F445888
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 447 | 255 | 446 | 261 |
Family's Representative Sequence
| Representative Sequence | 3300005366|Ga0070659_100029785|Ga0070659_1000297855 |
| Length | 285 |
| Sequence | VRSVTWARKASRRRFNRMPAAPMYGRLPIVKMLLVTIAATAVISAVMLSINWDGQEASTAAPKIDDLLNVMIVLSSFVFSLVCVMLFYALWKFKAKPGDESDGEPIHGNTKLEIAWTLIPTIIVLFGGGYSWKVLNEIEEKQPNPLTVDVFSQQYAWSFAYPGKGYKYVEGEFHVPVDRQIVFKMHAQDVIHSFWVPEWRIKKDNVPGITTTAVVTPDVPGTYQLICTELCGFGHATMRAKVVVESPSKFKKWVDSLEQETPPELMESVKQDTQANPVNLGAGGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 58 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 127 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 128 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 129 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 130 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 131 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 132 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 133 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 134 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 135 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 136 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 137 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 138 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 139 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 140 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 141 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 142 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 143 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 144 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 145 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 146 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 147 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 148 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 149 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 150 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 200 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 201 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 202 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 203 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 204 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 205 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 208 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 209 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 210 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 211 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 212 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 213 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 214 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 215 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 216 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 217 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 252 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 253 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 254 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.67 |
| Nodule | 0 |
| Rhizoplane | 10.29 |
| Rhizosphere | 86.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1007531 | 3300000546 | Bacteria | 1173 |
| 2 | JGI24740J21852_10007432 | 3300001979 | Bacteria | 4456 |
| 3 | JGI24748J21848_1012516 | 3300002074 | Bacteria | 1001 |
| 4 | JGI24034J26672_10000115 | 3300002239 | Bacteria | 12949 |
| 5 | JGI24742J22300_10013599 | 3300002244 | Bacteria | 1362 |
| 6 | Ga0070658_10122027 | 3300005327 | Bacteria | 2166 |
| 7 | Ga0070683_100007793 | 3300005329 | Bacteria | 9067 |
| 8 | Ga0070683_100135050 | 3300005329 | Bacteria | 2336 |
| 9 | Ga0070683_100144319 | 3300005329 | Bacteria | 2255 |
| 10 | Ga0070670_100018846 | 3300005331 | Bacteria | 5918 |
| 11 | Ga0070677_10000521 | 3300005333 | Bacteria | 13187 |
| 12 | Ga0070666_10120319 | 3300005335 | Bacteria | 1820 |
| 13 | Ga0070680_100164345 | 3300005336 | Bacteria | 1866 |
| 14 | Ga0070682_100000023 | 3300005337 | Bacteria | 206016 |
| 15 | Ga0070682_100000026 | 3300005337 | Bacteria | 191388 |
| 16 | Ga0068868_100000351 | 3300005338 | Bacteria | 31294 |
| 17 | Ga0070691_10000004 | 3300005341 | Bacteria | 80156 |
| 18 | Ga0070661_100000004 | 3300005344 | Bacteria | 243876 |
| 19 | Ga0070692_10077332 | 3300005345 | Bacteria | 1785 |
| 20 | Ga0070668_100083713 | 3300005347 | Bacteria | 2504 |
| 21 | Ga0070668_100098913 | 3300005347 | Bacteria | 2309 |
| 22 | Ga0070675_100000050 | 3300005354 | Bacteria | 72016 |
| 23 | Ga0070674_100000002 | 3300005356 | Bacteria | 271088 |
| 24 | Ga0070674_100000205 | 3300005356 | Bacteria | 28334 |
| 25 | Ga0070674_100066311 | 3300005356 | Bacteria | 2536 |
| 26 | Ga0070673_100078818 | 3300005364 | Bacteria | 2666 |
| 27 | Ga0070688_100000010 | 3300005365 | Bacteria | 84103 |
| 28 | Ga0070688_100000161 | 3300005365 | Bacteria | 35812 |
| 29 | Ga0070659_100029785 | 3300005366 | Bacteria | 4220 |
| 30 | Ga0070667_100001110 | 3300005367 | Bacteria | 24556 |
| 31 | Ga0070667_100153489 | 3300005367 | Bacteria | 2024 |
| 32 | Ga0070667_100453067 | 3300005367 | Bacteria | 1172 |
| 33 | Ga0070714_100154429 | 3300005435 | Bacteria | 2071 |
| 34 | Ga0070713_100000503 | 3300005436 | Bacteria | 24991 |
| 35 | Ga0070711_100042995 | 3300005439 | Bacteria | 3057 |
| 36 | Ga0070711_100193794 | 3300005439 | Bacteria | 1563 |
| 37 | Ga0070700_100101282 | 3300005441 | Bacteria | 1898 |
| 38 | Ga0070663_100005786 | 3300005455 | Bacteria | 7380 |
| 39 | Ga0070678_100084275 | 3300005456 | Bacteria | 2419 |
| 40 | Ga0070678_100394544 | 3300005456 | Bacteria | 1201 |
| 41 | Ga0070681_10208275 | 3300005458 | Bacteria | 1872 |
| 42 | Ga0070681_10269558 | 3300005458 | Bacteria | 1614 |
| 43 | Ga0068867_100000078 | 3300005459 | Bacteria | 59729 |
| 44 | Ga0070685_10000010 | 3300005466 | Bacteria | 146946 |
| 45 | Ga0070685_10000061 | 3300005466 | Bacteria | 63408 |
| 46 | Ga0070679_100000424 | 3300005530 | Bacteria | 35927 |
| 47 | Ga0070679_100000471 | 3300005530 | Bacteria | 34374 |
| 48 | Ga0070684_100056329 | 3300005535 | Bacteria | 3430 |
| 49 | Ga0070684_100135203 | 3300005535 | Bacteria | 2226 |
| 50 | Ga0068853_100007596 | 3300005539 | Bacteria | 8682 |
| 51 | Ga0070672_100000031 | 3300005543 | Bacteria | 62241 |
| 52 | Ga0070686_100158327 | 3300005544 | Bacteria | 1592 |
| 53 | Ga0070696_100476921 | 3300005546 | Bacteria | 989 |
| 54 | Ga0070693_100032067 | 3300005547 | Bacteria | 2886 |
| 55 | Ga0070665_100000022 | 3300005548 | Bacteria | 379286 |
| 56 | Ga0070665_100026842 | 3300005548 | Bacteria | 5801 |
| 57 | Ga0070665_100068987 | 3300005548 | Bacteria | 3543 |
| 58 | Ga0070665_100241863 | 3300005548 | Bacteria | 1805 |
| 59 | Ga0070665_100263848 | 3300005548 | Bacteria | 1723 |
| 60 | Ga0070704_100070908 | 3300005549 | Bacteria | 2530 |
| 61 | Ga0068854_100000082 | 3300005578 | Bacteria | 68340 |
| 62 | Ga0068854_100156760 | 3300005578 | Bacteria | 1760 |
| 63 | Ga0068856_100000417 | 3300005614 | Bacteria | 46946 |
| 64 | Ga0068856_100018096 | 3300005614 | Bacteria | 6831 |
| 65 | Ga0068856_100027420 | 3300005614 | Bacteria | 5558 |
| 66 | Ga0068852_100000966 | 3300005616 | Bacteria | 18875 |
| 67 | Ga0068852_100113762 | 3300005616 | Bacteria | 2465 |
| 68 | Ga0068866_10000005 | 3300005718 | Bacteria | 196339 |
| 69 | Ga0068866_10000206 | 3300005718 | Bacteria | 27716 |
| 70 | Ga0068861_100034640 | 3300005719 | Bacteria | 3735 |
| 71 | Ga0068851_10000141 | 3300005834 | Bacteria | 38800 |
| 72 | Ga0068863_100000261 | 3300005841 | Bacteria | 55053 |
| 73 | Ga0068863_100020755 | 3300005841 | Bacteria | 6274 |
| 74 | Ga0068858_100000046 | 3300005842 | Bacteria | 127519 |
| 75 | Ga0068858_100001180 | 3300005842 | Bacteria | 27065 |
| 76 | Ga0068858_100129653 | 3300005842 | Bacteria | 2363 |
| 77 | Ga0068858_100131860 | 3300005842 | Bacteria | 2344 |
| 78 | Ga0068860_100015233 | 3300005843 | Bacteria | 7511 |
| 79 | Ga0068860_100158523 | 3300005843 | Bacteria | 2181 |
| 80 | Ga0068862_100002784 | 3300005844 | Bacteria | 15326 |
| 81 | Ga0081455_10004942 | 3300005937 | Bacteria | 14737 |
| 82 | Ga0081540_1000557 | 3300005983 | Bacteria | 36162 |
| 83 | Ga0081539_10000776 | 3300005985 | Bacteria | 62705 |
| 84 | Ga0081539_10050002 | 3300005985 | Bacteria | 2368 |
| 85 | Ga0070715_10000008 | 3300006163 | Bacteria | 189899 |
| 86 | Ga0070712_100000841 | 3300006175 | Bacteria | 18240 |
| 87 | Ga0075430_100076644 | 3300006846 | Bacteria | 2803 |
| 88 | Ga0068865_100000499 | 3300006881 | Bacteria | 22000 |
| 89 | Ga0105240_10507327 | 3300009093 | Bacteria | 1340 |
| 90 | Ga0105245_10000040 | 3300009098 | Bacteria | 144005 |
| 91 | Ga0105245_10000314 | 3300009098 | Bacteria | 46175 |
| 92 | Ga0105245_10000857 | 3300009098 | Bacteria | 27591 |
| 93 | Ga0105245_10002546 | 3300009098 | Bacteria | 16428 |
| 94 | Ga0105247_10000131 | 3300009101 | Bacteria | 72578 |
| 95 | Ga0105247_10422779 | 3300009101 | Bacteria | 954 |
| 96 | Ga0105243_10161789 | 3300009148 | Bacteria | 1931 |
| 97 | Ga0105242_10000063 | 3300009176 | Bacteria | 74721 |
| 98 | Ga0105242_10091455 | 3300009176 | Bacteria | 2561 |
| 99 | Ga0105242_10392061 | 3300009176 | Bacteria | 1293 |
| 100 | Ga0105242_10422907 | 3300009176 | Bacteria | 1249 |
| 101 | Ga0105248_10000037 | 3300009177 | Bacteria | 180751 |
| 102 | Ga0105237_10226265 | 3300009545 | Bacteria | 1871 |
| 103 | Ga0105249_10000218 | 3300009553 | Bacteria | 65480 |
| 104 | Ga0105249_10074063 | 3300009553 | Bacteria | 3151 |
| 105 | Ga0105249_10105682 | 3300009553 | Bacteria | 2655 |
| 106 | Ga0105239_10223637 | 3300010375 | Bacteria | 2111 |
| 107 | Ga0105239_10276583 | 3300010375 | Bacteria | 1889 |
| 108 | Ga0105239_10506416 | 3300010375 | Bacteria | 1373 |
| 109 | Ga0157371_10004888 | 3300013102 | Bacteria | 11513 |
| 110 | Ga0157370_10010636 | 3300013104 | Bacteria | 9684 |
| 111 | Ga0157370_10014559 | 3300013104 | Bacteria | 8039 |
| 112 | Ga0157369_10001730 | 3300013105 | Bacteria | 26528 |
| 113 | Ga0157374_10001797 | 3300013296 | Bacteria | 18046 |
| 114 | Ga0157374_10058364 | 3300013296 | Bacteria | 3606 |
| 115 | Ga0157374_10394726 | 3300013296 | Unclassified | 1379 |
| 116 | Ga0157378_10219217 | 3300013297 | Bacteria | 1808 |
| 117 | Ga0157378_10292773 | 3300013297 | Bacteria | 1573 |
| 118 | Ga0163162_10850559 | 3300013306 | Bacteria | 1027 |
| 119 | Ga0157375_10044770 | 3300013308 | Bacteria | 4303 |
| 120 | Ga0157375_10273456 | 3300013308 | Bacteria | 1852 |
| 121 | Ga0163163_10530542 | 3300014325 | Bacteria | 1239 |
| 122 | Ga0157380_10000007 | 3300014326 | Bacteria | 157634 |
| 123 | Ga0157380_10001943 | 3300014326 | Bacteria | 13750 |
| 124 | Ga0157379_10015110 | 3300014968 | Bacteria | 6771 |
| 125 | Ga0157379_10018096 | 3300014968 | Bacteria | 6209 |
| 126 | Ga0157379_10083447 | 3300014968 | Bacteria | 2864 |
| 127 | Ga0157376_10147644 | 3300014969 | Bacteria | 2117 |
| 128 | Ga0157376_10685128 | 3300014969 | Bacteria | 1029 |
| 129 | Ga0163161_10000064 | 3300017792 | Bacteria | 108508 |
| 130 | Ga0163161_10193624 | 3300017792 | Bacteria | 1564 |
| 131 | Ga0207656_10000380 | 3300025321 | Bacteria | 14901 |
| 132 | Ga0207653_10022428 | 3300025885 | Bacteria | 2005 |
| 133 | Ga0207682_10000769 | 3300025893 | Bacteria | 14799 |
| 134 | Ga0207642_10000005 | 3300025899 | Bacteria | 401934 |
| 135 | Ga0207642_10001468 | 3300025899 | Bacteria | 7292 |
| 136 | Ga0207710_10000268 | 3300025900 | Bacteria | 42956 |
| 137 | Ga0207685_10000012 | 3300025905 | Bacteria | 189900 |
| 138 | Ga0207705_10019730 | 3300025909 | Bacteria | 4820 |
| 139 | Ga0207707_10221557 | 3300025912 | Bacteria | 1647 |
| 140 | Ga0207695_10074168 | 3300025913 | Bacteria | 3464 |
| 141 | Ga0207693_10001350 | 3300025915 | Bacteria | 21696 |
| 142 | Ga0207663_10040991 | 3300025916 | Bacteria | 2819 |
| 143 | Ga0207660_10244081 | 3300025917 | Bacteria | 1416 |
| 144 | Ga0207649_10000003 | 3300025920 | Bacteria | 388908 |
| 145 | Ga0207652_10000232 | 3300025921 | Bacteria | 58473 |
| 146 | Ga0207652_10000412 | 3300025921 | Bacteria | 44366 |
| 147 | Ga0207650_10021117 | 3300025925 | Bacteria | 4602 |
| 148 | Ga0207659_10000055 | 3300025926 | Bacteria | 74252 |
| 149 | Ga0207687_10000040 | 3300025927 | Bacteria | 113598 |
| 150 | Ga0207687_10000095 | 3300025927 | Bacteria | 64664 |
| 151 | Ga0207687_10000128 | 3300025927 | Bacteria | 50603 |
| 152 | Ga0207687_10082349 | 3300025927 | Bacteria | 2328 |
| 153 | Ga0207700_10000003 | 3300025928 | Bacteria | 500797 |
| 154 | Ga0207700_10077530 | 3300025928 | Bacteria | 2582 |
| 155 | Ga0207664_10094031 | 3300025929 | Bacteria | 2463 |
| 156 | Ga0207690_10014580 | 3300025932 | Bacteria | 4747 |
| 157 | Ga0207686_10000230 | 3300025934 | Bacteria | 42566 |
| 158 | Ga0207686_10000395 | 3300025934 | Bacteria | 30349 |
| 159 | Ga0207686_10231003 | 3300025934 | Bacteria | 1341 |
| 160 | Ga0207709_10101698 | 3300025935 | Bacteria | 1901 |
| 161 | Ga0207669_10000003 | 3300025937 | Bacteria | 252239 |
| 162 | Ga0207669_10000021 | 3300025937 | Bacteria | 100327 |
| 163 | Ga0207704_10000104 | 3300025938 | Bacteria | 46614 |
| 164 | Ga0207691_10000178 | 3300025940 | Bacteria | 60110 |
| 165 | Ga0207711_10000011 | 3300025941 | Bacteria | 518817 |
| 166 | Ga0207661_10000858 | 3300025944 | Bacteria | 19953 |
| 167 | Ga0207661_10001136 | 3300025944 | Bacteria | 17743 |
| 168 | Ga0207661_10006993 | 3300025944 | Bacteria | 8002 |
| 169 | Ga0207661_10081293 | 3300025944 | Bacteria | 2676 |
| 170 | Ga0207661_10123205 | 3300025944 | Bacteria | 2210 |
| 171 | Ga0207661_10178225 | 3300025944 | Bacteria | 1854 |
| 172 | Ga0207667_10054875 | 3300025949 | Bacteria | 4191 |
| 173 | Ga0207651_10036181 | 3300025960 | Bacteria | 3220 |
| 174 | Ga0207712_10000027 | 3300025961 | Bacteria | 263739 |
| 175 | Ga0207712_10198726 | 3300025961 | Bacteria | 1588 |
| 176 | Ga0207668_10008828 | 3300025972 | Bacteria | 6024 |
| 177 | Ga0207640_10000054 | 3300025981 | Bacteria | 95136 |
| 178 | Ga0207640_10110408 | 3300025981 | Bacteria | 1948 |
| 179 | Ga0207658_10001811 | 3300025986 | Bacteria | 15995 |
| 180 | Ga0207658_10155859 | 3300025986 | Bacteria | 1866 |
| 181 | Ga0207677_10000304 | 3300026023 | Bacteria | 36147 |
| 182 | Ga0207703_10000020 | 3300026035 | Bacteria | 251603 |
| 183 | Ga0207703_10000042 | 3300026035 | Bacteria | 161459 |
| 184 | Ga0207703_10148311 | 3300026035 | Bacteria | 2043 |
| 185 | Ga0207678_10002172 | 3300026067 | Bacteria | 17730 |
| 186 | Ga0207708_10024542 | 3300026075 | Bacteria | 4562 |
| 187 | Ga0207708_10144413 | 3300026075 | Bacteria | 1869 |
| 188 | Ga0207702_10000105 | 3300026078 | Bacteria | 97835 |
| 189 | Ga0207702_10001788 | 3300026078 | Bacteria | 21174 |
| 190 | Ga0207702_10016153 | 3300026078 | Bacteria | 6180 |
| 191 | Ga0207702_10195018 | 3300026078 | Bacteria | 1874 |
| 192 | Ga0207641_10000062 | 3300026088 | Bacteria | 159982 |
| 193 | Ga0207641_10009398 | 3300026088 | Bacteria | 8058 |
| 194 | Ga0207648_10000457 | 3300026089 | Bacteria | 45386 |
| 195 | Ga0207675_100064160 | 3300026118 | Bacteria | 3433 |
| 196 | Ga0207675_100100788 | 3300026118 | Bacteria | 2721 |
| 197 | Ga0207683_10100169 | 3300026121 | Bacteria | 2586 |
| 198 | Ga0207683_10131689 | 3300026121 | Bacteria | 2249 |
| 199 | Ga0207698_10000015 | 3300026142 | Bacteria | 207368 |
| 200 | Ga0268266_10000029 | 3300028379 | Bacteria | 424015 |
| 201 | Ga0268266_10000526 | 3300028379 | Bacteria | 53404 |
| 202 | Ga0268266_10000990 | 3300028379 | Bacteria | 35791 |
| 203 | Ga0268266_10122565 | 3300028379 | Bacteria | 2315 |
| 204 | Ga0268266_10235356 | 3300028379 | Bacteria | 1688 |
| 205 | Ga0268265_10001768 | 3300028380 | Bacteria | 17341 |
| 206 | Ga0268264_10021055 | 3300028381 | Bacteria | 5330 |
| 207 | Ga0268264_10106030 | 3300028381 | Bacteria | 2452 |
| 208 | Ga0265337_1000167 | 3300028556 | Bacteria | 34055 |
| 209 | Ga0265326_10000452 | 3300028558 | Bacteria | 16152 |
| 210 | Ga0265319_1000010 | 3300028563 | Bacteria | 188773 |
| 211 | Ga0265334_10087671 | 3300028573 | Bacteria | 1139 |
| 212 | Ga0265322_10000005 | 3300028654 | Bacteria | 246112 |
| 213 | Ga0265338_10000287 | 3300028800 | Bacteria | 90818 |
| 214 | Ga0265324_10000183 | 3300029957 | Bacteria | 48185 |
| 215 | Ga0265320_10000010 | 3300031240 | Bacteria | 250501 |
| 216 | Ga0265325_10025508 | 3300031241 | Bacteria | 3209 |
| 217 | Ga0265329_10004243 | 3300031242 | Bacteria | 6019 |
| 218 | Ga0265331_10000217 | 3300031250 | Bacteria | 69142 |
| 219 | Ga0265327_10000040 | 3300031251 | Bacteria | 291052 |
| 220 | Ga0265314_10000578 | 3300031711 | Bacteria | 46350 |
| 221 | Ga0373954_0084024 | 3300035118 | Bacteria | 1524 |
| 222 | Ga0373937_0067329 | 3300036401 | Bacteria | 3299 |
| 223 | Ga0451802_1360614 | 3300041460 | Bacteria | 918 |
| 224 | Ga0451807_0930195 | 3300041486 | Unclassified | 1030 |
| 225 | Ga0451843_1191107 | 3300041509 | Bacteria | 1074 |
| 226 | Ga0451853_1210896 | 3300041512 | Bacteria | 1543 |
| 227 | Ga0451853_3534475 | 3300041512 | Bacteria | 1392 |
| 228 | Ga0466963_0000233 | 3300044694 | Bacteria | 24036 |
| 229 | Ga0466963_0008048 | 3300044694 | Bacteria | 6311 |
| 230 | Ga0466963_0084612 | 3300044694 | Bacteria | 2152 |
| 231 | Ga0466957_0001268 | 3300044842 | Bacteria | 13149 |
| 232 | Ga0466960_0228555 | 3300044901 | Unclassified | 1026 |
| 233 | Ga0466958_0045441 | 3300045836 | Bacteria | 2649 |
| 234 | Ga0466967_0000002 | 3300045976 | Bacteria | 219994 |
| 235 | Ga0466967_0180846 | 3300045976 | Bacteria | 1989 |
| 236 | Ga0466967_0405145 | 3300045976 | Bacteria | 1328 |
| 237 | Ga0495592_0000024 | 3300046454 | Bacteria | 136661 |
| 238 | Ga0495592_0100353 | 3300046454 | Bacteria | 2064 |
| 239 | Ga0495603_0000102 | 3300046455 | Bacteria | 40074 |
| 240 | Ga0495603_0027208 | 3300046455 | Bacteria | 3452 |
| 241 | Ga0495603_0097966 | 3300046455 | Unclassified | 1712 |
| 242 | Ga0495629_0010954 | 3300046459 | Bacteria | 6593 |
| 243 | Ga0495629_0029234 | 3300046459 | Bacteria | 3910 |
| 244 | Ga0495638_0036473 | 3300046460 | Bacteria | 3133 |
| 245 | Ga0495641_0000004 | 3300046461 | Bacteria | 210501 |
| 246 | Ga0495641_0017169 | 3300046461 | Bacteria | 3781 |
| 247 | Ga0495653_0064817 | 3300046463 | Bacteria | 2752 |
| 248 | Ga0495582_0000003 | 3300046473 | Bacteria | 168880 |
| 249 | Ga0495662_0000069 | 3300046476 | Bacteria | 36219 |
| 250 | Ga0495662_0025721 | 3300046476 | Bacteria | 2842 |
| 251 | Ga0495664_0275987 | 3300046477 | Bacteria | 1016 |
| 252 | Ga0495594_0000009 | 3300046499 | Bacteria | 122139 |
| 253 | Ga0495594_0207531 | 3300046499 | Bacteria | 1117 |
| 254 | Ga0495606_0000017 | 3300046507 | Bacteria | 284549 |
| 255 | Ga0495608_0000013 | 3300046511 | Bacteria | 228481 |
| 256 | Ga0495608_0000754 | 3300046511 | Bacteria | 22642 |
| 257 | Ga0495608_0212587 | 3300046511 | Bacteria | 1215 |
| 258 | Ga0495610_0110927 | 3300046512 | Bacteria | 1215 |
| 259 | Ga0495620_0000041 | 3300046515 | Bacteria | 112605 |
| 260 | Ga0495628_0000794 | 3300046516 | Bacteria | 29108 |
| 261 | Ga0495628_0004134 | 3300046516 | Bacteria | 12910 |
| 262 | Ga0495628_0013643 | 3300046516 | Bacteria | 6829 |
| 263 | Ga0495628_0176835 | 3300046516 | Bacteria | 1616 |
| 264 | Ga0495628_0443786 | 3300046516 | Bacteria | 943 |
| 265 | Ga0495630_0000026 | 3300046517 | Bacteria | 147084 |
| 266 | Ga0495630_0000032 | 3300046517 | Bacteria | 134425 |
| 267 | Ga0495630_0237385 | 3300046517 | Bacteria | 1393 |
| 268 | Ga0495652_0000018 | 3300046529 | Bacteria | 201634 |
| 269 | Ga0495652_0060643 | 3300046529 | Bacteria | 3196 |
| 270 | Ga0495587_0017028 | 3300046536 | Bacteria | 4519 |
| 271 | Ga0495587_0021994 | 3300046536 | Bacteria | 3930 |
| 272 | Ga0495621_0002315 | 3300046539 | Bacteria | 5108 |
| 273 | Ga0495645_0021055 | 3300046543 | Bacteria | 4712 |
| 274 | Ga0495645_0125239 | 3300046543 | Bacteria | 1806 |
| 275 | Ga0495645_0221247 | 3300046543 | Bacteria | 1273 |
| 276 | Ga0495622_0000097 | 3300046557 | Bacteria | 76953 |
| 277 | Ga0495667_0000038 | 3300046559 | Bacteria | 131349 |
| 278 | Ga0495656_0022728 | 3300046615 | Bacteria | 2460 |
| 279 | Ga0495668_0168905 | 3300046616 | Unclassified | 1198 |
| 280 | Ga0495634_0000002 | 3300046642 | Bacteria | 247842 |
| 281 | Ga0495634_0006840 | 3300046642 | Bacteria | 8627 |
| 282 | Ga0495634_0070185 | 3300046642 | Bacteria | 2310 |
| 283 | Ga0495634_0093614 | 3300046642 | Bacteria | 1948 |
| 284 | Ga0495625_0000243 | 3300046660 | Bacteria | 85589 |
| 285 | Ga0495625_0083392 | 3300046660 | Bacteria | 2222 |
| 286 | Ga0495635_0046155 | 3300046663 | Bacteria | 3005 |
| 287 | Ga0495588_0000073 | 3300046674 | Bacteria | 219005 |
| 288 | Ga0495657_0000003 | 3300046675 | Bacteria | 279680 |
| 289 | Ga0495657_0012043 | 3300046675 | Bacteria | 6435 |
| 290 | Ga0495657_0065934 | 3300046675 | Bacteria | 2380 |
| 291 | Ga0495599_0130511 | 3300046678 | Bacteria | 1561 |
| 292 | Ga0495647_0000585 | 3300046681 | Bacteria | 10787 |
| 293 | Ga0495647_0074433 | 3300046681 | Bacteria | 1365 |
| 294 | Ga0495658_0000001 | 3300046683 | Bacteria | 385362 |
| 295 | Ga0495658_0000947 | 3300046683 | Bacteria | 15486 |
| 296 | Ga0495669_0000609 | 3300046684 | Bacteria | 15639 |
| 297 | Ga0495669_0099444 | 3300046684 | Bacteria | 1350 |
| 298 | Ga0495613_0000027 | 3300046689 | Bacteria | 146674 |
| 299 | Ga0495613_0001632 | 3300046689 | Bacteria | 17071 |
| 300 | Ga0495624_0000691 | 3300046690 | Bacteria | 26457 |
| 301 | Ga0495624_0047286 | 3300046690 | Bacteria | 2734 |
| 302 | Ga0495670_0008267 | 3300046691 | Bacteria | 5117 |
| 303 | Ga0495671_0152244 | 3300046692 | Bacteria | 1126 |
| 304 | Ga0495649_0010793 | 3300046694 | Bacteria | 5380 |
| 305 | Ga0495604_0002435 | 3300047317 | Bacteria | 14888 |
| 306 | Ga0495604_0037624 | 3300047317 | Bacteria | 3809 |
| 307 | Ga0495674_0000039 | 3300047319 | Bacteria | 97645 |
| 308 | Ga0495676_0015192 | 3300047321 | Bacteria | 6865 |
| 309 | Ga0495676_0024706 | 3300047321 | Bacteria | 5195 |
| 310 | Ga0495676_0025193 | 3300047321 | Bacteria | 5139 |
| 311 | Ga0495676_0149426 | 3300047321 | Bacteria | 1665 |
| 312 | Ga0495676_0210523 | 3300047321 | Bacteria | 1345 |
| 313 | Ga0495680_0000007 | 3300047322 | Bacteria | 152053 |
| 314 | Ga0495680_0000929 | 3300047322 | Bacteria | 32526 |
| 315 | Ga0495680_0001001 | 3300047322 | Bacteria | 31451 |
| 316 | Ga0495680_0227189 | 3300047322 | Bacteria | 1330 |
| 317 | Ga0495675_0000002 | 3300047444 | Bacteria | 216469 |
| 318 | Ga0495679_008360 | 3300047446 | Bacteria | 4215 |
| 319 | Ga0495679_042921 | 3300047446 | Bacteria | 1393 |
| 320 | Ga0495685_005973 | 3300047447 | Bacteria | 3977 |
| 321 | Ga0495686_0059460 | 3300047472 | Bacteria | 2379 |
| 322 | Ga0495602_0000034 | 3300048088 | Bacteria | 140722 |
| 323 | Ga0495602_0009482 | 3300048088 | Bacteria | 10121 |
| 324 | Ga0495602_0115818 | 3300048088 | Bacteria | 2167 |
| 325 | Ga0495602_0124666 | 3300048088 | Bacteria | 2066 |
| 326 | Ga0496100_0000001 | 3300048903 | Bacteria | 530179 |
| 327 | Ga0496100_0000024 | 3300048903 | Bacteria | 116138 |
| 328 | Ga0496100_0045865 | 3300048903 | Bacteria | 2807 |
| 329 | Ga0496101_0000028 | 3300048904 | Bacteria | 198664 |
| 330 | Ga0496101_0000072 | 3300048904 | Bacteria | 116138 |
| 331 | Ga0496102_0000749 | 3300048905 | Bacteria | 31723 |
| 332 | Ga0496103_0003112 | 3300048906 | Bacteria | 10202 |
| 333 | Ga0496103_0019977 | 3300048906 | Bacteria | 4023 |
| 334 | Ga0496104_0000008 | 3300048907 | Bacteria | 516976 |
| 335 | Ga0496104_0000010 | 3300048907 | Bacteria | 475255 |
| 336 | Ga0496104_0000230 | 3300048907 | Bacteria | 49225 |
| 337 | Ga0496104_0232072 | 3300048907 | Bacteria | 1757 |
| 338 | Ga0496105_0000003 | 3300048908 | Bacteria | 713251 |
| 339 | Ga0496105_0000005 | 3300048908 | Bacteria | 475797 |
| 340 | Ga0496105_0000051 | 3300048908 | Bacteria | 90365 |
| 341 | Ga0496105_0004601 | 3300048908 | Bacteria | 10395 |
| 342 | Ga0496105_0089012 | 3300048908 | Bacteria | 2550 |
| 343 | Ga0496106_0000040 | 3300048909 | Bacteria | 108754 |
| 344 | Ga0496106_0000218 | 3300048909 | Bacteria | 40075 |
| 345 | Ga0496107_0000002 | 3300048910 | Bacteria | 320871 |
| 346 | Ga0496107_0000025 | 3300048910 | Bacteria | 116138 |
| 347 | Ga0496107_0064629 | 3300048910 | Bacteria | 2653 |
| 348 | Ga0496108_0000004 | 3300048911 | Bacteria | 545055 |
| 349 | Ga0496108_0000005 | 3300048911 | Bacteria | 535059 |
| 350 | Ga0496108_0001876 | 3300048911 | Bacteria | 16829 |
| 351 | Ga0496108_0040737 | 3300048911 | Bacteria | 3874 |
| 352 | Ga0496109_0000002 | 3300048912 | Bacteria | 443393 |
| 353 | Ga0496109_0000013 | 3300048912 | Bacteria | 227469 |
| 354 | Ga0496109_0000221 | 3300048912 | Bacteria | 56054 |
| 355 | Ga0496109_0004919 | 3300048912 | Bacteria | 11154 |
| 356 | Ga0496110_0000052 | 3300048913 | Bacteria | 58549 |
| 357 | Ga0496110_0394639 | 3300048913 | Bacteria | 1261 |
| 358 | Ga0496110_0533312 | 3300048913 | Bacteria | 1067 |
| 359 | Ga0496111_0000209 | 3300048914 | Bacteria | 27572 |
| 360 | Ga0496111_0357213 | 3300048914 | Bacteria | 1081 |
| 361 | Ga0496112_0000026 | 3300048915 | Bacteria | 144758 |
| 362 | Ga0496112_0001298 | 3300048915 | Bacteria | 18986 |
| 363 | Ga0496113_0000005 | 3300048916 | Bacteria | 105956 |
| 364 | Ga0496113_0271913 | 3300048916 | Bacteria | 1354 |
| 365 | Ga0496114_0000003 | 3300048917 | Bacteria | 630981 |
| 366 | Ga0496114_0046922 | 3300048917 | Bacteria | 3591 |
| 367 | Ga0496115_0000016 | 3300048918 | Bacteria | 187067 |
| 368 | Ga0496115_0000827 | 3300048918 | Bacteria | 22678 |
| 369 | Ga0496115_0008810 | 3300048918 | Bacteria | 7475 |
| 370 | Ga0496116_0001008 | 3300048919 | Bacteria | 34374 |
| 371 | Ga0496119_0007530 | 3300048922 | Bacteria | 9784 |
| 372 | Ga0496119_0038448 | 3300048922 | Bacteria | 3091 |
| 373 | Ga0496119_0044175 | 3300048922 | Bacteria | 2808 |
| 374 | Ga0496121_0043818 | 3300048924 | Bacteria | 3869 |
| 375 | Ga0496121_0252195 | 3300048924 | Bacteria | 1223 |
| 376 | Ga0496125_0060081 | 3300048928 | Bacteria | 3058 |
| 377 | Ga0496125_0089546 | 3300048928 | Bacteria | 2314 |
| 378 | Ga0501031_0020352 | 3300049568 | Bacteria | 4325 |
| 379 | Ga0501032_0003121 | 3300049569 | Bacteria | 12764 |
| 380 | Ga0501033_0001901 | 3300049570 | Bacteria | 18171 |
| 381 | Ga0501034_0020205 | 3300049571 | Bacteria | 6800 |
| 382 | Ga0501034_0172767 | 3300049571 | Bacteria | 2127 |
| 383 | Ga0501034_0444896 | 3300049571 | Bacteria | 1214 |
| 384 | Ga0501036_0003397 | 3300049572 | Bacteria | 12722 |
| 385 | Ga0501037_0001034 | 3300049573 | Bacteria | 20571 |
| 386 | Ga0501038_0019841 | 3300049574 | Bacteria | 6051 |
| 387 | Ga0501039_0014767 | 3300049575 | Bacteria | 5974 |
| 388 | Ga0501040_0124216 | 3300049576 | Bacteria | 1812 |
| 389 | Ga0501040_0334338 | 3300049576 | Bacteria | 1084 |
| 390 | Ga0501042_0117019 | 3300049578 | Bacteria | 1919 |
| 391 | Ga0501043_0010305 | 3300049579 | Bacteria | 7328 |
| 392 | Ga0501046_0004349 | 3300049580 | Bacteria | 12898 |
| 393 | Ga0501047_0004614 | 3300049581 | Bacteria | 12960 |
| 394 | Ga0501047_0028630 | 3300049581 | Bacteria | 5372 |
| 395 | Ga0501048_0003121 | 3300049582 | Bacteria | 12648 |
| 396 | Ga0501067_0151440 | 3300049583 | Bacteria | 1292 |
| 397 | Ga0501068_0102137 | 3300049584 | Bacteria | 1778 |
| 398 | Ga0501068_0167658 | 3300049584 | Bacteria | 1385 |
| 399 | Ga0501069_0009529 | 3300049585 | Bacteria | 5125 |
| 400 | Ga0501069_0022233 | 3300049585 | Bacteria | 3447 |
| 401 | Ga0501070_0001885 | 3300049586 | Bacteria | 18541 |
| 402 | Ga0501070_0085919 | 3300049586 | Bacteria | 2604 |
| 403 | Ga0501070_0652605 | 3300049586 | Bacteria | 835 |
| 404 | Ga0501071_0039466 | 3300049587 | Bacteria | 3378 |
| 405 | Ga0501071_0292446 | 3300049587 | Bacteria | 1234 |
| 406 | Ga0501072_0056040 | 3300049588 | Bacteria | 3107 |
| 407 | Ga0501073_0015928 | 3300049589 | Bacteria | 5448 |
| 408 | Ga0501074_0196515 | 3300049590 | Bacteria | 1438 |
| 409 | Ga0501074_0300318 | 3300049590 | Bacteria | 1140 |
| 410 | Ga0501076_0065375 | 3300049592 | Bacteria | 2900 |
| 411 | Ga0501079_0044164 | 3300049741 | Bacteria | 3439 |
| 412 | Ga0501080_0100111 | 3300049742 | Bacteria | 2689 |
| 413 | Ga0501080_0213870 | 3300049742 | Bacteria | 1766 |
| 414 | Ga0501083_0004148 | 3300049744 | Bacteria | 10204 |
| 415 | Ga0501083_0135065 | 3300049744 | Bacteria | 1616 |
| 416 | Ga0501035_0007139 | 3300049822 | Bacteria | 10445 |
| 417 | Ga0501044_0006522 | 3300049823 | Bacteria | 12889 |
| 418 | Ga0501044_0103207 | 3300049823 | Bacteria | 2866 |
| 419 | Ga0501044_0293120 | 3300049823 | Bacteria | 1558 |
| 420 | Ga0501045_0050171 | 3300049824 | Bacteria | 3044 |
| 421 | Ga0495601_0000017 | 3300053077 | Bacteria | 204209 |
| 422 | Ga0495601_0004530 | 3300053077 | Bacteria | 8033 |
| 423 | Ga0495601_0024345 | 3300053077 | Bacteria | 3728 |
| 424 | Ga0495601_0026888 | 3300053077 | Bacteria | 3555 |
| 425 | Ga0495601_0181949 | 3300053077 | Bacteria | 1374 |
| 426 | Ga0495601_0269060 | 3300053077 | Bacteria | 1112 |
| 427 | Ga0495612_0007191 | 3300053078 | Bacteria | 4553 |
| 428 | Ga0495612_0026961 | 3300053078 | Bacteria | 2309 |
| 429 | Ga0495655_0000258 | 3300053083 | Bacteria | 9877 |
| 430 | Ga0495655_0019439 | 3300053083 | Bacteria | 1508 |
| 431 | Ga0495595_0000007 | 3300053084 | Bacteria | 228504 |
| 432 | Ga0495595_0000378 | 3300053084 | Bacteria | 16864 |
| 433 | Ga0495619_0000001 | 3300053085 | Bacteria | 586054 |
| 434 | Ga0495619_0000026 | 3300053085 | Bacteria | 167387 |
| 435 | Ga0495619_0000088 | 3300053085 | Bacteria | 69615 |
| 436 | Ga0495619_0000682 | 3300053085 | Bacteria | 22203 |
| 437 | Ga0495619_0005677 | 3300053085 | Bacteria | 7913 |
| 438 | Ga0495619_0009392 | 3300053085 | Bacteria | 6171 |
| 439 | Ga0495619_0018618 | 3300053085 | Bacteria | 4407 |
| 440 | Ga0495619_0215483 | 3300053085 | Bacteria | 1330 |
| 441 | Ga0495619_0274008 | 3300053085 | Bacteria | 1169 |
| 442 | Ga0500566_0011210 | 3300053094 | Bacteria | 5281 |
| 443 | Ga0500641_0001015 | 3300053096 | Bacteria | 9981 |
| 444 | Ga0500628_000072 | 3300053129 | Bacteria | 26251 |
| 445 | Ga0501084_0166283 | 3300054114 | Bacteria | 1861 |
| 446 | Ga0501082_0087473 | 3300060353 | Bacteria | 2688 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026078 | Ga0207702_10195018 | Ga0207702_101950181 | 239 |
| 2 | 3300041460 | Ga0451802_1360614 | Ga0451802_1360614_178_900 | 239 |
| 3 | 3300044901 | Ga0466960_0228555 | Ga0466960_0228555_11_730 | 239 |
| 4 | 3300046642 | Ga0495634_0093614 | Ga0495634_0093614_15_734 | 239 |
| 5 | 3300005367 | Ga0070667_100453067 | Ga0070667_1004530672 | 243 |
| 6 | 3300046692 | Ga0495671_0152244 | Ga0495671_0152244_239_1006 | 243 |
| 7 | 3300009101 | Ga0105247_10422779 | Ga0105247_104227791 | 245 |
| 8 | 3300046473 | Ga0495582_0000003 | Ga0495582_0000003_19138_19929 | 245 |
| 9 | 3300046683 | Ga0495658_0000001 | Ga0495658_0000001_152482_153273 | 245 |
| 10 | 3300041512 | Ga0451853_1210896 | Ga0451853_1210896_152_943 | 247 |
| 11 | 3300053077 | Ga0495601_0024345 | Ga0495601_0024345_2545_3336 | 248 |
| 12 | 3300046675 | Ga0495657_0012043 | Ga0495657_0012043_4826_5617 | 249 |
| 13 | 3300049588 | Ga0501072_0056040 | Ga0501072_0056040_1980_2732 | 249 |
| 14 | 3300046454 | Ga0495592_0000024 | Ga0495592_0000024_135059_135850 | 250 |
| 15 | 3300048908 | Ga0496105_0089012 | Ga0496105_0089012_1416_2207 | 251 |
| 16 | 3300006881 | Ga0068865_100000499 | Ga0068865_10000049922 | 252 |
| 17 | 3300025938 | Ga0207704_10000104 | Ga0207704_1000010410 | 252 |
| 18 | 3300046559 | Ga0495667_0000038 | Ga0495667_0000038_35701_36492 | 252 |
| 19 | 3300047322 | Ga0495680_0001001 | Ga0495680_0001001_10274_11065 | 252 |
| 20 | 3300005335 | Ga0070666_10120319 | Ga0070666_101203192 | 253 |
| 21 | 3300047321 | Ga0495676_0015192 | Ga0495676_0015192_1515_2303 | 253 |
| 22 | 3300048903 | Ga0496100_0000001 | Ga0496100_0000001_72575_73363 | 253 |
| 23 | 3300048904 | Ga0496101_0000028 | Ga0496101_0000028_72564_73352 | 253 |
| 24 | 3300048909 | Ga0496106_0000218 | Ga0496106_0000218_5578_6366 | 253 |
| 25 | 3300048910 | Ga0496107_0000002 | Ga0496107_0000002_175125_175913 | 253 |
| 26 | 3300005329 | Ga0070683_100144319 | Ga0070683_1001443191 | 254 |
| 27 | 3300005439 | Ga0070711_100042995 | Ga0070711_1000429952 | 254 |
| 28 | 3300009545 | Ga0105237_10226265 | Ga0105237_102262652 | 254 |
| 29 | 3300010375 | Ga0105239_10223637 | Ga0105239_102236372 | 254 |
| 30 | 3300025916 | Ga0207663_10040991 | Ga0207663_100409912 | 254 |
| 31 | 3300025944 | Ga0207661_10123205 | Ga0207661_101232052 | 254 |
| 32 | 3300041512 | Ga0451853_3534475 | Ga0451853_3534475_547_1311 | 254 |
| 33 | 3300045976 | Ga0466967_0405145 | Ga0466967_0405145_292_1059 | 254 |
| 34 | 3300046461 | Ga0495641_0000004 | Ga0495641_0000004_87068_87832 | 254 |
| 35 | 3300046461 | Ga0495641_0017169 | Ga0495641_0017169_477_1241 | 254 |
| 36 | 3300046463 | Ga0495653_0064817 | Ga0495653_0064817_297_1061 | 254 |
| 37 | 3300046477 | Ga0495664_0275987 | Ga0495664_0275987_147_914 | 254 |
| 38 | 3300046511 | Ga0495608_0212587 | Ga0495608_0212587_15_779 | 254 |
| 39 | 3300046516 | Ga0495628_0000794 | Ga0495628_0000794_1784_2548 | 254 |
| 40 | 3300046516 | Ga0495628_0176835 | Ga0495628_0176835_30_794 | 254 |
| 41 | 3300046529 | Ga0495652_0000018 | Ga0495652_0000018_94206_94970 | 254 |
| 42 | 3300046529 | Ga0495652_0060643 | Ga0495652_0060643_546_1310 | 254 |
| 43 | 3300046536 | Ga0495587_0017028 | Ga0495587_0017028_3368_4132 | 254 |
| 44 | 3300046543 | Ga0495645_0021055 | Ga0495645_0021055_2297_3061 | 254 |
| 45 | 3300046543 | Ga0495645_0221247 | Ga0495645_0221247_133_900 | 254 |
| 46 | 3300046642 | Ga0495634_0006840 | Ga0495634_0006840_2861_3628 | 254 |
| 47 | 3300046678 | Ga0495599_0130511 | Ga0495599_0130511_133_900 | 254 |
| 48 | 3300046684 | Ga0495669_0099444 | Ga0495669_0099444_372_1136 | 254 |
| 49 | 3300047321 | Ga0495676_0024706 | Ga0495676_0024706_2009_2773 | 254 |
| 50 | 3300047321 | Ga0495676_0025193 | Ga0495676_0025193_914_1678 | 254 |
| 51 | 3300047322 | Ga0495680_0000007 | Ga0495680_0000007_139306_140070 | 254 |
| 52 | 3300047472 | Ga0495686_0059460 | Ga0495686_0059460_1414_2205 | 254 |
| 53 | 3300048903 | Ga0496100_0045865 | Ga0496100_0045865_1576_2343 | 254 |
| 54 | 3300048907 | Ga0496104_0000010 | Ga0496104_0000010_226929_227693 | 254 |
| 55 | 3300048907 | Ga0496104_0000230 | Ga0496104_0000230_20691_21455 | 254 |
| 56 | 3300048907 | Ga0496104_0232072 | Ga0496104_0232072_351_1118 | 254 |
| 57 | 3300048908 | Ga0496105_0000005 | Ga0496105_0000005_226929_227693 | 254 |
| 58 | 3300048908 | Ga0496105_0000051 | Ga0496105_0000051_54829_55593 | 254 |
| 59 | 3300048908 | Ga0496105_0004601 | Ga0496105_0004601_266_1033 | 254 |
| 60 | 3300048910 | Ga0496107_0064629 | Ga0496107_0064629_1802_2569 | 254 |
| 61 | 3300048911 | Ga0496108_0000004 | Ga0496108_0000004_461547_462311 | 254 |
| 62 | 3300048912 | Ga0496109_0000013 | Ga0496109_0000013_143988_144752 | 254 |
| 63 | 3300048915 | Ga0496112_0000026 | Ga0496112_0000026_35776_36567 | 254 |
| 64 | 3300048919 | Ga0496116_0001008 | Ga0496116_0001008_12884_13651 | 254 |
| 65 | 3300048922 | Ga0496119_0007530 | Ga0496119_0007530_1179_1946 | 254 |
| 66 | 3300048922 | Ga0496119_0038448 | Ga0496119_0038448_832_1599 | 254 |
| 67 | 3300048922 | Ga0496119_0044175 | Ga0496119_0044175_712_1476 | 254 |
| 68 | 3300048924 | Ga0496121_0043818 | Ga0496121_0043818_1539_2306 | 254 |
| 69 | 3300048924 | Ga0496121_0252195 | Ga0496121_0252195_298_1065 | 254 |
| 70 | 3300048928 | Ga0496125_0060081 | Ga0496125_0060081_764_1528 | 254 |
| 71 | 3300048928 | Ga0496125_0089546 | Ga0496125_0089546_1503_2270 | 254 |
| 72 | 3300049568 | Ga0501031_0020352 | Ga0501031_0020352_2077_2844 | 254 |
| 73 | 3300049569 | Ga0501032_0003121 | Ga0501032_0003121_7748_8515 | 254 |
| 74 | 3300049570 | Ga0501033_0001901 | Ga0501033_0001901_1843_2610 | 254 |
| 75 | 3300049571 | Ga0501034_0020205 | Ga0501034_0020205_1797_2564 | 254 |
| 76 | 3300049571 | Ga0501034_0172767 | Ga0501034_0172767_49_816 | 254 |
| 77 | 3300049571 | Ga0501034_0444896 | Ga0501034_0444896_367_1134 | 254 |
| 78 | 3300049572 | Ga0501036_0003397 | Ga0501036_0003397_7725_8492 | 254 |
| 79 | 3300049573 | Ga0501037_0001034 | Ga0501037_0001034_4216_4983 | 254 |
| 80 | 3300049574 | Ga0501038_0019841 | Ga0501038_0019841_1801_2568 | 254 |
| 81 | 3300049575 | Ga0501039_0014767 | Ga0501039_0014767_1760_2527 | 254 |
| 82 | 3300049576 | Ga0501040_0124216 | Ga0501040_0124216_119_886 | 254 |
| 83 | 3300049576 | Ga0501040_0334338 | Ga0501040_0334338_22_789 | 254 |
| 84 | 3300049578 | Ga0501042_0117019 | Ga0501042_0117019_359_1126 | 254 |
| 85 | 3300049579 | Ga0501043_0010305 | Ga0501043_0010305_3487_4254 | 254 |
| 86 | 3300049580 | Ga0501046_0004349 | Ga0501046_0004349_7919_8686 | 254 |
| 87 | 3300049581 | Ga0501047_0004614 | Ga0501047_0004614_4417_5184 | 254 |
| 88 | 3300049581 | Ga0501047_0028630 | Ga0501047_0028630_3648_4415 | 254 |
| 89 | 3300049582 | Ga0501048_0003121 | Ga0501048_0003121_4226_4993 | 254 |
| 90 | 3300049583 | Ga0501067_0151440 | Ga0501067_0151440_369_1136 | 254 |
| 91 | 3300049584 | Ga0501068_0102137 | Ga0501068_0102137_239_1006 | 254 |
| 92 | 3300049584 | Ga0501068_0167658 | Ga0501068_0167658_606_1373 | 254 |
| 93 | 3300049585 | Ga0501069_0009529 | Ga0501069_0009529_2205_2972 | 254 |
| 94 | 3300049585 | Ga0501069_0022233 | Ga0501069_0022233_1630_2397 | 254 |
| 95 | 3300049586 | Ga0501070_0001885 | Ga0501070_0001885_2069_2836 | 254 |
| 96 | 3300049586 | Ga0501070_0085919 | Ga0501070_0085919_400_1167 | 254 |
| 97 | 3300049586 | Ga0501070_0652605 | Ga0501070_0652605_11_775 | 254 |
| 98 | 3300049587 | Ga0501071_0039466 | Ga0501071_0039466_1735_2502 | 254 |
| 99 | 3300049587 | Ga0501071_0292446 | Ga0501071_0292446_174_938 | 254 |
| 100 | 3300049589 | Ga0501073_0015928 | Ga0501073_0015928_1159_1926 | 254 |
| 101 | 3300049590 | Ga0501074_0300318 | Ga0501074_0300318_57_824 | 254 |
| 102 | 3300049741 | Ga0501079_0044164 | Ga0501079_0044164_520_1287 | 254 |
| 103 | 3300049742 | Ga0501080_0100111 | Ga0501080_0100111_129_896 | 254 |
| 104 | 3300049742 | Ga0501080_0213870 | Ga0501080_0213870_340_1107 | 254 |
| 105 | 3300049744 | Ga0501083_0004148 | Ga0501083_0004148_7645_8412 | 254 |
| 106 | 3300049744 | Ga0501083_0135065 | Ga0501083_0135065_457_1224 | 254 |
| 107 | 3300049822 | Ga0501035_0007139 | Ga0501035_0007139_1869_2636 | 254 |
| 108 | 3300049823 | Ga0501044_0006522 | Ga0501044_0006522_7772_8539 | 254 |
| 109 | 3300049823 | Ga0501044_0103207 | Ga0501044_0103207_1861_2628 | 254 |
| 110 | 3300049823 | Ga0501044_0293120 | Ga0501044_0293120_144_911 | 254 |
| 111 | 3300049824 | Ga0501045_0050171 | Ga0501045_0050171_412_1179 | 254 |
| 112 | 3300053077 | Ga0495601_0181949 | Ga0495601_0181949_296_1060 | 254 |
| 113 | 3300053077 | Ga0495601_0269060 | Ga0495601_0269060_170_937 | 254 |
| 114 | 3300053085 | Ga0495619_0215483 | Ga0495619_0215483_407_1174 | 254 |
| 115 | 3300054114 | Ga0501084_0166283 | Ga0501084_0166283_307_1074 | 254 |
| 116 | 3300060353 | Ga0501082_0087473 | Ga0501082_0087473_73_840 | 254 |
| 117 | 3300002074 | JGI24748J21848_1012516 | JGI24748J21848_10125162 | 255 |
| 118 | 3300002239 | JGI24034J26672_10000115 | JGI24034J26672_1000011513 | 255 |
| 119 | 3300002244 | JGI24742J22300_10013599 | JGI24742J22300_100135991 | 255 |
| 120 | 3300013104 | Ga0157370_10010636 | Ga0157370_100106367 | 255 |
| 121 | 3300013297 | Ga0157378_10292773 | Ga0157378_102927732 | 255 |
| 122 | 3300005455 | Ga0070663_100005786 | Ga0070663_1000057864 | 256 |
| 123 | 3300005458 | Ga0070681_10208275 | Ga0070681_102082752 | 256 |
| 124 | 3300005530 | Ga0070679_100000471 | Ga0070679_1000004715 | 256 |
| 125 | 3300025921 | Ga0207652_10000412 | Ga0207652_1000041240 | 256 |
| 126 | 3300025944 | Ga0207661_10006993 | Ga0207661_100069938 | 256 |
| 127 | 3300026067 | Ga0207678_10002172 | Ga0207678_1000217220 | 256 |
| 128 | 3300047321 | Ga0495676_0149426 | Ga0495676_0149426_474_1262 | 256 |
| 129 | 3300013102 | Ga0157371_10004888 | Ga0157371_1000488812 | 257 |
| 130 | 3300035118 | Ga0373954_0084024 | Ga0373954_0084024_514_1308 | 257 |
| 131 | 3300036401 | Ga0373937_0067329 | Ga0373937_0067329_2078_2872 | 257 |
| 132 | 3300048918 | Ga0496115_0008810 | Ga0496115_0008810_3743_4534 | 257 |
| 133 | 3300014968 | Ga0157379_10083447 | Ga0157379_100834472 | 258 |
| 134 | 3300005547 | Ga0070693_100032067 | Ga0070693_1000320672 | 262 |
| 135 | 3300005985 | Ga0081539_10050002 | Ga0081539_100500022 | 262 |
| 136 | 3300047447 | Ga0495685_005973 | Ga0495685_005973_1139_1927 | 262 |
| 137 | 3300049590 | Ga0501074_0196515 | Ga0501074_0196515_277_1074 | 262 |
| 138 | 3300000546 | LJNas_1007531 | LJNas_10075312 | 263 |
| 139 | 3300001979 | JGI24740J21852_10007432 | JGI24740J21852_100074322 | 263 |
| 140 | 3300005327 | Ga0070658_10122027 | Ga0070658_101220272 | 263 |
| 141 | 3300005329 | Ga0070683_100007793 | Ga0070683_10000779311 | 263 |
| 142 | 3300005329 | Ga0070683_100135050 | Ga0070683_1001350502 | 263 |
| 143 | 3300005331 | Ga0070670_100018846 | Ga0070670_1000188464 | 263 |
| 144 | 3300005333 | Ga0070677_10000521 | Ga0070677_1000052114 | 263 |
| 145 | 3300005336 | Ga0070680_100164345 | Ga0070680_1001643452 | 263 |
| 146 | 3300005337 | Ga0070682_100000023 | Ga0070682_100000023168 | 263 |
| 147 | 3300005337 | Ga0070682_100000026 | Ga0070682_100000026180 | 263 |
| 148 | 3300005338 | Ga0068868_100000351 | Ga0068868_10000035130 | 263 |
| 149 | 3300005341 | Ga0070691_10000004 | Ga0070691_1000000431 | 263 |
| 150 | 3300005344 | Ga0070661_100000004 | Ga0070661_100000004242 | 263 |
| 151 | 3300005345 | Ga0070692_10077332 | Ga0070692_100773322 | 263 |
| 152 | 3300005347 | Ga0070668_100083713 | Ga0070668_1000837132 | 263 |
| 153 | 3300005347 | Ga0070668_100098913 | Ga0070668_1000989132 | 263 |
| 154 | 3300005354 | Ga0070675_100000050 | Ga0070675_10000005044 | 263 |
| 155 | 3300005356 | Ga0070674_100000002 | Ga0070674_10000000233 | 263 |
| 156 | 3300005356 | Ga0070674_100000205 | Ga0070674_1000002055 | 263 |
| 157 | 3300005356 | Ga0070674_100066311 | Ga0070674_1000663112 | 263 |
| 158 | 3300005364 | Ga0070673_100078818 | Ga0070673_1000788182 | 263 |
| 159 | 3300005365 | Ga0070688_100000010 | Ga0070688_1000000104 | 263 |
| 160 | 3300005365 | Ga0070688_100000161 | Ga0070688_10000016138 | 263 |
| 161 | 3300005366 | Ga0070659_100029785 | Ga0070659_1000297855 | 263 |
| 162 | 3300005367 | Ga0070667_100001110 | Ga0070667_10000111013 | 263 |
| 163 | 3300005367 | Ga0070667_100153489 | Ga0070667_1001534892 | 263 |
| 164 | 3300005435 | Ga0070714_100154429 | Ga0070714_1001544292 | 263 |
| 165 | 3300005436 | Ga0070713_100000503 | Ga0070713_10000050321 | 263 |
| 166 | 3300005439 | Ga0070711_100193794 | Ga0070711_1001937942 | 263 |
| 167 | 3300005441 | Ga0070700_100101282 | Ga0070700_1001012822 | 263 |
| 168 | 3300005456 | Ga0070678_100084275 | Ga0070678_1000842752 | 263 |
| 169 | 3300005456 | Ga0070678_100394544 | Ga0070678_1003945441 | 263 |
| 170 | 3300005458 | Ga0070681_10269558 | Ga0070681_102695582 | 263 |
| 171 | 3300005459 | Ga0068867_100000078 | Ga0068867_10000007828 | 263 |
| 172 | 3300005466 | Ga0070685_10000010 | Ga0070685_10000010123 | 263 |
| 173 | 3300005466 | Ga0070685_10000061 | Ga0070685_1000006167 | 263 |
| 174 | 3300005530 | Ga0070679_100000424 | Ga0070679_1000004246 | 263 |
| 175 | 3300005535 | Ga0070684_100056329 | Ga0070684_1000563292 | 263 |
| 176 | 3300005535 | Ga0070684_100135203 | Ga0070684_1001352032 | 263 |
| 177 | 3300005539 | Ga0068853_100007596 | Ga0068853_1000075962 | 263 |
| 178 | 3300005543 | Ga0070672_100000031 | Ga0070672_10000003169 | 263 |
| 179 | 3300005544 | Ga0070686_100158327 | Ga0070686_1001583272 | 263 |
| 180 | 3300005546 | Ga0070696_100476921 | Ga0070696_1004769211 | 263 |
| 181 | 3300005548 | Ga0070665_100000022 | Ga0070665_10000002224 | 263 |
| 182 | 3300005548 | Ga0070665_100026842 | Ga0070665_1000268422 | 263 |
| 183 | 3300005548 | Ga0070665_100068987 | Ga0070665_1000689872 | 263 |
| 184 | 3300005548 | Ga0070665_100241863 | Ga0070665_1002418632 | 263 |
| 185 | 3300005548 | Ga0070665_100263848 | Ga0070665_1002638482 | 263 |
| 186 | 3300005549 | Ga0070704_100070908 | Ga0070704_1000709082 | 263 |
| 187 | 3300005578 | Ga0068854_100000082 | Ga0068854_10000008248 | 263 |
| 188 | 3300005578 | Ga0068854_100156760 | Ga0068854_1001567601 | 263 |
| 189 | 3300005614 | Ga0068856_100000417 | Ga0068856_10000041744 | 263 |
| 190 | 3300005614 | Ga0068856_100018096 | Ga0068856_1000180962 | 263 |
| 191 | 3300005614 | Ga0068856_100027420 | Ga0068856_1000274202 | 263 |
| 192 | 3300005616 | Ga0068852_100000966 | Ga0068852_1000009668 | 263 |
| 193 | 3300005616 | Ga0068852_100113762 | Ga0068852_1001137622 | 263 |
| 194 | 3300005718 | Ga0068866_10000005 | Ga0068866_100000055 | 263 |
| 195 | 3300005718 | Ga0068866_10000206 | Ga0068866_1000020625 | 263 |
| 196 | 3300005719 | Ga0068861_100034640 | Ga0068861_1000346402 | 263 |
| 197 | 3300005834 | Ga0068851_10000141 | Ga0068851_1000014139 | 263 |
| 198 | 3300005841 | Ga0068863_100000261 | Ga0068863_10000026125 | 263 |
| 199 | 3300005841 | Ga0068863_100020755 | Ga0068863_1000207557 | 263 |
| 200 | 3300005842 | Ga0068858_100000046 | Ga0068858_10000004665 | 263 |
| 201 | 3300005842 | Ga0068858_100001180 | Ga0068858_10000118024 | 263 |
| 202 | 3300005842 | Ga0068858_100129653 | Ga0068858_1001296532 | 263 |
| 203 | 3300005842 | Ga0068858_100131860 | Ga0068858_1001318602 | 263 |
| 204 | 3300005843 | Ga0068860_100015233 | Ga0068860_1000152334 | 263 |
| 205 | 3300005843 | Ga0068860_100158523 | Ga0068860_1001585232 | 263 |
| 206 | 3300005844 | Ga0068862_100002784 | Ga0068862_10000278413 | 263 |
| 207 | 3300005937 | Ga0081455_10004942 | Ga0081455_1000494213 | 263 |
| 208 | 3300005983 | Ga0081540_1000557 | Ga0081540_100055744 | 263 |
| 209 | 3300005985 | Ga0081539_10000776 | Ga0081539_1000077615 | 263 |
| 210 | 3300006163 | Ga0070715_10000008 | Ga0070715_1000000850 | 263 |
| 211 | 3300006175 | Ga0070712_100000841 | Ga0070712_10000084112 | 263 |
| 212 | 3300006846 | Ga0075430_100076644 | Ga0075430_1000766442 | 263 |
| 213 | 3300009093 | Ga0105240_10507327 | Ga0105240_105073272 | 263 |
| 214 | 3300009098 | Ga0105245_10000040 | Ga0105245_1000004029 | 263 |
| 215 | 3300009098 | Ga0105245_10000314 | Ga0105245_100003142 | 263 |
| 216 | 3300009098 | Ga0105245_10000857 | Ga0105245_100008572 | 263 |
| 217 | 3300009098 | Ga0105245_10002546 | Ga0105245_1000254617 | 263 |
| 218 | 3300009098 | Ga0105245_10002546 | Ga0105245_100025462 | 263 |
| 219 | 3300009101 | Ga0105247_10000131 | Ga0105247_1000013134 | 263 |
| 220 | 3300009148 | Ga0105243_10161789 | Ga0105243_101617892 | 263 |
| 221 | 3300009176 | Ga0105242_10000063 | Ga0105242_1000006338 | 263 |
| 222 | 3300009176 | Ga0105242_10091455 | Ga0105242_100914552 | 263 |
| 223 | 3300009176 | Ga0105242_10392061 | Ga0105242_103920612 | 263 |
| 224 | 3300009176 | Ga0105242_10422907 | Ga0105242_104229072 | 263 |
| 225 | 3300009177 | Ga0105248_10000037 | Ga0105248_10000037165 | 263 |
| 226 | 3300009553 | Ga0105249_10000218 | Ga0105249_1000021847 | 263 |
| 227 | 3300009553 | Ga0105249_10074063 | Ga0105249_100740632 | 263 |
| 228 | 3300009553 | Ga0105249_10105682 | Ga0105249_101056822 | 263 |
| 229 | 3300010375 | Ga0105239_10276583 | Ga0105239_102765831 | 263 |
| 230 | 3300010375 | Ga0105239_10506416 | Ga0105239_105064162 | 263 |
| 231 | 3300013104 | Ga0157370_10014559 | Ga0157370_100145598 | 263 |
| 232 | 3300013105 | Ga0157369_10001730 | Ga0157369_1000173015 | 263 |
| 233 | 3300013296 | Ga0157374_10001797 | Ga0157374_100017972 | 263 |
| 234 | 3300013296 | Ga0157374_10058364 | Ga0157374_100583644 | 263 |
| 235 | 3300013296 | Ga0157374_10394726 | Ga0157374_103947262 | 263 |
| 236 | 3300013297 | Ga0157378_10219217 | Ga0157378_102192172 | 263 |
| 237 | 3300013306 | Ga0163162_10850559 | Ga0163162_108505591 | 263 |
| 238 | 3300013308 | Ga0157375_10044770 | Ga0157375_100447704 | 263 |
| 239 | 3300013308 | Ga0157375_10273456 | Ga0157375_102734562 | 263 |
| 240 | 3300014325 | Ga0163163_10530542 | Ga0163163_105305422 | 263 |
| 241 | 3300014326 | Ga0157380_10000007 | Ga0157380_1000000726 | 263 |
| 242 | 3300014326 | Ga0157380_10001943 | Ga0157380_100019432 | 263 |
| 243 | 3300014968 | Ga0157379_10015110 | Ga0157379_100151102 | 263 |
| 244 | 3300014968 | Ga0157379_10018096 | Ga0157379_100180962 | 263 |
| 245 | 3300014969 | Ga0157376_10147644 | Ga0157376_101476442 | 263 |
| 246 | 3300014969 | Ga0157376_10685128 | Ga0157376_106851281 | 263 |
| 247 | 3300017792 | Ga0163161_10000064 | Ga0163161_10000064111 | 263 |
| 248 | 3300017792 | Ga0163161_10193624 | Ga0163161_101936242 | 263 |
| 249 | 3300025321 | Ga0207656_10000380 | Ga0207656_100003802 | 263 |
| 250 | 3300025885 | Ga0207653_10022428 | Ga0207653_100224282 | 263 |
| 251 | 3300025893 | Ga0207682_10000769 | Ga0207682_1000076917 | 263 |
| 252 | 3300025899 | Ga0207642_10000005 | Ga0207642_10000005210 | 263 |
| 253 | 3300025899 | Ga0207642_10001468 | Ga0207642_100014689 | 263 |
| 254 | 3300025900 | Ga0207710_10000268 | Ga0207710_1000026847 | 263 |
| 255 | 3300025905 | Ga0207685_10000012 | Ga0207685_1000001250 | 263 |
| 256 | 3300025909 | Ga0207705_10019730 | Ga0207705_100197302 | 263 |
| 257 | 3300025912 | Ga0207707_10221557 | Ga0207707_102215571 | 263 |
| 258 | 3300025913 | Ga0207695_10074168 | Ga0207695_100741682 | 263 |
| 259 | 3300025915 | Ga0207693_10001350 | Ga0207693_1000135020 | 263 |
| 260 | 3300025917 | Ga0207660_10244081 | Ga0207660_102440812 | 263 |
| 261 | 3300025920 | Ga0207649_10000003 | Ga0207649_1000000317 | 263 |
| 262 | 3300025921 | Ga0207652_10000232 | Ga0207652_1000023218 | 263 |
| 263 | 3300025925 | Ga0207650_10021117 | Ga0207650_100211173 | 263 |
| 264 | 3300025926 | Ga0207659_10000055 | Ga0207659_1000005546 | 263 |
| 265 | 3300025927 | Ga0207687_10000040 | Ga0207687_100000402 | 263 |
| 266 | 3300025927 | Ga0207687_10000095 | Ga0207687_1000009539 | 263 |
| 267 | 3300025927 | Ga0207687_10000128 | Ga0207687_1000012849 | 263 |
| 268 | 3300025927 | Ga0207687_10082349 | Ga0207687_100823492 | 263 |
| 269 | 3300025928 | Ga0207700_10000003 | Ga0207700_10000003169 | 263 |
| 270 | 3300025928 | Ga0207700_10077530 | Ga0207700_100775302 | 263 |
| 271 | 3300025929 | Ga0207664_10094031 | Ga0207664_100940312 | 263 |
| 272 | 3300025932 | Ga0207690_10014580 | Ga0207690_100145802 | 263 |
| 273 | 3300025934 | Ga0207686_10000230 | Ga0207686_1000023038 | 263 |
| 274 | 3300025934 | Ga0207686_10000395 | Ga0207686_1000039531 | 263 |
| 275 | 3300025934 | Ga0207686_10231003 | Ga0207686_102310032 | 263 |
| 276 | 3300025935 | Ga0207709_10101698 | Ga0207709_101016982 | 263 |
| 277 | 3300025937 | Ga0207669_10000003 | Ga0207669_10000003262 | 263 |
| 278 | 3300025937 | Ga0207669_10000021 | Ga0207669_1000002117 | 263 |
| 279 | 3300025940 | Ga0207691_10000178 | Ga0207691_1000017816 | 263 |
| 280 | 3300025941 | Ga0207711_10000011 | Ga0207711_10000011378 | 263 |
| 281 | 3300025944 | Ga0207661_10000858 | Ga0207661_1000085820 | 263 |
| 282 | 3300025944 | Ga0207661_10001136 | Ga0207661_1000113617 | 263 |
| 283 | 3300025944 | Ga0207661_10081293 | Ga0207661_100812932 | 263 |
| 284 | 3300025944 | Ga0207661_10178225 | Ga0207661_101782252 | 263 |
| 285 | 3300025949 | Ga0207667_10054875 | Ga0207667_100548752 | 263 |
| 286 | 3300025960 | Ga0207651_10036181 | Ga0207651_100361813 | 263 |
| 287 | 3300025961 | Ga0207712_10000027 | Ga0207712_10000027240 | 263 |
| 288 | 3300025961 | Ga0207712_10198726 | Ga0207712_101987262 | 263 |
| 289 | 3300025972 | Ga0207668_10008828 | Ga0207668_100088283 | 263 |
| 290 | 3300025981 | Ga0207640_10000054 | Ga0207640_1000005423 | 263 |
| 291 | 3300025981 | Ga0207640_10110408 | Ga0207640_101104082 | 263 |
| 292 | 3300025986 | Ga0207658_10001811 | Ga0207658_1000181115 | 263 |
| 293 | 3300025986 | Ga0207658_10155859 | Ga0207658_101558592 | 263 |
| 294 | 3300026023 | Ga0207677_10000304 | Ga0207677_1000030437 | 263 |
| 295 | 3300026035 | Ga0207703_10000020 | Ga0207703_1000002078 | 263 |
| 296 | 3300026035 | Ga0207703_10000042 | Ga0207703_1000004230 | 263 |
| 297 | 3300026035 | Ga0207703_10148311 | Ga0207703_101483112 | 263 |
| 298 | 3300026075 | Ga0207708_10024542 | Ga0207708_100245425 | 263 |
| 299 | 3300026075 | Ga0207708_10144413 | Ga0207708_101444132 | 263 |
| 300 | 3300026078 | Ga0207702_10000105 | Ga0207702_1000010585 | 263 |
| 301 | 3300026078 | Ga0207702_10001788 | Ga0207702_100017886 | 263 |
| 302 | 3300026078 | Ga0207702_10016153 | Ga0207702_100161532 | 263 |
| 303 | 3300026088 | Ga0207641_10000062 | Ga0207641_10000062143 | 263 |
| 304 | 3300026088 | Ga0207641_10009398 | Ga0207641_100093982 | 263 |
| 305 | 3300026089 | Ga0207648_10000457 | Ga0207648_1000045719 | 263 |
| 306 | 3300026118 | Ga0207675_100064160 | Ga0207675_1000641602 | 263 |
| 307 | 3300026118 | Ga0207675_100100788 | Ga0207675_1001007882 | 263 |
| 308 | 3300026121 | Ga0207683_10100169 | Ga0207683_101001692 | 263 |
| 309 | 3300026121 | Ga0207683_10131689 | Ga0207683_101316892 | 263 |
| 310 | 3300026142 | Ga0207698_10000015 | Ga0207698_10000015110 | 263 |
| 311 | 3300028379 | Ga0268266_10000029 | Ga0268266_10000029425 | 263 |
| 312 | 3300028379 | Ga0268266_10000526 | Ga0268266_1000052643 | 263 |
| 313 | 3300028379 | Ga0268266_10000990 | Ga0268266_1000099013 | 263 |
| 314 | 3300028379 | Ga0268266_10122565 | Ga0268266_101225652 | 263 |
| 315 | 3300028379 | Ga0268266_10235356 | Ga0268266_102353562 | 263 |
| 316 | 3300028380 | Ga0268265_10001768 | Ga0268265_1000176812 | 263 |
| 317 | 3300028381 | Ga0268264_10021055 | Ga0268264_100210552 | 263 |
| 318 | 3300028381 | Ga0268264_10106030 | Ga0268264_101060302 | 263 |
| 319 | 3300028556 | Ga0265337_1000167 | Ga0265337_100016733 | 263 |
| 320 | 3300028558 | Ga0265326_10000452 | Ga0265326_1000045212 | 263 |
| 321 | 3300028563 | Ga0265319_1000010 | Ga0265319_100001054 | 263 |
| 322 | 3300028573 | Ga0265334_10087671 | Ga0265334_100876711 | 263 |
| 323 | 3300028654 | Ga0265322_10000005 | Ga0265322_10000005155 | 263 |
| 324 | 3300028800 | Ga0265338_10000287 | Ga0265338_1000028755 | 263 |
| 325 | 3300029957 | Ga0265324_10000183 | Ga0265324_1000018338 | 263 |
| 326 | 3300031240 | Ga0265320_10000010 | Ga0265320_10000010201 | 263 |
| 327 | 3300031241 | Ga0265325_10025508 | Ga0265325_100255082 | 263 |
| 328 | 3300031242 | Ga0265329_10004243 | Ga0265329_100042435 | 263 |
| 329 | 3300031250 | Ga0265331_10000217 | Ga0265331_1000021743 | 263 |
| 330 | 3300031251 | Ga0265327_10000040 | Ga0265327_10000040105 | 263 |
| 331 | 3300031711 | Ga0265314_10000578 | Ga0265314_1000057847 | 263 |
| 332 | 3300041486 | Ga0451807_0930195 | Ga0451807_0930195_40_831 | 263 |
| 333 | 3300041509 | Ga0451843_1191107 | Ga0451843_1191107_16_807 | 263 |
| 334 | 3300044694 | Ga0466963_0000233 | Ga0466963_0000233_2030_2821 | 263 |
| 335 | 3300044694 | Ga0466963_0008048 | Ga0466963_0008048_4271_5062 | 263 |
| 336 | 3300044694 | Ga0466963_0084612 | Ga0466963_0084612_617_1408 | 263 |
| 337 | 3300044842 | Ga0466957_0001268 | Ga0466957_0001268_7696_8502 | 263 |
| 338 | 3300045836 | Ga0466958_0045441 | Ga0466958_0045441_947_1738 | 263 |
| 339 | 3300045976 | Ga0466967_0000002 | Ga0466967_0000002_23561_24352 | 263 |
| 340 | 3300045976 | Ga0466967_0180846 | Ga0466967_0180846_570_1361 | 263 |
| 341 | 3300046454 | Ga0495592_0100353 | Ga0495592_0100353_536_1327 | 263 |
| 342 | 3300046455 | Ga0495603_0000102 | Ga0495603_0000102_30513_31319 | 263 |
| 343 | 3300046455 | Ga0495603_0027208 | Ga0495603_0027208_1193_1984 | 263 |
| 344 | 3300046455 | Ga0495603_0097966 | Ga0495603_0097966_744_1535 | 263 |
| 345 | 3300046459 | Ga0495629_0010954 | Ga0495629_0010954_3810_4601 | 263 |
| 346 | 3300046459 | Ga0495629_0029234 | Ga0495629_0029234_1731_2522 | 263 |
| 347 | 3300046460 | Ga0495638_0036473 | Ga0495638_0036473_2198_2989 | 263 |
| 348 | 3300046476 | Ga0495662_0000069 | Ga0495662_0000069_28310_29101 | 263 |
| 349 | 3300046476 | Ga0495662_0025721 | Ga0495662_0025721_623_1414 | 263 |
| 350 | 3300046499 | Ga0495594_0000009 | Ga0495594_0000009_27462_28253 | 263 |
| 351 | 3300046499 | Ga0495594_0207531 | Ga0495594_0207531_229_1020 | 263 |
| 352 | 3300046507 | Ga0495606_0000017 | Ga0495606_0000017_48872_49678 | 263 |
| 353 | 3300046511 | Ga0495608_0000013 | Ga0495608_0000013_100804_101598 | 263 |
| 354 | 3300046511 | Ga0495608_0000754 | Ga0495608_0000754_590_1381 | 263 |
| 355 | 3300046512 | Ga0495610_0110927 | Ga0495610_0110927_44_850 | 263 |
| 356 | 3300046515 | Ga0495620_0000041 | Ga0495620_0000041_33121_33912 | 263 |
| 357 | 3300046516 | Ga0495628_0004134 | Ga0495628_0004134_11129_11926 | 263 |
| 358 | 3300046516 | Ga0495628_0013643 | Ga0495628_0013643_798_1589 | 263 |
| 359 | 3300046516 | Ga0495628_0443786 | Ga0495628_0443786_59_850 | 263 |
| 360 | 3300046517 | Ga0495630_0000026 | Ga0495630_0000026_101958_102749 | 263 |
| 361 | 3300046517 | Ga0495630_0000032 | Ga0495630_0000032_66525_67316 | 263 |
| 362 | 3300046517 | Ga0495630_0237385 | Ga0495630_0237385_118_909 | 263 |
| 363 | 3300046536 | Ga0495587_0021994 | Ga0495587_0021994_1689_2480 | 263 |
| 364 | 3300046539 | Ga0495621_0002315 | Ga0495621_0002315_3281_4072 | 263 |
| 365 | 3300046543 | Ga0495645_0125239 | Ga0495645_0125239_648_1439 | 263 |
| 366 | 3300046557 | Ga0495622_0000097 | Ga0495622_0000097_72666_73457 | 263 |
| 367 | 3300046615 | Ga0495656_0022728 | Ga0495656_0022728_709_1500 | 263 |
| 368 | 3300046616 | Ga0495668_0168905 | Ga0495668_0168905_118_909 | 263 |
| 369 | 3300046642 | Ga0495634_0000002 | Ga0495634_0000002_115189_115983 | 263 |
| 370 | 3300046642 | Ga0495634_0070185 | Ga0495634_0070185_1507_2298 | 263 |
| 371 | 3300046660 | Ga0495625_0000243 | Ga0495625_0000243_68033_68824 | 263 |
| 372 | 3300046660 | Ga0495625_0083392 | Ga0495625_0083392_276_1085 | 263 |
| 373 | 3300046663 | Ga0495635_0046155 | Ga0495635_0046155_830_1621 | 263 |
| 374 | 3300046674 | Ga0495588_0000073 | Ga0495588_0000073_180799_181605 | 263 |
| 375 | 3300046675 | Ga0495657_0000003 | Ga0495657_0000003_152003_152797 | 263 |
| 376 | 3300046675 | Ga0495657_0065934 | Ga0495657_0065934_1385_2176 | 263 |
| 377 | 3300046681 | Ga0495647_0000585 | Ga0495647_0000585_9197_9988 | 263 |
| 378 | 3300046681 | Ga0495647_0074433 | Ga0495647_0074433_361_1152 | 263 |
| 379 | 3300046683 | Ga0495658_0000947 | Ga0495658_0000947_11048_11839 | 263 |
| 380 | 3300046684 | Ga0495669_0000609 | Ga0495669_0000609_13567_14358 | 263 |
| 381 | 3300046689 | Ga0495613_0000027 | Ga0495613_0000027_143899_144705 | 263 |
| 382 | 3300046689 | Ga0495613_0001632 | Ga0495613_0001632_8920_9711 | 263 |
| 383 | 3300046690 | Ga0495624_0000691 | Ga0495624_0000691_24731_25522 | 263 |
| 384 | 3300046690 | Ga0495624_0047286 | Ga0495624_0047286_1351_2142 | 263 |
| 385 | 3300046691 | Ga0495670_0008267 | Ga0495670_0008267_2851_3642 | 263 |
| 386 | 3300046694 | Ga0495649_0010793 | Ga0495649_0010793_752_1543 | 263 |
| 387 | 3300047317 | Ga0495604_0002435 | Ga0495604_0002435_12684_13478 | 263 |
| 388 | 3300047317 | Ga0495604_0037624 | Ga0495604_0037624_1414_2205 | 263 |
| 389 | 3300047319 | Ga0495674_0000039 | Ga0495674_0000039_78028_78819 | 263 |
| 390 | 3300047321 | Ga0495676_0210523 | Ga0495676_0210523_503_1294 | 263 |
| 391 | 3300047322 | Ga0495680_0000929 | Ga0495680_0000929_30019_30810 | 263 |
| 392 | 3300047322 | Ga0495680_0227189 | Ga0495680_0227189_250_1041 | 263 |
| 393 | 3300047444 | Ga0495675_0000002 | Ga0495675_0000002_152003_152797 | 263 |
| 394 | 3300047446 | Ga0495679_008360 | Ga0495679_008360_2627_3418 | 263 |
| 395 | 3300047446 | Ga0495679_042921 | Ga0495679_042921_515_1306 | 263 |
| 396 | 3300048088 | Ga0495602_0000034 | Ga0495602_0000034_72249_73040 | 263 |
| 397 | 3300048088 | Ga0495602_0009482 | Ga0495602_0009482_1712_2509 | 263 |
| 398 | 3300048088 | Ga0495602_0115818 | Ga0495602_0115818_1006_1797 | 263 |
| 399 | 3300048088 | Ga0495602_0124666 | Ga0495602_0124666_591_1382 | 263 |
| 400 | 3300048903 | Ga0496100_0000024 | Ga0496100_0000024_82755_83546 | 263 |
| 401 | 3300048904 | Ga0496101_0000072 | Ga0496101_0000072_32593_33384 | 263 |
| 402 | 3300048905 | Ga0496102_0000749 | Ga0496102_0000749_28884_29675 | 263 |
| 403 | 3300048906 | Ga0496103_0003112 | Ga0496103_0003112_7383_8174 | 263 |
| 404 | 3300048906 | Ga0496103_0019977 | Ga0496103_0019977_2699_3490 | 263 |
| 405 | 3300048907 | Ga0496104_0000008 | Ga0496104_0000008_133188_133979 | 263 |
| 406 | 3300048908 | Ga0496105_0000003 | Ga0496105_0000003_133188_133979 | 263 |
| 407 | 3300048909 | Ga0496106_0000040 | Ga0496106_0000040_75371_76162 | 263 |
| 408 | 3300048910 | Ga0496107_0000025 | Ga0496107_0000025_82755_83546 | 263 |
| 409 | 3300048911 | Ga0496108_0000005 | Ga0496108_0000005_439781_440572 | 263 |
| 410 | 3300048911 | Ga0496108_0001876 | Ga0496108_0001876_5652_6446 | 263 |
| 411 | 3300048911 | Ga0496108_0040737 | Ga0496108_0040737_287_1093 | 263 |
| 412 | 3300048912 | Ga0496109_0000002 | Ga0496109_0000002_94520_95311 | 263 |
| 413 | 3300048912 | Ga0496109_0000221 | Ga0496109_0000221_39222_40028 | 263 |
| 414 | 3300048912 | Ga0496109_0004919 | Ga0496109_0004919_9259_10053 | 263 |
| 415 | 3300048913 | Ga0496110_0000052 | Ga0496110_0000052_25153_25944 | 263 |
| 416 | 3300048913 | Ga0496110_0394639 | Ga0496110_0394639_385_1194 | 263 |
| 417 | 3300048913 | Ga0496110_0533312 | Ga0496110_0533312_218_1009 | 263 |
| 418 | 3300048914 | Ga0496111_0000209 | Ga0496111_0000209_1174_1965 | 263 |
| 419 | 3300048914 | Ga0496111_0357213 | Ga0496111_0357213_125_916 | 263 |
| 420 | 3300048915 | Ga0496112_0001298 | Ga0496112_0001298_16750_17556 | 263 |
| 421 | 3300048916 | Ga0496113_0000005 | Ga0496113_0000005_96511_97317 | 263 |
| 422 | 3300048916 | Ga0496113_0271913 | Ga0496113_0271913_214_1005 | 263 |
| 423 | 3300048917 | Ga0496114_0000003 | Ga0496114_0000003_482312_483103 | 263 |
| 424 | 3300048917 | Ga0496114_0046922 | Ga0496114_0046922_1640_2434 | 263 |
| 425 | 3300048918 | Ga0496115_0000016 | Ga0496115_0000016_25470_26264 | 263 |
| 426 | 3300048918 | Ga0496115_0000827 | Ga0496115_0000827_13467_14258 | 263 |
| 427 | 3300049592 | Ga0501076_0065375 | Ga0501076_0065375_1290_2081 | 263 |
| 428 | 3300053077 | Ga0495601_0000017 | Ga0495601_0000017_2071_2862 | 263 |
| 429 | 3300053077 | Ga0495601_0004530 | Ga0495601_0004530_783_1574 | 263 |
| 430 | 3300053077 | Ga0495601_0026888 | Ga0495601_0026888_759_1550 | 263 |
| 431 | 3300053078 | Ga0495612_0007191 | Ga0495612_0007191_809_1600 | 263 |
| 432 | 3300053078 | Ga0495612_0026961 | Ga0495612_0026961_759_1550 | 263 |
| 433 | 3300053083 | Ga0495655_0000258 | Ga0495655_0000258_1824_2615 | 263 |
| 434 | 3300053083 | Ga0495655_0019439 | Ga0495655_0019439_153_959 | 263 |
| 435 | 3300053084 | Ga0495595_0000007 | Ga0495595_0000007_100827_101621 | 263 |
| 436 | 3300053084 | Ga0495595_0000378 | Ga0495595_0000378_14262_15053 | 263 |
| 437 | 3300053085 | Ga0495619_0000001 | Ga0495619_0000001_433322_434116 | 263 |
| 438 | 3300053085 | Ga0495619_0000026 | Ga0495619_0000026_70943_71737 | 263 |
| 439 | 3300053085 | Ga0495619_0000088 | Ga0495619_0000088_55317_56108 | 263 |
| 440 | 3300053085 | Ga0495619_0000682 | Ga0495619_0000682_20345_21136 | 263 |
| 441 | 3300053085 | Ga0495619_0005677 | Ga0495619_0005677_791_1582 | 263 |
| 442 | 3300053085 | Ga0495619_0009392 | Ga0495619_0009392_1013_1804 | 263 |
| 443 | 3300053085 | Ga0495619_0018618 | Ga0495619_0018618_144_935 | 263 |
| 444 | 3300053085 | Ga0495619_0274008 | Ga0495619_0274008_35_826 | 263 |
| 445 | 3300053094 | Ga0500566_0011210 | Ga0500566_0011210_3495_4286 | 263 |
| 446 | 3300053096 | Ga0500641_0001015 | Ga0500641_0001015_7079_7870 | 263 |
| 447 | 3300053129 | Ga0500628_000072 | Ga0500628_000072_7257_8048 | 263 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7w5z-assembly1.cif.gz_c2 | cryo-em structure of tetrahymena thermophila mitochondrial complex iv, composite dimer model | 0.9148 | 146 | 231 |
| 4w9z-assembly1.cif.gz_A | crystal structure of the periplasmic domain of subunit ii of cytochrome oxidase (coxb) of bradyrhizobium japonicum | 0.9064 | 117 | 230 |
| 2cua-assembly1.cif.gz_A | the cua domain of cytochrome ba3 from thermus thermophilus | 0.8928 | 118 | 219 |
| 3qjs-assembly1.cif.gz_B | the structure of and photolytic induced changes of carbon monoxide binding to the cytochrome ba3-oxidase from thermus thermophilus | 0.8918 | 118 | 219 |
| 5u7n-assembly7.cif.gz_G | crystal structure of a chimeric cua domain (subunit ii) of cytochrome ba3 from thermus thermophilus with the amicyanin loop | 0.8918 | 118 | 219 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2yevE02 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.9511 | 119 | 230 | 2.60.40.420 |
| af_A0A1D6ED90_406_498_2.60.40.420 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.9489 | 146 | 227 | 2.60.40.420 |
| af_P0ABJ1_113_282_2.60.40.420 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.944 | 118 | 229 | 2.60.40.420 |
| af_A0A2P2CLF0_113_253_2.60.40.420 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.9382 | 122 | 229 | 2.60.40.420 |
| 3hb3B01 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.9288 | 120 | 233 | 2.60.40.420 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382YL77-F1-model_v4 | Cytochrome oxidase subunit II copper A binding domain-containing protein | 0.9756 | 145 | 229 |
GO:0004129
GO:0005507 GO:0016020 GO:0020037 GO:0042773 |
| AF-A0A2V8PE98-F1-model_v4 | Cytochrome-c oxidase | 0.957 | 146 | 219 |
GO:0004129
GO:0005507 GO:0016020 GO:0030313 |
| AF-A0A5S9MLG3-F1-model_v4 | Cytochrome oxidase subunit II copper A binding domain-containing protein | 0.9539 | 134 | 229 |
GO:0004129
GO:0005507 GO:0005886 GO:0042773 |
| AF-A0A3N5V1Y2-F1-model_v4 | Cytochrome oxidase subunit II copper A binding domain-containing protein | 0.9522 | 147 | 228 |
GO:0004129
GO:0005507 GO:0016020 GO:0042773 |
| AF-A0A109ZZI2-F1-model_v4 | cytochrome-c oxidase (EC 7.1.1.9) (Cytochrome c oxidase polypeptide II) | 0.9491 | 146 | 229 |
GO:0004129
GO:0005507 GO:0031966 GO:0042773 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar