F445869

General Info

Members Datasets Scaffolds Average Seq Length
447 192 894 300

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10002937|Ga0070676_100029376
Length 324
Sequence MAVSTCSWRRAIVCSRSLCISTIMLTRREFGALALSSVAWPALGRAQTVSGVRLGVQTYSFRELMRPAGGDLVDPVIAAMKECGLTECELWAPQIEPASTGGGGRPTPEEAQRSREGLRKWRLETPLDHFRSIGKRFNTAGITIYAFNYSPNGSFSDEEIDRGFEMAKALGAEIITASATLEAARRMVPFAAKHRMPVAMHNHSNVSDPNEFATLESLATALKLSPQFRINLDIGHFTAANNDAVAYIREHHHQITNLHLKDRRKNQGDNVAWGTGDTPIREVLQLLKKERWPIRAYIEYEHKGEVGAVEEVKKCLAFARSALA

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
138 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
139 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
143 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
144 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
145 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
146 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
153 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
187 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
190 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
191 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
192 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 0.67
Rhizosphere 98.66
Stem 0
Stem Tuber 0
Unclassified 12.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10002937 3300005328 Bacteria 8797
2 Ga0065714_10109490 3300005288 Unclassified 1499
3 Ga0065712_10000157 3300005290 Bacteria 58547
4 Ga0065712_10148614 3300005290 Bacteria 1388
5 Ga0065715_10014299 3300005293 Bacteria 4291
6 Ga0065707_10097141 3300005295 Bacteria 3199
7 Ga0065707_10149936 3300005295 Unclassified 1670
8 Ga0070676_10180688 3300005328 Bacteria 1371
9 Ga0070676_10244837 3300005328 Bacteria 1194
10 Ga0070676_10250991 3300005328 Bacteria 1181
11 Ga0070690_100114536 3300005330 Bacteria 1803
12 Ga0070690_100199976 3300005330 Unclassified 1390
13 Ga0070670_100009296 3300005331 Bacteria 8396
14 Ga0070670_100079798 3300005331 Bacteria 2813
15 Ga0070670_100304452 3300005331 Bacteria 1394
16 Ga0070677_10023756 3300005333 Bacteria 2273
17 Ga0070677_10170799 3300005333 Bacteria 1028
18 Ga0068869_100001377 3300005334 Bacteria 14394
19 Ga0068869_100124953 3300005334 Bacteria 1972
20 Ga0068869_100136333 3300005334 Bacteria 1891
21 Ga0070666_10017818 3300005335 Bacteria 4557
22 Ga0070666_10256944 3300005335 Unclassified 1238
23 Ga0070680_100291181 3300005336 Bacteria 1384
24 Ga0070689_100060266 3300005340 Bacteria 2950
25 Ga0070689_100110272 3300005340 Bacteria 2188
26 Ga0070689_100185675 3300005340 Unclassified 1691
27 Ga0070687_100045441 3300005343 Bacteria 2243
28 Ga0070661_100013806 3300005344 Bacteria 5676
29 Ga0070692_10199643 3300005345 Unclassified 1171
30 Ga0070668_100035281 3300005347 Bacteria 3813
31 Ga0070668_100337721 3300005347 Bacteria 1272
32 Ga0070668_100384850 3300005347 Bacteria 1195
33 Ga0070669_100003674 3300005353 Bacteria 11067
34 Ga0070669_100022523 3300005353 Bacteria 4504
35 Ga0070669_100116574 3300005353 Bacteria 2033
36 Ga0070669_100175233 3300005353 Bacteria 1674
37 Ga0070675_100000230 3300005354 Bacteria 35985
38 Ga0070675_100014386 3300005354 Bacteria 6240
39 Ga0070675_100020038 3300005354 Bacteria 5336
40 Ga0070675_100063695 3300005354 Bacteria 3048
41 Ga0070675_100108296 3300005354 Bacteria 2347
42 Ga0070675_100112296 3300005354 Bacteria 2307
43 Ga0070675_100221946 3300005354 Bacteria 1646
44 Ga0070675_100385311 3300005354 Bacteria 1248
45 Ga0070675_100434965 3300005354 Unclassified 1175
46 Ga0070671_100012844 3300005355 Bacteria 6752
47 Ga0070671_100025015 3300005355 Bacteria 4894
48 Ga0070671_100290596 3300005355 Bacteria 1391
49 Ga0070674_100212113 3300005356 Unclassified 1501
50 Ga0070674_100351641 3300005356 Bacteria 1190
51 Ga0070673_100010753 3300005364 Bacteria 6210
52 Ga0070673_100011163 3300005364 Bacteria 6125
53 Ga0070673_100037315 3300005364 Bacteria 3701
54 Ga0070688_100003612 3300005365 Bacteria 7984
55 Ga0070688_100021631 3300005365 Bacteria 3759
56 Ga0070688_100057309 3300005365 Bacteria 2448
57 Ga0070688_100175504 3300005365 Bacteria 1482
58 Ga0070667_100029015 3300005367 Bacteria 4608
59 Ga0070667_100062677 3300005367 Bacteria 3149
60 Ga0070667_100132872 3300005367 Bacteria 2174
61 Ga0070701_10059366 3300005438 Bacteria 2011
62 Ga0070700_100061821 3300005441 Bacteria 2364
63 Ga0070700_100070768 3300005441 Unclassified 2225
64 Ga0070708_100439288 3300005445 Unclassified 1231
65 Ga0070678_100060029 3300005456 Bacteria 2797
66 Ga0070678_100072130 3300005456 Bacteria 2587
67 Ga0070678_100395169 3300005456 Bacteria 1200
68 Ga0070662_100021722 3300005457 Bacteria 4386
69 Ga0068867_100009997 3300005459 Bacteria 6687
70 Ga0068867_100028918 3300005459 Bacteria 3991
71 Ga0068867_100073180 3300005459 Bacteria 2566
72 Ga0068867_100258350 3300005459 Unclassified 1419
73 Ga0070685_10039789 3300005466 Bacteria 2673
74 Ga0070685_10050846 3300005466 Bacteria 2396
75 Ga0070685_10053719 3300005466 Bacteria 2335
76 Ga0070699_100085886 3300005518 Bacteria 2746
77 Ga0070699_100188927 3300005518 Bacteria 1829
78 Ga0070697_100015314 3300005536 Bacteria 6017
79 Ga0070697_100533684 3300005536 Bacteria 1028
80 Ga0070672_100019441 3300005543 Bacteria 4929
81 Ga0070672_100035211 3300005543 Bacteria 3805
82 Ga0070672_100105164 3300005543 Bacteria 2295
83 Ga0070672_100126022 3300005543 Bacteria 2101
84 Ga0070672_100169516 3300005543 Bacteria 1815
85 Ga0070672_100391611 3300005543 Unclassified 1190
86 Ga0070686_100020104 3300005544 Bacteria 3948
87 Ga0070686_100034616 3300005544 Bacteria 3114
88 Ga0070686_100187251 3300005544 Bacteria 1475
89 Ga0070695_100087177 3300005545 Bacteria 2076
90 Ga0070665_100002105 3300005548 Bacteria 22257
91 Ga0070665_100375818 3300005548 Bacteria 1428
92 Ga0070704_100051245 3300005549 Bacteria 2906
93 Ga0070664_100004567 3300005564 Bacteria 11109
94 Ga0070664_100610950 3300005564 Bacteria 1011
95 Ga0068857_100016769 3300005577 Bacteria 6418
96 Ga0070702_100019334 3300005615 Bacteria 3551
97 Ga0070702_100172907 3300005615 Bacteria 1407
98 Ga0068859_100031319 3300005617 Bacteria 5341
99 Ga0068859_100073438 3300005617 Bacteria 3459
100 Ga0068859_100084522 3300005617 Bacteria 3219
101 Ga0068859_100310718 3300005617 Bacteria 1670
102 Ga0068864_100018372 3300005618 Bacteria 5841
103 Ga0068864_100024259 3300005618 Bacteria 5101
104 Ga0068864_100030020 3300005618 Bacteria 4608
105 Ga0068864_100196329 3300005618 Bacteria 1852
106 Ga0068866_10244380 3300005718 Bacteria 1095
107 Ga0068861_100133450 3300005719 Unclassified 2018
108 Ga0068870_10013670 3300005840 Bacteria 3820
109 Ga0068870_10075965 3300005840 Bacteria 1844
110 Ga0068870_10146429 3300005840 Bacteria 1387
111 Ga0068863_100002274 3300005841 Bacteria 19085
112 Ga0068863_100003258 3300005841 Bacteria 16036
113 Ga0068858_100032833 3300005842 Bacteria 4820
114 Ga0068858_100196448 3300005842 Bacteria 1907
115 Ga0068860_100045088 3300005843 Bacteria 4204
116 Ga0068860_100099238 3300005843 Bacteria 2778
117 Ga0068860_100113918 3300005843 Bacteria 2586
118 Ga0068862_100023503 3300005844 Bacteria 5165
119 Ga0068862_100119806 3300005844 Unclassified 2319
120 Ga0068862_100379139 3300005844 Bacteria 1319
121 Ga0081455_10040046 3300005937 Bacteria 4136
122 Ga0081455_10057938 3300005937 Bacteria 3281
123 Ga0097621_100000923 3300006237 Bacteria 20554
124 Ga0097621_100100983 3300006237 Bacteria 2427
125 Ga0068871_100025327 3300006358 Unclassified 4614
126 Ga0068871_100051230 3300006358 Bacteria 3342
127 Ga0068871_100059328 3300006358 Bacteria 3117
128 Ga0075428_100013238 3300006844 Bacteria 9178
129 Ga0075428_100108442 3300006844 Bacteria 3026
130 Ga0075428_100513599 3300006844 Unclassified 1281
131 Ga0075430_100251065 3300006846 Bacteria 1466
132 Ga0075430_100401607 3300006846 Bacteria 1131
133 Ga0075431_100000804 3300006847 Bacteria 27410
134 Ga0075431_100049740 3300006847 Bacteria 4322
135 Ga0075431_100296140 3300006847 Bacteria 1635
136 Ga0075433_10000859 3300006852 Bacteria 21272
137 Ga0075433_10005542 3300006852 Bacteria 9911
138 Ga0075433_10008218 3300006852 Bacteria 8315
139 Ga0075433_10019856 3300006852 Bacteria 5608
140 Ga0075433_10057793 3300006852 Bacteria 3391
141 Ga0075434_100001651 3300006871 Bacteria 19004
142 Ga0075434_100008098 3300006871 Bacteria 9748
143 Ga0075434_100071372 3300006871 Bacteria 3464
144 Ga0075434_100097444 3300006871 Bacteria 2946
145 Ga0075429_100019522 3300006880 Bacteria 5873
146 Ga0075429_100154659 3300006880 Unclassified 2008
147 Ga0068865_100033715 3300006881 Bacteria 3429
148 Ga0068865_100056832 3300006881 Bacteria 2728
149 Ga0068865_100296374 3300006881 Bacteria 1293
150 Ga0075436_100004829 3300006914 Bacteria 9266
151 Ga0075436_100032524 3300006914 Bacteria 3596
152 Ga0097620_100031318 3300006931 Bacteria 5341
153 Ga0097620_100073438 3300006931 Bacteria 3459
154 Ga0097620_100084522 3300006931 Bacteria 3219
155 Ga0097620_100176127 3300006931 Unclassified 2220
156 Ga0097620_100310703 3300006931 Bacteria 1670
157 Ga0075435_100000448 3300007076 Bacteria 25223
158 Ga0075435_100003002 3300007076 Bacteria 11356
159 Ga0075435_100192905 3300007076 Unclassified 1725
160 Ga0105240_10001924 3300009093 Bacteria 34516
161 Ga0111539_10000058 3300009094 Bacteria 114638
162 Ga0111539_10003275 3300009094 Bacteria 21401
163 Ga0111539_10004803 3300009094 Bacteria 17626
164 Ga0111539_10032777 3300009094 Bacteria 6310
165 Ga0111539_10151701 3300009094 Bacteria 2712
166 Ga0111539_10300258 3300009094 Unclassified 1869
167 Ga0111539_10303557 3300009094 Bacteria 1858
168 Ga0111539_10687846 3300009094 Unclassified 1191
169 Ga0111539_10980669 3300009094 Unclassified 982
170 Ga0105245_10006113 3300009098 Bacteria 10586
171 Ga0105245_10616063 3300009098 Bacteria 1113
172 Ga0105247_10008725 3300009101 Bacteria 6183
173 Ga0114129_10000807 3300009147 Bacteria 40253
174 Ga0114129_10010117 3300009147 Bacteria 13447
175 Ga0114129_10026805 3300009147 Bacteria 8161
176 Ga0114129_10053853 3300009147 Bacteria 5643
177 Ga0114129_10184734 3300009147 Bacteria 2834
178 Ga0114129_10523314 3300009147 Bacteria 1546
179 Ga0114129_10814234 3300009147 Bacteria 1190
180 Ga0105243_10332785 3300009148 Bacteria 1388
181 Ga0105243_10374388 3300009148 Bacteria 1315
182 Ga0105242_10030468 3300009176 Bacteria 4307
183 Ga0105242_10077589 3300009176 Unclassified 2771
184 Ga0105242_10245717 3300009176 Bacteria 1611
185 Ga0105248_10010662 3300009177 Bacteria 10138
186 Ga0105248_10027089 3300009177 Bacteria 6377
187 Ga0105248_10042134 3300009177 Bacteria 5120
188 Ga0105248_10084645 3300009177 Bacteria 3567
189 Ga0105248_10090362 3300009177 Bacteria 3448
190 Ga0105248_10325516 3300009177 Unclassified 1731
191 Ga0105248_10328836 3300009177 Unclassified 1721
192 Ga0105238_10418778 3300009551 Bacteria 1334
193 Ga0105249_10121316 3300009553 Bacteria 2484
194 Ga0105249_10660344 3300009553 Bacteria 1104
195 Ga0105246_10242609 3300011119 Bacteria 1425
196 Ga0157374_10281952 3300013296 Bacteria 1641
197 Ga0163162_10017681 3300013306 Bacteria 6977
198 Ga0157375_10012341 3300013308 Bacteria 7576
199 Ga0157375_10071849 3300013308 Unclassified 3475
200 Ga0157375_10098818 3300013308 Bacteria 2996
201 Ga0157375_10312359 3300013308 Bacteria 1736
202 Ga0163163_10009383 3300014325 Bacteria 8735
203 Ga0163163_10047763 3300014325 Bacteria 4208
204 Ga0163163_10112605 3300014325 Bacteria 2751
205 Ga0157380_10002213 3300014326 Bacteria 13085
206 Ga0157380_10005515 3300014326 Bacteria 8844
207 Ga0157380_10030060 3300014326 Bacteria 4157
208 Ga0157380_10098929 3300014326 Unclassified 2424
209 Ga0157380_10504579 3300014326 Unclassified 1176
210 Ga0157380_10759492 3300014326 Bacteria 982
211 Ga0157377_10100066 3300014745 Bacteria 1726
212 Ga0157379_10018079 3300014968 Bacteria 6213
213 Ga0157379_10034434 3300014968 Bacteria 4516
214 Ga0157379_10045098 3300014968 Bacteria 3936
215 Ga0157376_10029637 3300014969 Bacteria 4361
216 Ga0157376_10203086 3300014969 Unclassified 1825
217 Ga0157376_10331879 3300014969 Bacteria 1449
218 Ga0163161_10076439 3300017792 Bacteria 2458
219 Ga0163161_10096193 3300017792 Bacteria 2198
220 Ga0213876_10108641 3300021384 Unclassified 1472
221 Ga0207682_10003257 3300025893 Bacteria 7103
222 Ga0207682_10005272 3300025893 Bacteria 5285
223 Ga0207682_10006634 3300025893 Bacteria 4653
224 Ga0207682_10053731 3300025893 Unclassified 1671
225 Ga0207682_10067223 3300025893 Unclassified 1512
226 Ga0207682_10157046 3300025893 Bacteria 1029
227 Ga0207710_10015444 3300025900 Bacteria 3226
228 Ga0207710_10052113 3300025900 Bacteria 1839
229 Ga0207688_10011933 3300025901 Bacteria 4730
230 Ga0207645_10001335 3300025907 Bacteria 20268
231 Ga0207645_10141041 3300025907 Bacteria 1570
232 Ga0207643_10003447 3300025908 Bacteria 8505
233 Ga0207643_10138383 3300025908 Bacteria 1453
234 Ga0207643_10168879 3300025908 Bacteria 1319
235 Ga0207684_10016272 3300025910 Bacteria 6386
236 Ga0207695_10003258 3300025913 Bacteria 23071
237 Ga0207695_10306320 3300025913 Bacteria 1479
238 Ga0207660_10129202 3300025917 Unclassified 1921
239 Ga0207660_10226772 3300025917 Bacteria 1468
240 Ga0207662_10014575 3300025918 Bacteria 4413
241 Ga0207662_10085191 3300025918 Bacteria 1935
242 Ga0207662_10134614 3300025918 Bacteria 1561
243 Ga0207681_10055790 3300025923 Bacteria 2693
244 Ga0207681_10114549 3300025923 Bacteria 1967
245 Ga0207681_10218059 3300025923 Bacteria 1474
246 Ga0207650_10036221 3300025925 Bacteria 3588
247 Ga0207650_10050254 3300025925 Bacteria 3083
248 Ga0207659_10002400 3300025926 Bacteria 11145
249 Ga0207659_10003281 3300025926 Bacteria 9685
250 Ga0207659_10014346 3300025926 Bacteria 5106
251 Ga0207659_10017649 3300025926 Bacteria 4663
252 Ga0207659_10048630 3300025926 Bacteria 3005
253 Ga0207659_10095889 3300025926 Bacteria 2226
254 Ga0207659_10375205 3300025926 Bacteria 1185
255 Ga0207687_10092069 3300025927 Unclassified 2213
256 Ga0207687_10258230 3300025927 Bacteria 1388
257 Ga0207644_10048785 3300025931 Bacteria 3029
258 Ga0207644_10080208 3300025931 Bacteria 2410
259 Ga0207644_10166047 3300025931 Bacteria 1720
260 Ga0207706_10005650 3300025933 Bacteria 11654
261 Ga0207706_10034533 3300025933 Bacteria 4498
262 Ga0207686_10001990 3300025934 Bacteria 11262
263 Ga0207686_10033987 3300025934 Bacteria 3048
264 Ga0207670_10057161 3300025936 Bacteria 2645
265 Ga0207670_10080481 3300025936 Bacteria 2277
266 Ga0207670_10131695 3300025936 Unclassified 1833
267 Ga0207669_10017650 3300025937 Bacteria 3667
268 Ga0207669_10098171 3300025937 Bacteria 1928
269 Ga0207669_10319262 3300025937 Unclassified 1188
270 Ga0207669_10382570 3300025937 Bacteria 1097
271 Ga0207704_10039039 3300025938 Bacteria 2760
272 Ga0207691_10008829 3300025940 Bacteria 9670
273 Ga0207691_10021284 3300025940 Bacteria 6125
274 Ga0207691_10034699 3300025940 Bacteria 4690
275 Ga0207691_10058474 3300025940 Bacteria 3507
276 Ga0207691_10061575 3300025940 Bacteria 3409
277 Ga0207691_10112547 3300025940 Bacteria 2419
278 Ga0207691_10365454 3300025940 Bacteria 1233
279 Ga0207691_10425160 3300025940 Unclassified 1132
280 Ga0207711_10037323 3300025941 Bacteria 4126
281 Ga0207711_10083720 3300025941 Bacteria 2791
282 Ga0207711_10110669 3300025941 Unclassified 2442
283 Ga0207689_10001511 3300025942 Bacteria 22145
284 Ga0207689_10040816 3300025942 Bacteria 3839
285 Ga0207679_10492933 3300025945 Bacteria 1092
286 Ga0207667_10383687 3300025949 Bacteria 1431
287 Ga0207651_10005797 3300025960 Bacteria 6379
288 Ga0207651_10011053 3300025960 Bacteria 5033
289 Ga0207651_10032714 3300025960 Bacteria 3344
290 Ga0207651_10055326 3300025960 Bacteria 2724
291 Ga0207651_10175325 3300025960 Bacteria 1695
292 Ga0207712_10121638 3300025961 Bacteria 1976
293 Ga0207640_10299078 3300025981 Viruses 1272
294 Ga0207658_10065455 3300025986 Bacteria 2730
295 Ga0207677_10078038 3300026023 Unclassified 2364
296 Ga0207703_10141505 3300026035 Bacteria 2088
297 Ga0207703_10203412 3300026035 Bacteria 1761
298 Ga0207703_10261000 3300026035 Bacteria 1566
299 Ga0207703_10412765 3300026035 Bacteria 1255
300 Ga0207708_10012139 3300026075 Bacteria 6423
301 Ga0207708_10083307 3300026075 Bacteria 2458
302 Ga0207708_10141216 3300026075 Bacteria 1889
303 Ga0207708_10392096 3300026075 Unclassified 1147
304 Ga0207641_10019673 3300026088 Bacteria 5542
305 Ga0207641_10134172 3300026088 Bacteria 2226
306 Ga0207641_10640053 3300026088 Bacteria 1044
307 Ga0207648_10006857 3300026089 Bacteria 11289
308 Ga0207648_10137069 3300026089 Bacteria 2156
309 Ga0207648_10170725 3300026089 Unclassified 1922
310 Ga0207648_10190865 3300026089 Bacteria 1815
311 Ga0207676_10016882 3300026095 Bacteria 5285
312 Ga0207676_10041809 3300026095 Bacteria 3522
313 Ga0207676_10067864 3300026095 Bacteria 2850
314 Ga0207674_10023935 3300026116 Bacteria 6532
315 Ga0207674_10098337 3300026116 Bacteria 2910
316 Ga0207674_10127731 3300026116 Unclassified 2507
317 Ga0207675_100029631 3300026118 Bacteria 5097
318 Ga0207675_100111395 3300026118 Unclassified 2582
319 Ga0207683_10012107 3300026121 Bacteria 7362
320 Ga0207683_10015043 3300026121 Bacteria 6585
321 Ga0207683_10130914 3300026121 Bacteria 2257
322 Ga0207698_10071237 3300026142 Bacteria 2757
323 Ga0207428_10000236 3300027907 Bacteria 75764
324 Ga0207428_10006274 3300027907 Bacteria 10990
325 Ga0207428_10006872 3300027907 Bacteria 10426
326 Ga0207428_10018362 3300027907 Bacteria 5976
327 Ga0207428_10055618 3300027907 Unclassified 3146
328 Ga0207428_10099284 3300027907 Bacteria 2251
329 Ga0268266_10007086 3300028379 Bacteria 10181
330 Ga0268265_10012435 3300028380 Bacteria 5767
331 Ga0268265_10346209 3300028380 Bacteria 1355
332 Ga0268264_10214605 3300028381 Bacteria 1768
333 Ga0307408_100011881 3300031548 Bacteria 5761
334 Ga0307405_10034677 3300031731 Bacteria 3005
335 Ga0307413_10000866 3300031824 Bacteria 10693
336 Ga0307413_10016166 3300031824 Bacteria 3845
337 Ga0307410_10076718 3300031852 Bacteria 2333
338 Ga0307410_10164119 3300031852 Bacteria 1667
339 Ga0307406_10090474 3300031901 Bacteria 2059
340 Ga0307407_10002641 3300031903 Bacteria 7087
341 Ga0307412_10009827 3300031911 Bacteria 5495
342 Ga0307412_10027309 3300031911 Bacteria 3557
343 Ga0307409_100008530 3300031995 Bacteria 6229
344 Ga0307409_100037613 3300031995 Bacteria 3569
345 Ga0307416_100156407 3300032002 Bacteria 2099
346 Ga0307416_100166872 3300032002 Bacteria 2043
347 Ga0307411_10004373 3300032005 Bacteria 6757
348 Ga0307411_10027128 3300032005 Bacteria 3460
349 Ga0307411_10039210 3300032005 Bacteria 2995
350 Ga0307411_10217358 3300032005 Bacteria 1480
351 Ga0307415_100008077 3300032126 Bacteria 5811
352 Ga0373932_0096623 3300035112 Bacteria 956
353 Ga0373941_0047062 3300035115 Bacteria 1357
354 Ga0373961_0025581 3300035241 Bacteria 1606
355 Ga0373937_0039649 3300036401 Bacteria 4293
356 Ga0373937_0280741 3300036401 Bacteria 1573
357 Ga0436365_0944033 3300039437 Unclassified 3600
358 Ga0439453_0015019 3300041408 Bacteria 1335
359 Ga0439433_0005261 3300041999 Unclassified 2781
360 Ga0439441_028119 3300042001 Unclassified 1076
361 Ga0450920_020611 3300042122 Bacteria 1271
362 Ga0439435_0000415 3300042436 Bacteria 6638
363 Ga0451576_0011737 3300045051 Bacteria 9923
364 Ga0495650_0071119 3300046471 Bacteria 1365
365 Ga0495630_0033144 3300046517 Bacteria 3852
366 Ga0495643_0002568 3300046522 Bacteria 14184
367 Ga0495635_0070222 3300046663 Bacteria 2401
368 Ga0495669_0006065 3300046684 Bacteria 5045
369 Ga0495686_0000083 3300047472 Bacteria 198933
370 Ga0496113_0072644 3300048916 Bacteria 2619
371 Ga0496114_0118541 3300048917 Bacteria 2274
372 Ga0496114_0652022 3300048917 Unclassified 926
373 Ga0501033_0258844 3300049570 Unclassified 1232
374 Ga0501034_0471477 3300049571 Bacteria 1171
375 Ga0501036_0193254 3300049572 Bacteria 1712
376 Ga0501037_0172407 3300049573 Bacteria 1537
377 Ga0501038_0123079 3300049574 Bacteria 2137
378 Ga0501039_0098500 3300049575 Bacteria 2281
379 Ga0501039_0474586 3300049575 Bacteria 982
380 Ga0501040_0004831 3300049576 Bacteria 8733
381 Ga0501040_0020737 3300049576 Bacteria 4382
382 Ga0501041_0001803 3300049577 Bacteria 12002
383 Ga0501042_0024117 3300049578 Unclassified 4264
384 Ga0501042_0223742 3300049578 Bacteria 1357
385 Ga0501042_0234715 3300049578 Bacteria 1323
386 Ga0501046_0042302 3300049580 Bacteria 3633
387 Ga0501046_0349601 3300049580 Bacteria 1074
388 Ga0501068_0114886 3300049584 Bacteria 1676
389 Ga0501071_0017646 3300049587 Bacteria 4927
390 Ga0501072_0022392 3300049588 Bacteria 4902
391 Ga0501072_0263065 3300049588 Archaea 1373
392 Ga0501074_0029220 3300049590 Bacteria 3993
393 Ga0501074_0273657 3300049590 Bacteria 1200
394 Ga0501075_0007156 3300049591 Bacteria 7724
395 Ga0501075_0019220 3300049591 Bacteria 4955
396 Ga0501075_0045334 3300049591 Bacteria 3300
397 Ga0501076_0049691 3300049592 Bacteria 3317
398 Ga0501077_0222945 3300049593 Unclassified 1198
399 Ga0501079_0032001 3300049741 Bacteria 4042
400 Ga0501079_0075627 3300049741 Bacteria 2604
401 Ga0501080_0500028 3300049742 Unclassified 1086
402 Ga0501081_0011300 3300049743 Bacteria 5840
403 Ga0501081_0254697 3300049743 Unclassified 1282
404 Ga0501045_0026320 3300049824 Bacteria 4184
405 nmdc:mga05p37_17920_c1 3300050507 Bacteria 8549
406 nmdc:mga05p37_354246_c1 3300050507 Unclassified 1727
407 nmdc:mga09592_133948_c1 3300050508 Bacteria 2134
408 nmdc:mga09592_166351_c1 3300050508 Bacteria 1906
409 nmdc:mga09592_51681_c1 3300050508 Bacteria 3467
410 nmdc:mga09592_6451_c1 3300050508 Bacteria 9556
411 nmdc:mga09592_95843_c1 3300050508 Unclassified 2538
412 nmdc:mga0qj67_289195_c1 3300050509 Bacteria 1328
413 nmdc:mga0qj67_337130_c1 3300050509 Bacteria 1220
414 nmdc:mga0qj67_49797_c1 3300050509 Bacteria 3311
415 nmdc:mga06r32_175143_c1 3300050510 Bacteria 2129
416 nmdc:mga06r32_32043_c1 3300050510 Bacteria 4941
417 nmdc:mga08y16_12253_c1 3300050511 Bacteria 9011
418 nmdc:mga08y16_15280_c1 3300050511 Bacteria 8077
419 nmdc:mga08y16_1659_c1 3300050511 Bacteria 22568
420 nmdc:mga08y16_201679_c1 3300050511 Unclassified 2061
421 nmdc:mga08y16_327_c1 3300050511 Bacteria 43166
422 nmdc:mga08y16_467449_c1 3300050511 Bacteria 1285
423 nmdc:mga08y16_53101_c1 3300050511 Bacteria 4239
424 nmdc:mga08y16_70818_c1 3300050511 Bacteria 3634
425 nmdc:mga0n895_1051_c1 3300050512 Bacteria 20103
426 nmdc:mga0n895_256750_c1 3300050512 Bacteria 1774
427 nmdc:mga0n895_28411_c1 3300050512 Bacteria 5319
428 nmdc:mga0n895_34168_c1 3300050512 Bacteria 4893
429 nmdc:mga0n895_476919_c1 3300050512 Unclassified 1258
430 nmdc:mga0rr50_1067_c1 3300050513 Bacteria 14898
431 nmdc:mga0rr50_159234_c1 3300050513 Bacteria 1831
432 nmdc:mga0rr50_23475_c1 3300050513 Bacteria 4254
433 nmdc:mga0rr50_3762_c1 3300050513 Bacteria 8798
434 nmdc:mga08x19_29038_c1 3300050514 Bacteria 3468
435 nmdc:mga08x19_66187_c1 3300050514 Bacteria 2348
436 nmdc:mga0a205_23424_c1 3300050515 Bacteria 5857
437 nmdc:mga0a205_2820_c1 3300050515 Bacteria 15378
438 nmdc:mga0a205_6117_c1 3300050515 Bacteria 6669
439 nmdc:mga0a205_668_c1 3300050515 Bacteria 27339
440 Ga0495619_0010537 3300053085 Bacteria 5816
441 Ga0500627_0099662 3300053158 Unclassified 1304
442 Ga0501084_0108880 3300054114 Bacteria 2328
443 Ga0501084_0157214 3300054114 Bacteria 1917
444 Ga0590075_000095 3300059424 Bacteria 22892
445 Ga0590077_001061 3300059426 Bacteria 6821
446 Ga0530510_0037583 3300061734 Bacteria 3493
447 2910250537 2910245624 Bacteria 6935613
448 Ga0070676_10002937
449 Ga0065714_10109490
450 Ga0065712_10000157
451 Ga0065712_10148614
452 Ga0065715_10014299
453 Ga0065707_10097141
454 Ga0065707_10149936
455 Ga0070676_10180688
456 Ga0070676_10244837
457 Ga0070676_10250991
458 Ga0070690_100114536
459 Ga0070690_100199976
460 Ga0070670_100009296
461 Ga0070670_100079798
462 Ga0070670_100304452
463 Ga0070677_10023756
464 Ga0070677_10170799
465 Ga0068869_100001377
466 Ga0068869_100124953
467 Ga0068869_100136333
468 Ga0070666_10017818
469 Ga0070666_10256944
470 Ga0070680_100291181
471 Ga0070689_100060266
472 Ga0070689_100110272
473 Ga0070689_100185675
474 Ga0070687_100045441
475 Ga0070661_100013806
476 Ga0070692_10199643
477 Ga0070668_100035281
478 Ga0070668_100337721
479 Ga0070668_100384850
480 Ga0070669_100003674
481 Ga0070669_100022523
482 Ga0070669_100116574
483 Ga0070669_100175233
484 Ga0070675_100000230
485 Ga0070675_100014386
486 Ga0070675_100020038
487 Ga0070675_100063695
488 Ga0070675_100108296
489 Ga0070675_100112296
490 Ga0070675_100221946
491 Ga0070675_100385311
492 Ga0070675_100434965
493 Ga0070671_100012844
494 Ga0070671_100025015
495 Ga0070671_100290596
496 Ga0070674_100212113
497 Ga0070674_100351641
498 Ga0070673_100010753
499 Ga0070673_100011163
500 Ga0070673_100037315
501 Ga0070688_100003612
502 Ga0070688_100021631
503 Ga0070688_100057309
504 Ga0070688_100175504
505 Ga0070667_100029015
506 Ga0070667_100062677
507 Ga0070667_100132872
508 Ga0070701_10059366
509 Ga0070700_100061821
510 Ga0070700_100070768
511 Ga0070708_100439288
512 Ga0070678_100060029
513 Ga0070678_100072130
514 Ga0070678_100395169
515 Ga0070662_100021722
516 Ga0068867_100009997
517 Ga0068867_100028918
518 Ga0068867_100073180
519 Ga0068867_100258350
520 Ga0070685_10039789
521 Ga0070685_10050846
522 Ga0070685_10053719
523 Ga0070699_100085886
524 Ga0070699_100188927
525 Ga0070697_100015314
526 Ga0070697_100533684
527 Ga0070672_100019441
528 Ga0070672_100035211
529 Ga0070672_100105164
530 Ga0070672_100126022
531 Ga0070672_100169516
532 Ga0070672_100391611
533 Ga0070686_100020104
534 Ga0070686_100034616
535 Ga0070686_100187251
536 Ga0070695_100087177
537 Ga0070665_100002105
538 Ga0070665_100375818
539 Ga0070704_100051245
540 Ga0070664_100004567
541 Ga0070664_100610950
542 Ga0068857_100016769
543 Ga0070702_100019334
544 Ga0070702_100172907
545 Ga0068859_100031319
546 Ga0068859_100073438
547 Ga0068859_100084522
548 Ga0068859_100310718
549 Ga0068864_100018372
550 Ga0068864_100024259
551 Ga0068864_100030020
552 Ga0068864_100196329
553 Ga0068866_10244380
554 Ga0068861_100133450
555 Ga0068870_10013670
556 Ga0068870_10075965
557 Ga0068870_10146429
558 Ga0068863_100002274
559 Ga0068863_100003258
560 Ga0068858_100032833
561 Ga0068858_100196448
562 Ga0068860_100045088
563 Ga0068860_100099238
564 Ga0068860_100113918
565 Ga0068862_100023503
566 Ga0068862_100119806
567 Ga0068862_100379139
568 Ga0081455_10040046
569 Ga0081455_10057938
570 Ga0097621_100000923
571 Ga0097621_100100983
572 Ga0068871_100025327
573 Ga0068871_100051230
574 Ga0068871_100059328
575 Ga0075428_100013238
576 Ga0075428_100108442
577 Ga0075428_100513599
578 Ga0075430_100251065
579 Ga0075430_100401607
580 Ga0075431_100000804
581 Ga0075431_100049740
582 Ga0075431_100296140
583 Ga0075433_10000859
584 Ga0075433_10005542
585 Ga0075433_10008218
586 Ga0075433_10019856
587 Ga0075433_10057793
588 Ga0075434_100001651
589 Ga0075434_100008098
590 Ga0075434_100071372
591 Ga0075434_100097444
592 Ga0075429_100019522
593 Ga0075429_100154659
594 Ga0068865_100033715
595 Ga0068865_100056832
596 Ga0068865_100296374
597 Ga0075436_100004829
598 Ga0075436_100032524
599 Ga0097620_100031318
600 Ga0097620_100073438
601 Ga0097620_100084522
602 Ga0097620_100176127
603 Ga0097620_100310703
604 Ga0075435_100000448
605 Ga0075435_100003002
606 Ga0075435_100192905
607 Ga0105240_10001924
608 Ga0111539_10000058
609 Ga0111539_10003275
610 Ga0111539_10004803
611 Ga0111539_10032777
612 Ga0111539_10151701
613 Ga0111539_10300258
614 Ga0111539_10303557
615 Ga0111539_10687846
616 Ga0111539_10980669
617 Ga0105245_10006113
618 Ga0105245_10616063
619 Ga0105247_10008725
620 Ga0114129_10000807
621 Ga0114129_10010117
622 Ga0114129_10026805
623 Ga0114129_10053853
624 Ga0114129_10184734
625 Ga0114129_10523314
626 Ga0114129_10814234
627 Ga0105243_10332785
628 Ga0105243_10374388
629 Ga0105242_10030468
630 Ga0105242_10077589
631 Ga0105242_10245717
632 Ga0105248_10010662
633 Ga0105248_10027089
634 Ga0105248_10042134
635 Ga0105248_10084645
636 Ga0105248_10090362
637 Ga0105248_10325516
638 Ga0105248_10328836
639 Ga0105238_10418778
640 Ga0105249_10121316
641 Ga0105249_10660344
642 Ga0105246_10242609
643 Ga0157374_10281952
644 Ga0163162_10017681
645 Ga0157375_10012341
646 Ga0157375_10071849
647 Ga0157375_10098818
648 Ga0157375_10312359
649 Ga0163163_10009383
650 Ga0163163_10047763
651 Ga0163163_10112605
652 Ga0157380_10002213
653 Ga0157380_10005515
654 Ga0157380_10030060
655 Ga0157380_10098929
656 Ga0157380_10504579
657 Ga0157380_10759492
658 Ga0157377_10100066
659 Ga0157379_10018079
660 Ga0157379_10034434
661 Ga0157379_10045098
662 Ga0157376_10029637
663 Ga0157376_10203086
664 Ga0157376_10331879
665 Ga0163161_10076439
666 Ga0163161_10096193
667 Ga0213876_10108641
668 Ga0207682_10003257
669 Ga0207682_10005272
670 Ga0207682_10006634
671 Ga0207682_10053731
672 Ga0207682_10067223
673 Ga0207682_10157046
674 Ga0207710_10015444
675 Ga0207710_10052113
676 Ga0207688_10011933
677 Ga0207645_10001335
678 Ga0207645_10141041
679 Ga0207643_10003447
680 Ga0207643_10138383
681 Ga0207643_10168879
682 Ga0207684_10016272
683 Ga0207695_10003258
684 Ga0207695_10306320
685 Ga0207660_10129202
686 Ga0207660_10226772
687 Ga0207662_10014575
688 Ga0207662_10085191
689 Ga0207662_10134614
690 Ga0207681_10055790
691 Ga0207681_10114549
692 Ga0207681_10218059
693 Ga0207650_10036221
694 Ga0207650_10050254
695 Ga0207659_10002400
696 Ga0207659_10003281
697 Ga0207659_10014346
698 Ga0207659_10017649
699 Ga0207659_10048630
700 Ga0207659_10095889
701 Ga0207659_10375205
702 Ga0207687_10092069
703 Ga0207687_10258230
704 Ga0207644_10048785
705 Ga0207644_10080208
706 Ga0207644_10166047
707 Ga0207706_10005650
708 Ga0207706_10034533
709 Ga0207686_10001990
710 Ga0207686_10033987
711 Ga0207670_10057161
712 Ga0207670_10080481
713 Ga0207670_10131695
714 Ga0207669_10017650
715 Ga0207669_10098171
716 Ga0207669_10319262
717 Ga0207669_10382570
718 Ga0207704_10039039
719 Ga0207691_10008829
720 Ga0207691_10021284
721 Ga0207691_10034699
722 Ga0207691_10058474
723 Ga0207691_10061575
724 Ga0207691_10112547
725 Ga0207691_10365454
726 Ga0207691_10425160
727 Ga0207711_10037323
728 Ga0207711_10083720
729 Ga0207711_10110669
730 Ga0207689_10001511
731 Ga0207689_10040816
732 Ga0207679_10492933
733 Ga0207667_10383687
734 Ga0207651_10005797
735 Ga0207651_10011053
736 Ga0207651_10032714
737 Ga0207651_10055326
738 Ga0207651_10175325
739 Ga0207712_10121638
740 Ga0207640_10299078
741 Ga0207658_10065455
742 Ga0207677_10078038
743 Ga0207703_10141505
744 Ga0207703_10203412
745 Ga0207703_10261000
746 Ga0207703_10412765
747 Ga0207708_10012139
748 Ga0207708_10083307
749 Ga0207708_10141216
750 Ga0207708_10392096
751 Ga0207641_10019673
752 Ga0207641_10134172
753 Ga0207641_10640053
754 Ga0207648_10006857
755 Ga0207648_10137069
756 Ga0207648_10170725
757 Ga0207648_10190865
758 Ga0207676_10016882
759 Ga0207676_10041809
760 Ga0207676_10067864
761 Ga0207674_10023935
762 Ga0207674_10098337
763 Ga0207674_10127731
764 Ga0207675_100029631
765 Ga0207675_100111395
766 Ga0207683_10012107
767 Ga0207683_10015043
768 Ga0207683_10130914
769 Ga0207698_10071237
770 Ga0207428_10000236
771 Ga0207428_10006274
772 Ga0207428_10006872
773 Ga0207428_10018362
774 Ga0207428_10055618
775 Ga0207428_10099284
776 Ga0268266_10007086
777 Ga0268265_10012435
778 Ga0268265_10346209
779 Ga0268264_10214605
780 Ga0307408_100011881
781 Ga0307405_10034677
782 Ga0307413_10000866
783 Ga0307413_10016166
784 Ga0307410_10076718
785 Ga0307410_10164119
786 Ga0307406_10090474
787 Ga0307407_10002641
788 Ga0307412_10009827
789 Ga0307412_10027309
790 Ga0307409_100008530
791 Ga0307409_100037613
792 Ga0307416_100156407
793 Ga0307416_100166872
794 Ga0307411_10004373
795 Ga0307411_10027128
796 Ga0307411_10039210
797 Ga0307411_10217358
798 Ga0307415_100008077
799 Ga0373932_0096623
800 Ga0373941_0047062
801 Ga0373961_0025581
802 Ga0373937_0039649
803 Ga0373937_0280741
804 Ga0436365_0944033
805 Ga0439453_0015019
806 Ga0439433_0005261
807 Ga0439441_028119
808 Ga0450920_020611
809 Ga0439435_0000415
810 Ga0451576_0011737
811 Ga0495650_0071119
812 Ga0495630_0033144
813 Ga0495643_0002568
814 Ga0495635_0070222
815 Ga0495669_0006065
816 Ga0495686_0000083
817 Ga0496113_0072644
818 Ga0496114_0118541
819 Ga0496114_0652022
820 Ga0501033_0258844
821 Ga0501034_0471477
822 Ga0501036_0193254
823 Ga0501037_0172407
824 Ga0501038_0123079
825 Ga0501039_0098500
826 Ga0501039_0474586
827 Ga0501040_0004831
828 Ga0501040_0020737
829 Ga0501041_0001803
830 Ga0501042_0024117
831 Ga0501042_0223742
832 Ga0501042_0234715
833 Ga0501046_0042302
834 Ga0501046_0349601
835 Ga0501068_0114886
836 Ga0501071_0017646
837 Ga0501072_0022392
838 Ga0501072_0263065
839 Ga0501074_0029220
840 Ga0501074_0273657
841 Ga0501075_0007156
842 Ga0501075_0019220
843 Ga0501075_0045334
844 Ga0501076_0049691
845 Ga0501077_0222945
846 Ga0501079_0032001
847 Ga0501079_0075627
848 Ga0501080_0500028
849 Ga0501081_0011300
850 Ga0501081_0254697
851 Ga0501045_0026320
852 nmdc:mga05p37_17920_c1
853 nmdc:mga05p37_354246_c1
854 nmdc:mga09592_133948_c1
855 nmdc:mga09592_166351_c1
856 nmdc:mga09592_51681_c1
857 nmdc:mga09592_6451_c1
858 nmdc:mga09592_95843_c1
859 nmdc:mga0qj67_289195_c1
860 nmdc:mga0qj67_337130_c1
861 nmdc:mga0qj67_49797_c1
862 nmdc:mga06r32_175143_c1
863 nmdc:mga06r32_32043_c1
864 nmdc:mga08y16_12253_c1
865 nmdc:mga08y16_15280_c1
866 nmdc:mga08y16_1659_c1
867 nmdc:mga08y16_201679_c1
868 nmdc:mga08y16_327_c1
869 nmdc:mga08y16_467449_c1
870 nmdc:mga08y16_53101_c1
871 nmdc:mga08y16_70818_c1
872 nmdc:mga0n895_1051_c1
873 nmdc:mga0n895_256750_c1
874 nmdc:mga0n895_28411_c1
875 nmdc:mga0n895_34168_c1
876 nmdc:mga0n895_476919_c1
877 nmdc:mga0rr50_1067_c1
878 nmdc:mga0rr50_159234_c1
879 nmdc:mga0rr50_23475_c1
880 nmdc:mga0rr50_3762_c1
881 nmdc:mga08x19_29038_c1
882 nmdc:mga08x19_66187_c1
883 nmdc:mga0a205_23424_c1
884 nmdc:mga0a205_2820_c1
885 nmdc:mga0a205_6117_c1
886 nmdc:mga0a205_668_c1
887 Ga0495619_0010537
888 Ga0500627_0099662
889 Ga0501084_0108880
890 Ga0501084_0157214
891 Ga0590075_000095
892 Ga0590077_001061
893 Ga0530510_0037583
894 2910250537

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

77

321

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lmz-assembly1.cif.gz_A-2 crystal structure of putative sugar isomerase. (yp_001305105.1) from parabacteroides distasonis atcc 8503 at 1.44 a resolution 0.8505 23 299
3lmz-assembly1.cif.gz_A-2 crystal structure of putative sugar isomerase. (yp_001305105.1) from parabacteroides distasonis atcc 8503 at 1.44 a resolution 0.8225 23 299
3p6l-assembly1.cif.gz_A crystal structure of a sugar phosphate isomerase/epimerase (bdi_1903) from parabacteroides distasonis atcc 8503 at 1.85 a resolution 0.8086 27 299
3p6l-assembly1.cif.gz_A crystal structure of a sugar phosphate isomerase/epimerase (bdi_1903) from parabacteroides distasonis atcc 8503 at 1.85 a resolution 0.775 27 299
3cqi-assembly1.cif.gz_B crystal structure of l-xylulose-5-phosphate 3-epimerase ulae (form b) complex with sulfate 0.7441 29 299
ID Description Score Start End Superfamily
3lmzA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8395 23 299 3.20.20.150
3lmzA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8112 23 299 3.20.20.150
3p6lA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8049 27 299 3.20.20.150
3p6lA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7709 27 299 3.20.20.150
3cqiB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7441 29 299 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A2V8K7G4-F1-model_v4 Xylose isomerase-like TIM barrel domain-containing protein 0.9885 105 300
AF-A0A2V8MR61-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9802 25 300 GO:0016853
AF-A0A2V8GCH9-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9709 121 300 GO:0016853
AF-A0A2V9LCD1-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9705 86 299 GO:0016853
AF-A0A7V8NT26-F1-model_v4 TIM barrel protein 0.9667 108 299

Map