586 Ga0501070_0001885 Ga0501070_0001885_2069_2836 254
96 3300049586 Ga0501070_0085919 Ga0501070_0085919_400_1167 254
97 3300049586 Ga0501070_0652605 Ga0501070_0652605_11_775 254
98 3300049587 Ga0501071_0039466 Ga0501071_0039466_1735_2502 254
99 3300049587 Ga0501071_0292446 Ga0501071_0292446_174_938 254
100 3300049589 Ga0501073_0015928 Ga0501073_0015928_1159_1926 254
101 3300049590 Ga0501074_0300318 Ga0501074_0300318_57_824 254
102 3300049741 Ga0501079_0044164 Ga0501079_0044164_520_1287 254
103 3300049742 Ga0501080_0100111 Ga0501080_0100111_129_896 254
104 3300049742 Ga0501080_0213870 Ga0501080_0213870_340_1107 254
105 3300049744 Ga0501083_0004148 Ga0501083_0004148_7645_8412 254
106 3300049744 Ga0501083_0135065 Ga0501083_0135065_457_1224 254
107 3300049822 Ga0501035_0007139 Ga0501035_0007139_1869_2636 254
108 3300049823 Ga0501044_0006522 Ga0501044_0006522_7772_8539 254
109 3300049823 Ga0501044_0103207 Ga0501044_0103207_1861_2628 254
110 3300049823 Ga0501044_0293120 Ga0501044_0293120_144_911 254
111 3300049824 Ga0501045_0050171 Ga0501045_0050171_412_1179 254
112 3300053077 Ga0495601_0181949 Ga0495601_0181949_296_1060 254
113 3300053077 Ga0495601_0269060 Ga0495601_0269060_170_937 254
114 3300053085 Ga0495619_0215483 Ga0495619_0215483_407_1174 254
115 3300054114 Ga0501084_0166283 Ga0501084_0166283_307_1074 254
116 3300060353 Ga0501082_0087473 Ga0501082_0087473_73_840 254
117 3300002074 JGI24748J21848_1012516 JGI24748J21848_10125162 255
118 3300002239 JGI24034J26672_10000115 JGI24034J26672_1000011513 255
119 3300002244 JGI24742J22300_10013599 JGI24742J22300_100135991 255
120 3300013104 Ga0157370_10010636 Ga0157370_100106367 255
121 3300013297 Ga0157378_10292773 Ga0157378_102927732 255
122 3300005455 Ga0070663_100005786 Ga0070663_1000057864 256
123 3300005458 Ga0070681_10208275 Ga0070681_102082752 256
124 3300005530 Ga0070679_100000471 Ga0070679_1000004715 256
125 3300025921 Ga0207652_10000412 Ga0207652_1000041240 256
126 3300025944 Ga0207661_10006993 Ga0207661_100069938 256
127 3300026067 Ga0207678_10002172 Ga0207678_1000217220 256
128 3300047321 Ga0495676_0149426 Ga0495676_0149426_474_1262 256
129 3300013102 Ga0157371_10004888 Ga0157371_1000488812 257
130 3300035118 Ga0373954_0084024 Ga0373954_0084024_514_1308 257
131 3300036401 Ga0373937_0067329 Ga0373937_0067329_2078_2872 257
132 3300048918 Ga0496115_0008810 Ga0496115_0008810_3743_4534 257
133 3300014968 Ga0157379_10083447 Ga0157379_100834472 258
134 3300005547 Ga0070693_100032067 Ga0070693_1000320672 262
135 3300005985 Ga0081539_10050002 Ga0081539_100500022 262
136 3300047447 Ga0495685_005973 Ga0495685_005973_1139_1927 262
137 3300049590 Ga0501074_0196515 Ga0501074_0196515_277_1074 262
138 3300000546 LJNas_1007531 LJNas_10075312 263
139 3300001979 JGI24740J21852_10007432 JGI24740J21852_100074322 263
140 3300005327 Ga0070658_10122027 Ga0070658_101220272 263
141 3300005329 Ga0070683_100007793 Ga0070683_10000779311 263
142 3300005329 Ga0070683_100135050 Ga0070683_1001350502 263
143 3300005331 Ga0070670_100018846 Ga0070670_1000188464 263
144 3300005333 Ga0070677_10000521 Ga0070677_1000052114 263
145 3300005336 Ga0070680_100164345 Ga0070680_1001643452 263
146 3300005337 Ga0070682_100000023 Ga0070682_100000023168 263
147 3300005337 Ga0070682_100000026 Ga0070682_100000026180 263
148 3300005338 Ga0068868_100000351 Ga0068868_10000035130 263
149 3300005341 Ga0070691_10000004 Ga0070691_1000000431 263
150 3300005344 Ga0070661_100000004 Ga0070661_100000004242 263
151 3300005345 Ga0070692_10077332 Ga0070692_100773322 263
152 3300005347 Ga0070668_100083713 Ga0070668_1000837132 263
153 3300005347 Ga0070668_100098913 Ga0070668_1000989132 263
154 3300005354 Ga0070675_100000050 Ga0070675_10000005044 263
155 3300005356 Ga0070674_100000002 Ga0070674_10000000233 263
156 3300005356 Ga0070674_100000205 Ga0070674_1000002055 263
157 3300005356 Ga0070674_100066311 Ga0070674_1000663112 263
158 3300005364 Ga0070673_100078818 Ga0070673_1000788182 263
159 3300005365 Ga0070688_100000010 Ga0070688_1000000104 263
160 3300005365 Ga0070688_100000161 Ga0070688_10000016138 263
161 3300005366 Ga0070659_100029785 Ga0070659_1000297855 263
162 3300005367 Ga0070667_100001110 Ga0070667_10000111013 263
163 3300005367 Ga0070667_100153489 Ga0070667_1001534892 263
164 3300005435 Ga0070714_100154429 Ga0070714_1001544292 263
165 3300005436 Ga0070713_100000503 Ga0070713_10000050321 263
166 3300005439 Ga0070711_100193794 Ga0070711_1001937942 263
167 3300005441 Ga0070700_100101282 Ga0070700_1001012822 263
168 3300005456 Ga0070678_100084275 Ga0070678_1000842752 263
169 3300005456 Ga0070678_100394544 Ga0070678_1003945441 263
170 3300005458 Ga0070681_10269558 Ga0070681_102695582 263
171 3300005459 Ga0068867_100000078 Ga0068867_10000007828 263
172 3300005466 Ga0070685_10000010 Ga0070685_10000010123 263
173 3300005466 Ga0070685_10000061 Ga0070685_1000006167 263
174 3300005530 Ga0070679_100000424 Ga0070679_1000004246 263
175 3300005535 Ga0070684_100056329 Ga0070684_1000563292 263
176 3300005535 Ga0070684_100135203 Ga0070684_1001352032 263
177 3300005539 Ga0068853_100007596 Ga0068853_1000075962 263
178 3300005543 Ga0070672_100000031 Ga0070672_10000003169 263
179 3300005544 Ga0070686_100158327 Ga0070686_1001583272 263
180 3300005546 Ga0070696_100476921 Ga0070696_1004769211 263
181 3300005548 Ga0070665_100000022 Ga0070665_10000002224 263
182 3300005548 Ga0070665_100026842 Ga0070665_1000268422 263
183 3300005548 Ga0070665_100068987 Ga0070665_1000689872 263
184 3300005548 Ga0070665_100241863 Ga0070665_1002418632 263
185 3300005548 Ga0070665_100263848 Ga0070665_1002638482 263
186 3300005549 Ga0070704_100070908 Ga0070704_1000709082 263
187 3300005578 Ga0068854_100000082 Ga0068854_10000008248 263
188 3300005578 Ga0068854_100156760 Ga0068854_1001567601 263
189 3300005614 Ga0068856_100000417 Ga0068856_10000041744 263
190 3300005614 Ga0068856_100018096 Ga0068856_1000180962 263
191 3300005614 Ga0068856_100027420 Ga0068856_1000274202 263
192 3300005616 Ga0068852_100000966 Ga0068852_1000009668 263
193 3300005616 Ga0068852_100113762 Ga0068852_1001137622 263
194 3300005718 Ga0068866_10000005 Ga0068866_100000055 263
195 3300005718 Ga0068866_10000206 Ga0068866_1000020625 263
196 3300005719 Ga0068861_100034640 Ga0068861_1000346402 263
197 3300005834 Ga0068851_10000141 Ga0068851_1000014139 263
198 3300005841 Ga0068863_100000261 Ga0068863_10000026125 263
199 3300005841 Ga0068863_100020755 Ga0068863_1000207557 263
200 3300005842 Ga0068858_100000046 Ga0068858_10000004665 263
201 3300005842 Ga0068858_100001180 Ga0068858_10000118024 263
202 3300005842 Ga0068858_100129653 Ga0068858_1001296532 263
203 3300005842 Ga0068858_100131860 Ga0068858_1001318602 263
204 3300005843 Ga0068860_100015233 Ga0068860_1000152334 263
205 3300005843 Ga0068860_100158523 Ga0068860_1001585232 263
206 3300005844 Ga0068862_100002784 Ga0068862_10000278413 263
207 3300005937 Ga0081455_10004942 Ga0081455_1000494213 263
208 3300005983 Ga0081540_1000557 Ga0081540_100055744 263
209 3300005985 Ga0081539_10000776 Ga0081539_1000077615 263
210 3300006163 Ga0070715_10000008 Ga0070715_1000000850 263
211 3300006175 Ga0070712_100000841 Ga0070712_10000084112 263
212 3300006846 Ga0075430_100076644 Ga0075430_1000766442 263
213 3300009093 Ga0105240_10507327 Ga0105240_105073272 263
214 3300009098 Ga0105245_10000040 Ga0105245_1000004029 263
215 3300009098 Ga0105245_10000314 Ga0105245_100003142 263
216 3300009098 Ga0105245_10000857 Ga0105245_100008572 263
217 3300009098 Ga0105245_10002546 Ga0105245_1000254617 263
218 3300009098 Ga0105245_10002546 Ga0105245_100025462 263
219 3300009101 Ga0105247_10000131 Ga0105247_1000013134 263
220 3300009148 Ga0105243_10161789 Ga0105243_101617892 263
221 3300009176 Ga0105242_10000063 Ga0105242_1000006338 263
222 3300009176 Ga0105242_10091455 Ga0105242_100914552 263
223 3300009176 Ga0105242_10392061 Ga0105242_103920612 263
224 3300009176 Ga0105242_10422907 Ga0105242_104229072 263
225 3300009177 Ga0105248_10000037 Ga0105248_10000037165 263
226 3300009553 Ga0105249_10000218 Ga0105249_1000021847 263
227 3300009553 Ga0105249_10074063 Ga0105249_100740632 263
228 3300009553 Ga0105249_10105682 Ga0105249_101056822 263
229 3300010375 Ga0105239_10276583 Ga0105239_102765831 263
230 3300010375 Ga0105239_10506416 Ga0105239_105064162 263
231 3300013104 Ga0157370_10014559 Ga0157370_100145598 263
232 3300013105 Ga0157369_10001730 Ga0157369_1000173015 263
233 3300013296 Ga0157374_10001797 Ga0157374_100017972 263
234 3300013296 Ga0157374_10058364 Ga0157374_100583644 263
235 3300013296 Ga0157374_10394726 Ga0157374_103947262 263
236 3300013297 Ga0157378_10219217 Ga0157378_102192172 263
237 3300013306 Ga0163162_10850559 Ga0163162_108505591 263
238 3300013308 Ga0157375_10044770 Ga0157375_100447704 263
239 3300013308 Ga0157375_10273456 Ga0157375_102734562 263
240 3300014325 Ga0163163_10530542 Ga0163163_105305422 263
241 3300014326 Ga0157380_10000007 Ga0157380_1000000726 263
242 3300014326 Ga0157380_10001943 Ga0157380_100019432 263
243 3300014968 Ga0157379_10015110 Ga0157379_100151102 263
244 3300014968 Ga0157379_10018096 Ga0157379_100180962 263
245 3300014969 Ga0157376_10147644 Ga0157376_101476442 263
246 3300014969 Ga0157376_10685128 Ga0157376_106851281 263
247 3300017792 Ga0163161_10000064 Ga0163161_10000064111 263
248 3300017792 Ga0163161_10193624 Ga0163161_101936242 263
249 3300025321 Ga0207656_10000380 Ga0207656_100003802 263
250 3300025885 Ga0207653_10022428 Ga0207653_100224282 263
251 3300025893 Ga0207682_10000769 Ga0207682_1000076917 263
252 3300025899 Ga0207642_10000005 Ga0207642_10000005210 263
253 3300025899 Ga0207642_10001468 Ga0207642_100014689 263
254 3300025900 Ga0207710_10000268 Ga0207710_1000026847 263
255 3300025905 Ga0207685_10000012 Ga0207685_1000001250 263
256 3300025909 Ga0207705_10019730 Ga0207705_100197302 263
257 3300025912 Ga0207707_10221557 Ga0207707_102215571 263
258 3300025913 Ga0207695_10074168 Ga0207695_100741682 263
259 3300025915 Ga0207693_10001350 Ga0207693_1000135020 263
260 3300025917 Ga0207660_10244081 Ga0207660_102440812 263
261 3300025920 Ga0207649_10000003 Ga0207649_1000000317 263
262 3300025921 Ga0207652_10000232 Ga0207652_1000023218 263
263 3300025925 Ga0207650_10021117 Ga0207650_100211173 263
264 3300025926 Ga0207659_10000055 Ga0207659_1000005546 263
265 3300025927 Ga0207687_10000040 Ga0207687_100000402 263
266 3300025927 Ga0207687_10000095 Ga0207687_1000009539 263
267 3300025927 Ga0207687_10000128 Ga0207687_1000012849 263
268 3300025927 Ga0207687_10082349 Ga0207687_100823492 263
269 3300025928 Ga0207700_10000003 Ga0207700_10000003169 263
270 3300025928 Ga0207700_10077530 Ga0207700_100775302 263
271 3300025929 Ga0207664_10094031 Ga0207664_100940312 263
272 3300025932 Ga0207690_10014580 Ga0207690_100145802 263
273 3300025934 Ga0207686_10000230 Ga0207686_1000023038 263
274 3300025934 Ga0207686_10000395 Ga0207686_1000039531 263
275 3300025934 Ga0207686_10231003 Ga0207686_102310032 263
276 3300025935 Ga0207709_10101698 Ga0207709_101016982 263
277 3300025937 Ga0207669_10000003 Ga0207669_10000003262 263
278 3300025937 Ga0207669_10000021 Ga0207669_1000002117 263
279 3300025940 Ga0207691_10000178 Ga0207691_1000017816 263
280 3300025941 Ga0207711_10000011 Ga0207711_10000011378 263
281 3300025944 Ga0207661_10000858 Ga0207661_1000085820 263
282 3300025944 Ga0207661_10001136 Ga0207661_1000113617 263
283 3300025944 Ga0207661_10081293 Ga0207661_100812932 263
284 3300025944 Ga0207661_10178225 Ga0207661_101782252 263
285 3300025949 Ga0207667_10054875 Ga0207667_100548752 263
286 3300025960 Ga0207651_10036181 Ga0207651_100361813 263
287 3300025961 Ga0207712_10000027 Ga0207712_10000027240 263
288 3300025961 Ga0207712_10198726 Ga0207712_101987262 263
289 3300025972 Ga0207668_10008828 Ga0207668_100088283 263
290 3300025981 Ga0207640_10000054 Ga0207640_1000005423 263
291 3300025981 Ga0207640_10110408 Ga0207640_101104082 263
292 3300025986 Ga0207658_10001811 Ga0207658_1000181115 263
293 3300025986 Ga0207658_10155859 Ga0207658_101558592 263
294 3300026023 Ga0207677_10000304 Ga0207677_1000030437 263
295 3300026035 Ga0207703_10000020 Ga0207703_1000002078 263
296 3300026035 Ga0207703_10000042 Ga0207703_1000004230 263
297 3300026035 Ga0207703_10148311 Ga0207703_101483112 263
298 3300026075 Ga0207708_10024542 Ga0207708_100245425 263
299 3300026075 Ga0207708_10144413 Ga0207708_101444132 263
300 3300026078 Ga0207702_10000105 Ga0207702_1000010585 263
301 3300026078 Ga0207702_10001788 Ga0207702_100017886 263
302 3300026078 Ga0207702_10016153 Ga0207702_100161532 263
303 3300026088 Ga0207641_10000062 Ga0207641_10000062143 263
304 3300026088 Ga0207641_10009398 Ga0207641_100093982 263
305 3300026089 Ga0207648_10000457 Ga0207648_1000045719 263
306 3300026118 Ga0207675_100064160 Ga0207675_1000641602 263
307 3300026118 Ga0207675_100100788 Ga0207675_1001007882 263
308 3300026121 Ga0207683_10100169 Ga0207683_101001692 263
309 3300026121 Ga0207683_10131689 Ga0207683_101316892 263
310 3300026142 Ga0207698_10000015 Ga0207698_10000015110 263
311 3300028379 Ga0268266_10000029 Ga0268266_10000029425 263
312 3300028379 Ga0268266_10000526 Ga0268266_1000052643 263
313 3300028379 Ga0268266_10000990 Ga0268266_1000099013 263
314 3300028379 Ga0268266_10122565 Ga0268266_101225652 263
315 3300028379 Ga0268266_10235356 Ga0268266_102353562 263
316 3300028380 Ga0268265_10001768 Ga0268265_1000176812 263
317 3300028381 Ga0268264_10021055 Ga0268264_100210552 263
318 3300028381 Ga0268264_10106030 Ga0268264_101060302 263
319 3300028556 Ga0265337_1000167 Ga0265337_100016733 263
320 3300028558 Ga0265326_10000452 Ga0265326_1000045212 263
321 3300028563 Ga0265319_1000010 Ga0265319_100001054 263
322 3300028573 Ga0265334_10087671 Ga0265334_100876711 263
323 3300028654 Ga0265322_10000005 Ga0265322_10000005155 263
324 3300028800 Ga0265338_10000287 Ga0265338_1000028755 263
325 3300029957 Ga0265324_10000183 Ga0265324_1000018338 263
326 3300031240 Ga0265320_10000010 Ga0265320_10000010201 263
327 3300031241 Ga0265325_10025508 Ga0265325_100255082 263
328 3300031242 Ga0265329_10004243 Ga0265329_100042435 263
329 3300031250 Ga0265331_10000217 Ga0265331_1000021743 263
330 3300031251 Ga0265327_10000040 Ga0265327_10000040105 263
331 3300031711 Ga0265314_10000578 Ga0265314_1000057847 263
332 3300041486 Ga0451807_0930195 Ga0451807_0930195_40_831 263
333 3300041509 Ga0451843_1191107 Ga0451843_1191107_16_807 263
334 3300044694 Ga0466963_0000233 Ga0466963_0000233_2030_2821 263
335 3300044694 Ga0466963_0008048 Ga0466963_0008048_4271_5062 263
336 3300044694 Ga0466963_0084612 Ga0466963_0084612_617_1408 263
337 3300044842 Ga0466957_0001268 Ga0466957_0001268_7696_8502 263
338 3300045836 Ga0466958_0045441 Ga0466958_0045441_947_1738 263
339 3300045976 Ga0466967_0000002 Ga0466967_0000002_23561_24352 263
340 3300045976 Ga0466967_0180846 Ga0466967_0180846_570_1361 263
341 3300046454 Ga0495592_0100353 Ga0495592_0100353_536_1327 263
342 3300046455 Ga0495603_0000102 Ga0495603_0000102_30513_31319 263
343 3300046455 Ga0495603_0027208 Ga0495603_0027208_1193_1984 263
344 3300046455 Ga0495603_0097966 Ga0495603_0097966_744_1535 263
345 3300046459 Ga0495629_0010954 Ga0495629_0010954_3810_4601 263
346 3300046459 Ga0495629_0029234 Ga0495629_0029234_1731_2522 263
347 3300046460 Ga0495638_0036473 Ga0495638_0036473_2198_2989 263
348 3300046476 Ga0495662_0000069 Ga0495662_0000069_28310_29101 263
349 3300046476 Ga0495662_0025721 Ga0495662_0025721_623_1414 263
350 3300046499 Ga0495594_0000009 Ga0495594_0000009_27462_28253 263
351 3300046499 Ga0495594_0207531 Ga0495594_0207531_229_1020 263
352 3300046507 Ga0495606_0000017 Ga0495606_0000017_48872_49678 263
353 3300046511 Ga0495608_0000013 Ga0495608_0000013_100804_101598 263
354 3300046511 Ga0495608_0000754 Ga0495608_0000754_590_1381 263
355 3300046512 Ga0495610_0110927 Ga0495610_0110927_44_850 263
356 3300046515 Ga0495620_0000041 Ga0495620_0000041_33121_33912 263
357 3300046516 Ga0495628_0004134 Ga0495628_0004134_11129_11926 263
358 3300046516 Ga0495628_0013643 Ga0495628_0013643_798_1589 263
359 3300046516 Ga0495628_0443786 Ga0495628_0443786_59_850 263
360 3300046517 Ga0495630_0000026 Ga0495630_0000026_101958_102749 263
361 3300046517 Ga0495630_0000032 Ga0495630_0000032_66525_67316 263
362 3300046517 Ga0495630_0237385 Ga0495630_0237385_118_909 263
363 3300046536 Ga0495587_0021994 Ga0495587_0021994_1689_2480 263
364 3300046539 Ga0495621_0002315 Ga0495621_0002315_3281_4072 263
365 3300046543 Ga0495645_0125239 Ga0495645_0125239_648_1439 263
366 3300046557 Ga0495622_0000097 Ga0495622_0000097_72666_73457 263
367 3300046615 Ga0495656_0022728 Ga0495656_0022728_709_1500 263
368 3300046616 Ga0495668_0168905 Ga0495668_0168905_118_909 263
369 3300046642 Ga0495634_0000002 Ga0495634_0000002_115189_115983 263
370 3300046642 Ga0495634_0070185 Ga0495634_0070185_1507_2298 263
371 3300046660 Ga0495625_0000243 Ga0495625_0000243_68033_68824 263
372 3300046660 Ga0495625_0083392 Ga0495625_0083392_276_1085 263
373 3300046663 Ga0495635_0046155 Ga0495635_0046155_830_1621 263
374 3300046674 Ga0495588_0000073 Ga0495588_0000073_180799_181605 263
375 3300046675 Ga0495657_0000003 Ga0495657_0000003_152003_152797 263
376 3300046675 Ga0495657_0065934 Ga0495657_0065934_1385_2176 263
377 3300046681 Ga0495647_0000585 Ga0495647_0000585_9197_9988 263
378 3300046681 Ga0495647_0074433 Ga0495647_0074433_361_1152 263
379 3300046683 Ga0495658_0000947 Ga0495658_0000947_11048_11839 263
380 3300046684 Ga0495669_0000609 Ga0495669_0000609_13567_14358 263
381 3300046689 Ga0495613_0000027 Ga0495613_0000027_143899_144705 263
382 3300046689 Ga0495613_0001632 Ga0495613_0001632_8920_9711 263
383 3300046690 Ga0495624_0000691 Ga0495624_0000691_24731_25522 263
384 3300046690 Ga0495624_0047286 Ga0495624_0047286_1351_2142 263
385 3300046691 Ga0495670_0008267 Ga0495670_0008267_2851_3642 263
386 3300046694 Ga0495649_0010793 Ga0495649_0010793_752_1543 263
387 3300047317 Ga0495604_0002435 Ga0495604_0002435_12684_13478 263
388 3300047317 Ga0495604_0037624 Ga0495604_0037624_1414_2205 263
389 3300047319 Ga0495674_0000039 Ga0495674_0000039_78028_78819 263
390 3300047321 Ga0495676_0210523 Ga0495676_0210523_503_1294 263
391 3300047322 Ga0495680_0000929 Ga0495680_0000929_30019_30810 263
392 3300047322 Ga0495680_0227189 Ga0495680_0227189_250_1041 263
393 3300047444 Ga0495675_0000002 Ga0495675_0000002_152003_152797 263
394 3300047446 Ga0495679_008360 Ga0495679_008360_2627_3418 263
395 3300047446 Ga0495679_042921 Ga0495679_042921_515_1306 263
396 3300048088 Ga0495602_0000034 Ga0495602_0000034_72249_73040 263
397 3300048088 Ga0495602_0009482 Ga0495602_0009482_1712_2509 263
398 3300048088 Ga0495602_0115818 Ga0495602_0115818_1006_1797 263
399 3300048088 Ga0495602_0124666 Ga0495602_0124666_591_1382 263
400 3300048903 Ga0496100_0000024 Ga0496100_0000024_82755_83546 263
401 3300048904 Ga0496101_0000072 Ga0496101_0000072_32593_33384 263
402 3300048905 Ga0496102_0000749 Ga0496102_0000749_28884_29675 263
403 3300048906 Ga0496103_0003112 Ga0496103_0003112_7383_8174 263
404 3300048906 Ga0496103_0019977 Ga0496103_0019977_2699_3490 263
405 3300048907 Ga0496104_0000008 Ga0496104_0000008_133188_133979 263
406 3300048908 Ga0496105_0000003 Ga0496105_0000003_133188_133979 263
407 3300048909 Ga0496106_0000040 Ga0496106_0000040_75371_76162 263
408 3300048910 Ga0496107_0000025 Ga0496107_0000025_82755_83546 263
409 3300048911 Ga0496108_0000005 Ga0496108_0000005_439781_440572 263
410 3300048911 Ga0496108_0001876 Ga0496108_0001876_5652_6446 263
411 3300048911 Ga0496108_0040737 Ga0496108_0040737_287_1093 263
412 3300048912 Ga0496109_0000002 Ga0496109_0000002_94520_95311 263
413 3300048912 Ga0496109_0000221 Ga0496109_0000221_39222_40028 263
414 3300048912 Ga0496109_0004919 Ga0496109_0004919_9259_10053 263
415 3300048913 Ga0496110_0000052 Ga0496110_0000052_25153_25944 263
416 3300048913 Ga0496110_0394639 Ga0496110_0394639_385_1194 263
417 3300048913 Ga0496110_0533312 Ga0496110_0533312_218_1009 263
418 3300048914 Ga0496111_0000209 Ga0496111_0000209_1174_1965 263
419 3300048914 Ga0496111_0357213 Ga0496111_0357213_125_916 263
420 3300048915 Ga0496112_0001298 Ga0496112_0001298_16750_17556 263
421 3300048916 Ga0496113_0000005 Ga0496113_0000005_96511_97317 263
422 3300048916 Ga0496113_0271913 Ga0496113_0271913_214_1005 263
423 3300048917 Ga0496114_0000003 Ga0496114_0000003_482312_483103 263
424 3300048917 Ga0496114_0046922 Ga0496114_0046922_1640_2434 263
425 3300048918 Ga0496115_0000016 Ga0496115_0000016_25470_26264 263
426 3300048918 Ga0496115_0000827 Ga0496115_0000827_13467_14258 263
427 3300049592 Ga0501076_0065375 Ga0501076_0065375_1290_2081 263
428 3300053077 Ga0495601_0000017 Ga0495601_0000017_2071_2862 263
429 3300053077 Ga0495601_0004530 Ga0495601_0004530_783_1574 263
430 3300053077 Ga0495601_0026888 Ga0495601_0026888_759_1550 263
431 3300053078 Ga0495612_0007191 Ga0495612_0007191_809_1600 263
432 3300053078 Ga0495612_0026961 Ga0495612_0026961_759_1550 263
433 3300053083 Ga0495655_0000258 Ga0495655_0000258_1824_2615 263
434 3300053083 Ga0495655_0019439 Ga0495655_0019439_153_959 263
435 3300053084 Ga0495595_0000007 Ga0495595_0000007_100827_101621 263
436 3300053084 Ga0495595_0000378 Ga0495595_0000378_14262_15053 263
437 3300053085 Ga0495619_0000001 Ga0495619_0000001_433322_434116 263
438 3300053085 Ga0495619_0000026 Ga0495619_0000026_70943_71737 263
439 3300053085 Ga0495619_0000088 Ga0495619_0000088_55317_56108 263
440 3300053085 Ga0495619_0000682 Ga0495619_0000682_20345_21136 263
441 3300053085 Ga0495619_0005677 Ga0495619_0005677_791_1582 263
442 3300053085 Ga0495619_0009392 Ga0495619_0009392_1013_1804 263
443 3300053085 Ga0495619_0018618 Ga0495619_0018618_144_935 263
444 3300053085 Ga0495619_0274008 Ga0495619_0274008_35_826 263
445 3300053094 Ga0500566_0011210 Ga0500566_0011210_3495_4286 263
446 3300053096 Ga0500641_0001015 Ga0500641_0001015_7079_7870 263
447 3300053129 Ga0500628_000072 Ga0500628_000072_7257_8048 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02790

COX2_TM

Cytochrome C oxidase subunit II, transmembrane domain

45

134

0.92

PF00116

COX2

Cytochrome C oxidase subunit II, periplasmic domain

165

246

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w5z-assembly1.cif.gz_c2 cryo-em structure of tetrahymena thermophila mitochondrial complex iv, composite dimer model 0.9148 146 231
4w9z-assembly1.cif.gz_A crystal structure of the periplasmic domain of subunit ii of cytochrome oxidase (coxb) of bradyrhizobium japonicum 0.9064 117 230
2cua-assembly1.cif.gz_A the cua domain of cytochrome ba3 from thermus thermophilus 0.8928 118 219
3qjs-assembly1.cif.gz_B the structure of and photolytic induced changes of carbon monoxide binding to the cytochrome ba3-oxidase from thermus thermophilus 0.8918 118 219
5u7n-assembly7.cif.gz_G crystal structure of a chimeric cua domain (subunit ii) of cytochrome ba3 from thermus thermophilus with the amicyanin loop 0.8918 118 219
ID Description Score Start End Superfamily
2yevE02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9511 119 230 2.60.40.420
af_A0A1D6ED90_406_498_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9489 146 227 2.60.40.420
af_P0ABJ1_113_282_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.944 118 229 2.60.40.420
af_A0A2P2CLF0_113_253_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9382 122 229 2.60.40.420
3hb3B01 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9288 120 233 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A382YL77-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9756 145 229 GO:0004129
GO:0005507
GO:0016020
GO:0020037
GO:0042773
AF-A0A2V8PE98-F1-model_v4 Cytochrome-c oxidase 0.957 146 219 GO:0004129
GO:0005507
GO:0016020
GO:0030313
AF-A0A5S9MLG3-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9539 134 229 GO:0004129
GO:0005507
GO:0005886
GO:0042773
AF-A0A3N5V1Y2-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9522 147 228 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A109ZZI2-F1-model_v4 cytochrome-c oxidase (EC 7.1.1.9) (Cytochrome c oxidase polypeptide II) 0.9491 146 229 GO:0004129
GO:0005507
GO:0031966
GO:0042773

Feature Viewer

pLDDT pTM Quality
85.85 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map