F445785

General Info

Members Datasets Scaffolds Average Seq Length
446 246 892 197

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0008622|Ga0495629_0008622_2556_3236
Length 226
Sequence MSVKPCSLLNSHCSSPEGLIELEQRSGYGSRVQLHKRDVVAAATAILDNYGIADLTMRRLGRELNVSPGALYWHFANKQQLLGAIADRILEPVGDEPGEWQARVVGICGRLRDALLSHTDGAELVSASFAAGQSEAMAQIVAHLAQAAIDAGVDSGHAELAARTVVYYVLGFTADEQSRLQWDAAGAELPDEQSVLADDAGERFGFGLALLVDGIAAHRAVVGLSD

Samples

Sample ID Description Type Environment
1 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
147 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
153 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
154 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
157 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
158 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
159 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
160 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
161 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
162 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
163 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
164 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
165 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
168 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
181 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
202 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
203 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
218 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
219 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
220 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
221 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
227 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
228 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
229 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
230 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
231 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
232 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
233 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
234 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
235 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
236 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
237 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
238 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
239 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
240 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
241 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
242 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
243 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
244 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
245 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
246 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.21
Metatranscriptomes 0
Isolates 1.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.43
Nodule 0
Rhizoplane 10.99
Rhizosphere 74.66
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495629_0008622 3300046459 Bacteria 7507
2 JGI24746J21847_1002992 3300001977 Bacteria 2657
3 JGI24737J22298_10037621 3300001990 Bacteria 1491
4 JGI24034J26672_10002872 3300002239 Bacteria 2381
5 JGI24742J22300_10001807 3300002244 Bacteria 3405
6 JGI24751J29686_10001487 3300002459 Bacteria 4876
7 Ga0070676_10176761 3300005328 Bacteria 1385
8 Ga0070690_100181232 3300005330 Bacteria 1456
9 Ga0070690_100435985 3300005330 Bacteria 969
10 Ga0070670_100261800 3300005331 Bacteria 1508
11 Ga0068869_100005048 3300005334 Bacteria 8272
12 Ga0068869_100059988 3300005334 Bacteria 2787
13 Ga0070680_100173873 3300005336 Bacteria 1813
14 Ga0070682_100110120 3300005337 Bacteria 1834
15 Ga0068868_100147117 3300005338 Bacteria 1938
16 Ga0068868_100588515 3300005338 Bacteria 984
17 Ga0070689_100090925 3300005340 Bacteria 2406
18 Ga0070689_100093245 3300005340 Bacteria 2376
19 Ga0070691_10001448 3300005341 Bacteria 10161
20 Ga0070692_10127011 3300005345 Bacteria 1429
21 Ga0070668_100000568 3300005347 Bacteria 24706
22 Ga0070668_100183945 3300005347 Bacteria 1708
23 Ga0070668_100383867 3300005347 Bacteria 1196
24 Ga0070668_100677971 3300005347 Bacteria 907
25 Ga0070669_100009018 3300005353 Bacteria 7114
26 Ga0070675_100074976 3300005354 Bacteria 2812
27 Ga0070671_100027334 3300005355 Bacteria 4695
28 Ga0070671_100044728 3300005355 Bacteria 3680
29 Ga0070671_100174854 3300005355 Bacteria 1816
30 Ga0070674_100001914 3300005356 Bacteria 11329
31 Ga0070674_100351538 3300005356 Bacteria 1191
32 Ga0070673_100876285 3300005364 Bacteria 832
33 Ga0070688_100051988 3300005365 Bacteria 2558
34 Ga0070659_100099965 3300005366 Bacteria 2334
35 Ga0070667_100003391 3300005367 Bacteria 13569
36 Ga0070667_100005403 3300005367 Bacteria 10671
37 Ga0070667_100166644 3300005367 Bacteria 1943
38 Ga0070703_10013783 3300005406 Bacteria 2298
39 Ga0070709_10294370 3300005434 Bacteria 1184
40 Ga0070710_10000932 3300005437 Bacteria 13915
41 Ga0070710_10201351 3300005437 Bacteria 1257
42 Ga0070701_10014939 3300005438 Bacteria 3572
43 Ga0070711_100001643 3300005439 Bacteria 12357
44 Ga0070711_100014398 3300005439 Bacteria 4984
45 Ga0070705_100367406 3300005440 Bacteria 1055
46 Ga0070700_100002582 3300005441 Bacteria 9259
47 Ga0070663_100056245 3300005455 Bacteria 2818
48 Ga0070663_100068846 3300005455 Bacteria 2570
49 Ga0070663_100244274 3300005455 Bacteria 1418
50 Ga0070678_100001757 3300005456 Bacteria 11669
51 Ga0070678_100089151 3300005456 Bacteria 2360
52 Ga0070678_100517449 3300005456 Bacteria 1055
53 Ga0070678_100640969 3300005456 Bacteria 952
54 Ga0070662_100001601 3300005457 Bacteria 13975
55 Ga0070662_100120682 3300005457 Bacteria 2009
56 Ga0070662_100645198 3300005457 Bacteria 893
57 Ga0068867_100020871 3300005459 Bacteria 4672
58 Ga0070685_10057839 3300005466 Bacteria 2258
59 Ga0070698_100346879 3300005471 Bacteria 1416
60 Ga0070697_100393286 3300005536 Bacteria 1202
61 Ga0068853_100010926 3300005539 Bacteria 7359
62 Ga0070672_100469940 3300005543 Bacteria 1085
63 Ga0070686_100131918 3300005544 Bacteria 1729
64 Ga0070686_100306404 3300005544 Bacteria 1180
65 Ga0070695_100011006 3300005545 Bacteria 5408
66 Ga0070695_100026193 3300005545 Bacteria 3606
67 Ga0070696_100017971 3300005546 Bacteria 4776
68 Ga0070696_100032827 3300005546 Bacteria 3563
69 Ga0070693_100037896 3300005547 Bacteria 2691
70 Ga0070665_100004596 3300005548 Bacteria 14442
71 Ga0070665_100027133 3300005548 Bacteria 5768
72 Ga0070704_100012664 3300005549 Bacteria 5218
73 Ga0070704_100016151 3300005549 Bacteria 4711
74 Ga0070704_100991477 3300005549 Bacteria 759
75 Ga0068855_100086324 3300005563 Bacteria 3629
76 Ga0068855_100664676 3300005563 Bacteria 1118
77 Ga0068854_100000704 3300005578 Bacteria 19787
78 Ga0068854_100202450 3300005578 Bacteria 1561
79 Ga0068854_100211153 3300005578 Bacteria 1531
80 Ga0070702_100027914 3300005615 Bacteria 3051
81 Ga0068852_100082950 3300005616 Bacteria 2850
82 Ga0068859_100005722 3300005617 Bacteria 12646
83 Ga0068859_101625809 3300005617 Bacteria 713
84 Ga0068859_101680804 3300005617 Bacteria 701
85 Ga0068864_100698572 3300005618 Bacteria 991
86 Ga0068866_10001957 3300005718 Bacteria 8588
87 Ga0068866_10089446 3300005718 Bacteria 1673
88 Ga0068861_100000622 3300005719 Bacteria 20950
89 Ga0068861_100045107 3300005719 Bacteria 3317
90 Ga0068863_100000886 3300005841 Bacteria 30122
91 Ga0068858_100028212 3300005842 Bacteria 5215
92 Ga0068858_100401647 3300005842 Bacteria 1317
93 Ga0068860_100013606 3300005843 Bacteria 7976
94 Ga0068860_100108679 3300005843 Bacteria 2651
95 Ga0068860_100338305 3300005843 Bacteria 1479
96 Ga0068862_100030020 3300005844 Bacteria 4580
97 Ga0068862_100132653 3300005844 Bacteria 2205
98 Ga0068862_100193029 3300005844 Bacteria 1833
99 Ga0081540_1036399 3300005983 Bacteria 2625
100 Ga0075365_10033311 3300006038 Bacteria 3319
101 Ga0075365_10042254 3300006038 Bacteria 2980
102 Ga0075365_10470431 3300006038 Bacteria 888
103 Ga0075363_100006370 3300006048 Bacteria 5349
104 Ga0075363_100014341 3300006048 Bacteria 3869
105 Ga0075363_100069613 3300006048 Bacteria 1909
106 Ga0075363_100136131 3300006048 Bacteria 1380
107 Ga0075363_100495954 3300006048 Bacteria 725
108 Ga0075363_100596675 3300006048 Bacteria 661
109 Ga0075364_10000234 3300006051 Bacteria 26412
110 Ga0075364_10077290 3300006051 Bacteria 2197
111 Ga0075432_10163310 3300006058 Bacteria 862
112 Ga0070715_10225742 3300006163 Bacteria 965
113 Ga0070715_10239062 3300006163 Bacteria 943
114 Ga0070716_100007560 3300006173 Bacteria 5360
115 Ga0070716_100222708 3300006173 Bacteria 1268
116 Ga0070716_100279275 3300006173 Bacteria 1152
117 Ga0070716_100521102 3300006173 Bacteria 881
118 Ga0070712_100009953 3300006175 Bacteria 5993
119 Ga0070712_100013437 3300006175 Bacteria 5234
120 Ga0070712_100050114 3300006175 Bacteria 2903
121 Ga0070712_100971515 3300006175 Bacteria 734
122 Ga0075367_10054540 3300006178 Bacteria 2370
123 Ga0075369_10001288 3300006186 Bacteria 8528
124 Ga0075369_10011608 3300006186 Bacteria 3468
125 Ga0075369_10017858 3300006186 Bacteria 2882
126 Ga0075369_10033187 3300006186 Bacteria 2187
127 Ga0075369_10042309 3300006186 Bacteria 1953
128 Ga0075369_10210980 3300006186 Bacteria 898
129 Ga0097621_100144689 3300006237 Bacteria 2034
130 Ga0068871_100870975 3300006358 Bacteria 833
131 Ga0075428_100086149 3300006844 Bacteria 3426
132 Ga0075430_100185897 3300006846 Bacteria 1728
133 Ga0075430_100552476 3300006846 Bacteria 950
134 Ga0075431_100084062 3300006847 Bacteria 3286
135 Ga0068865_100012022 3300006881 Bacteria 5439
136 Ga0068865_100366384 3300006881 Bacteria 1171
137 Ga0068865_100620449 3300006881 Bacteria 916
138 Ga0068865_101196613 3300006881 Bacteria 672
139 Ga0097620_100005722 3300006931 Bacteria 12646
140 Ga0097620_101625809 3300006931 Bacteria 713
141 Ga0097620_101681174 3300006931 Bacteria 701
142 Ga0105250_10070660 3300009092 Bacteria 1410
143 Ga0111539_10410530 3300009094 Bacteria 1577
144 Ga0111539_10860799 3300009094 Bacteria 1054
145 Ga0105245_10007406 3300009098 Bacteria 9613
146 Ga0105245_10398866 3300009098 Bacteria 1374
147 Ga0105247_10003220 3300009101 Bacteria 10742
148 Ga0105247_10227204 3300009101 Bacteria 1266
149 Ga0105247_10597969 3300009101 Bacteria 818
150 Ga0114129_10052042 3300009147 Bacteria 5747
151 Ga0105243_10033352 3300009148 Bacteria 3982
152 Ga0105241_10151788 3300009174 Bacteria 1896
153 Ga0105242_10001104 3300009176 Bacteria 21251
154 Ga0105248_10010806 3300009177 Bacteria 10081
155 Ga0105248_10153551 3300009177 Bacteria 2597
156 Ga0105248_11235541 3300009177 Bacteria 845
157 Ga0105237_10588047 3300009545 Bacteria 1120
158 Ga0105249_10000571 3300009553 Bacteria 33782
159 Ga0105249_10059665 3300009553 Bacteria 3499
160 Ga0105249_10137483 3300009553 Bacteria 2340
161 Ga0105249_11720535 3300009553 Bacteria 700
162 Ga0099796_10003973 3300010159 Bacteria 3514
163 Ga0105239_10062405 3300010375 Bacteria 4090
164 Ga0105239_11012166 3300010375 Bacteria 955
165 Ga0105246_10729884 3300011119 Bacteria 871
166 Ga0157369_10488432 3300013105 Bacteria 1274
167 Ga0157378_10030839 3300013297 Bacteria 4733
168 Ga0163162_10151319 3300013306 Bacteria 2438
169 Ga0163162_10163330 3300013306 Bacteria 2350
170 Ga0163162_10543049 3300013306 Bacteria 1291
171 Ga0163162_11350696 3300013306 Bacteria 810
172 Ga0157372_10208893 3300013307 Bacteria 2262
173 Ga0157372_11052004 3300013307 Bacteria 942
174 Ga0157375_10005667 3300013308 Bacteria 10866
175 Ga0157375_10042543 3300013308 Bacteria 4397
176 Ga0157375_10426753 3300013308 Bacteria 1492
177 Ga0163163_10956220 3300014325 Bacteria 920
178 Ga0157380_10017017 3300014326 Bacteria 5371
179 Ga0157380_10723406 3300014326 Bacteria 1003
180 Ga0157379_10018092 3300014968 Bacteria 6210
181 Ga0163161_10018132 3300017792 Bacteria 4935
182 Ga0207692_10007629 3300025898 Bacteria 4439
183 Ga0207642_10000205 3300025899 Bacteria 17391
184 Ga0207642_10004430 3300025899 Bacteria 4530
185 Ga0207710_10011183 3300025900 Bacteria 3778
186 Ga0207710_10216329 3300025900 Bacteria 950
187 Ga0207688_10003825 3300025901 Bacteria 8212
188 Ga0207688_10004459 3300025901 Bacteria 7623
189 Ga0207688_10147166 3300025901 Bacteria 1389
190 Ga0207685_10028767 3300025905 Bacteria 1961
191 Ga0207699_10019740 3300025906 Bacteria 3600
192 Ga0207645_10061030 3300025907 Bacteria 2408
193 Ga0207654_10016336 3300025911 Bacteria 3864
194 Ga0207693_10000705 3300025915 Bacteria 30041
195 Ga0207693_10002182 3300025915 Bacteria 17058
196 Ga0207663_10012077 3300025916 Bacteria 4657
197 Ga0207663_10156414 3300025916 Bacteria 1604
198 Ga0207663_10474471 3300025916 Bacteria 968
199 Ga0207681_10195745 3300025923 Bacteria 1549
200 Ga0207681_10245603 3300025923 Bacteria 1395
201 Ga0207694_10335555 3300025924 Bacteria 1250
202 Ga0207650_10607082 3300025925 Bacteria 920
203 Ga0207659_10010437 3300025926 Bacteria 5839
204 Ga0207687_10002750 3300025927 Bacteria 11926
205 Ga0207700_10485417 3300025928 Bacteria 1092
206 Ga0207644_10022035 3300025931 Bacteria 4347
207 Ga0207644_10143843 3300025931 Bacteria 1839
208 Ga0207706_10052081 3300025933 Bacteria 3614
209 Ga0207706_10119370 3300025933 Bacteria 2318
210 Ga0207686_10004667 3300025934 Bacteria 7343
211 Ga0207670_10093770 3300025936 Bacteria 2128
212 Ga0207670_10568623 3300025936 Bacteria 928
213 Ga0207669_10000318 3300025937 Bacteria 22011
214 Ga0207669_10013923 3300025937 Bacteria 4015
215 Ga0207669_10225459 3300025937 Bacteria 1379
216 Ga0207669_10497855 3300025937 Bacteria 974
217 Ga0207704_10001564 3300025938 Bacteria 10254
218 Ga0207704_10333783 3300025938 Bacteria 1174
219 Ga0207665_10006323 3300025939 Bacteria 7855
220 Ga0207665_10025277 3300025939 Bacteria 3917
221 Ga0207665_10578646 3300025939 Bacteria 875
222 Ga0207691_10073301 3300025940 Bacteria 3088
223 Ga0207691_10314959 3300025940 Bacteria 1342
224 Ga0207711_10450890 3300025941 Bacteria 1197
225 Ga0207711_10944554 3300025941 Bacteria 801
226 Ga0207689_10008722 3300025942 Bacteria 8823
227 Ga0207689_10037220 3300025942 Bacteria 4037
228 Ga0207651_10976531 3300025960 Bacteria 756
229 Ga0207712_10031697 3300025961 Bacteria 3563
230 Ga0207712_11054144 3300025961 Bacteria 723
231 Ga0207668_10063791 3300025972 Bacteria 2600
232 Ga0207668_10126118 3300025972 Bacteria 1947
233 Ga0207668_10618420 3300025972 Bacteria 945
234 Ga0207668_11043925 3300025972 Bacteria 731
235 Ga0207640_10000920 3300025981 Bacteria 16509
236 Ga0207640_10221876 3300025981 Bacteria 1448
237 Ga0207640_10302518 3300025981 Bacteria 1266
238 Ga0207658_10208021 3300025986 Bacteria 1638
239 Ga0207677_10089110 3300026023 Bacteria 2239
240 Ga0207677_11093920 3300026023 Bacteria 726
241 Ga0207703_10018029 3300026035 Bacteria 5513
242 Ga0207703_10218057 3300026035 Bacteria 1704
243 Ga0207639_10117959 3300026041 Bacteria 2175
244 Ga0207639_10273054 3300026041 Bacteria 1484
245 Ga0207678_10003485 3300026067 Bacteria 14158
246 Ga0207678_10039382 3300026067 Bacteria 4102
247 Ga0207678_10065341 3300026067 Bacteria 3124
248 Ga0207708_10003132 3300026075 Bacteria 12174
249 Ga0207708_10015051 3300026075 Bacteria 5798
250 Ga0207641_10004902 3300026088 Bacteria 11504
251 Ga0207648_10033020 3300026089 Bacteria 4566
252 Ga0207648_10294248 3300026089 Bacteria 1454
253 Ga0207676_10145975 3300026095 Bacteria 2032
254 Ga0207675_100000941 3300026118 Bacteria 29074
255 Ga0207675_100020330 3300026118 Bacteria 6189
256 Ga0207675_100022250 3300026118 Bacteria 5903
257 Ga0207683_10006869 3300026121 Bacteria 9747
258 Ga0207683_10027074 3300026121 Bacteria 4955
259 Ga0207683_10043502 3300026121 Bacteria 3925
260 Ga0207683_10661588 3300026121 Bacteria 968
261 Ga0207698_10078765 3300026142 Bacteria 2648
262 Ga0207428_10175801 3300027907 Bacteria 1619
263 Ga0268266_10002908 3300028379 Bacteria 17732
264 Ga0268266_10033590 3300028379 Bacteria 4361
265 Ga0268265_10005537 3300028380 Bacteria 8621
266 Ga0268265_10141740 3300028380 Bacteria 2013
267 Ga0268265_10661622 3300028380 Bacteria 1005
268 Ga0268265_10946845 3300028380 Bacteria 848
269 Ga0268265_11580412 3300028380 Bacteria 660
270 Ga0268264_10004799 3300028381 Bacteria 11468
271 Ga0268264_10236976 3300028381 Bacteria 1688
272 Ga0268264_10631174 3300028381 Bacteria 1059
273 Ga0265327_10000081 3300031251 Bacteria 205988
274 Ga0265327_10009711 3300031251 Bacteria 6892
275 Ga0265327_10046265 3300031251 Bacteria 2305
276 Ga0316578_10235808 3300031728 Bacteria 1099
277 Ga0307413_10786408 3300031824 Bacteria 798
278 Ga0307413_11107523 3300031824 Bacteria 684
279 Ga0307406_10338895 3300031901 Bacteria 1170
280 Ga0307416_101507608 3300032002 Bacteria 778
281 Ga0307414_10649774 3300032004 Bacteria 951
282 Ga0373959_0029646 3300034820 Bacteria 1098
283 Ga0373932_0209813 3300035112 Bacteria 696
284 Ga0373960_0081325 3300035121 Bacteria 1020
285 Ga0373931_0020790 3300035691 Bacteria 3286
286 Ga0436364_0610518 3300037853 Bacteria 13173
287 Ga0439461_0000435 3300041410 Bacteria 6003
288 Ga0439461_0006899 3300041410 Bacteria 1992
289 Ga0439465_0016274 3300041413 Bacteria 2320
290 Ga0439465_0060583 3300041413 Bacteria 1253
291 Ga0439431_0003883 3300041997 Bacteria 3297
292 Ga0439442_002369 3300042002 Bacteria 3696
293 Ga0439445_0001715 3300042004 Bacteria 4820
294 Ga0439445_0015111 3300042004 Bacteria 1887
295 Ga0439448_0086396 3300042005 Bacteria 1057
296 Ga0439435_0027625 3300042436 Bacteria 1520
297 Ga0466972_0020398 3300044658 Bacteria 3312
298 Ga0466965_0000977 3300044683 Bacteria 11071
299 Ga0466965_0084687 3300044683 Bacteria 1606
300 Ga0466963_0160430 3300044694 Bacteria 1565
301 Ga0466963_0170565 3300044694 Bacteria 1517
302 Ga0466964_0223531 3300044706 Bacteria 915
303 Ga0466968_0001250 3300044735 Bacteria 9032
304 Ga0466968_0025389 3300044735 Bacteria 2427
305 Ga0466970_0011683 3300044765 Bacteria 4479
306 Ga0466970_0039512 3300044765 Bacteria 2503
307 Ga0466970_0105989 3300044765 Bacteria 1533
308 Ga0466957_0004000 3300044842 Bacteria 8149
309 Ga0466957_0050880 3300044842 Bacteria 2521
310 Ga0466960_0064038 3300044901 Bacteria 1812
311 Ga0466959_0008423 3300045049 Bacteria 7291
312 Ga0466959_0012199 3300045049 Bacteria 6201
313 Ga0466958_0033873 3300045836 Bacteria 3045
314 Ga0466967_0011056 3300045976 Bacteria 6813
315 Ga0466967_0070338 3300045976 Bacteria 3131
316 Ga0466967_0158661 3300045976 Bacteria 2122
317 Ga0466967_0220439 3300045976 Bacteria 1802
318 Ga0466967_1031798 3300045976 Bacteria 819
319 Ga0495638_0030522 3300046460 Bacteria 3469
320 Ga0495582_0067322 3300046473 Bacteria 1979
321 Ga0495594_0123535 3300046499 Bacteria 1464
322 Ga0495630_0072647 3300046517 Bacteria 2590
323 Ga0495634_0176598 3300046642 Bacteria 1340
324 Ga0495588_0310130 3300046674 Bacteria 830
325 Ga0495646_0307465 3300046680 Bacteria 837
326 Ga0495581_0085003 3300047315 Bacteria 1834
327 Ga0495676_0130082 3300047321 Bacteria 1819
328 Ga0495686_0427572 3300047472 Bacteria 707
329 Ga0496100_0034082 3300048903 Bacteria 3191
330 Ga0496100_0117842 3300048903 Bacteria 1854
331 Ga0496100_0529811 3300048903 Bacteria 910
332 Ga0496101_0107635 3300048904 Bacteria 2095
333 Ga0496101_0160171 3300048904 Bacteria 1725
334 Ga0496101_0773091 3300048904 Bacteria 758
335 Ga0496102_0003474 3300048905 Bacteria 13362
336 Ga0496102_0005951 3300048905 Bacteria 10387
337 Ga0496102_0324052 3300048905 Bacteria 1451
338 Ga0496102_0448203 3300048905 Bacteria 1211
339 Ga0496102_0984352 3300048905 Bacteria 764
340 Ga0496103_0000932 3300048906 Bacteria 20970
341 Ga0496103_0157039 3300048906 Bacteria 1458
342 Ga0496103_0210841 3300048906 Bacteria 1249
343 Ga0496104_0117722 3300048907 Bacteria 2550
344 Ga0496104_0165521 3300048907 Bacteria 2120
345 Ga0496104_1584030 3300048907 Bacteria 558
346 Ga0496105_0009686 3300048908 Bacteria 7542
347 Ga0496105_0072825 3300048908 Bacteria 2839
348 Ga0496106_0038341 3300048909 Bacteria 3585
349 Ga0496106_0371161 3300048909 Bacteria 1150
350 Ga0496107_0282360 3300048910 Bacteria 1236
351 Ga0496107_0507745 3300048910 Bacteria 894
352 Ga0496108_0000404 3300048911 Bacteria 35603
353 Ga0496108_0010170 3300048911 Bacteria 7638
354 Ga0496108_0057461 3300048911 Bacteria 3269
355 Ga0496109_0000670 3300048912 Bacteria 28362
356 Ga0496109_0010226 3300048912 Bacteria 8012
357 Ga0496109_0137762 3300048912 Bacteria 2281
358 Ga0496109_0916073 3300048912 Bacteria 815
359 Ga0496110_0097586 3300048913 Bacteria 2633
360 Ga0496110_0101964 3300048913 Bacteria 2573
361 Ga0496111_0064258 3300048914 Bacteria 2662
362 Ga0496111_0495234 3300048914 Bacteria 900
363 Ga0496112_0042757 3300048915 Bacteria 4434
364 Ga0496112_0149106 3300048915 Bacteria 2306
365 Ga0496112_0150787 3300048915 Bacteria 2292
366 Ga0496112_0473131 3300048915 Bacteria 1190
367 Ga0496112_0806617 3300048915 Bacteria 863
368 Ga0496112_1292041 3300048915 Bacteria 645
369 Ga0496113_0025813 3300048916 Bacteria 4193
370 Ga0496113_0029053 3300048916 Bacteria 3987
371 Ga0496113_0104476 3300048916 Bacteria 2198
372 Ga0496113_0394308 3300048916 Bacteria 1111
373 Ga0496114_0002700 3300048917 Bacteria 13558
374 Ga0496114_0186370 3300048917 Bacteria 1814
375 Ga0496114_1071886 3300048917 Bacteria 690
376 Ga0496115_0020339 3300048918 Bacteria 5119
377 Ga0496115_0154914 3300048918 Bacteria 1893
378 Ga0496118_0234103 3300048921 Bacteria 1057
379 Ga0496122_0024627 3300048925 Bacteria 5261
380 Ga0496123_0027858 3300048926 Bacteria 4197
381 Ga0496126_0006189 3300048929 Bacteria 13394
382 Ga0496126_0046596 3300048929 Bacteria 3974
383 Ga0501034_0002996 3300049571 Bacteria 19542
384 Ga0501034_0077942 3300049571 Bacteria 3319
385 Ga0501034_0193083 3300049571 Bacteria 1997
386 Ga0501034_0421466 3300049571 Bacteria 1256
387 Ga0501036_0009512 3300049572 Bacteria 7996
388 Ga0501037_0005727 3300049573 Bacteria 9068
389 Ga0501039_0001425 3300049575 Bacteria 17614
390 Ga0501043_0000337 3300049579 Bacteria 42520
391 Ga0501047_0126125 3300049581 Bacteria 2440
392 Ga0501069_0123966 3300049585 Bacteria 1477
393 Ga0501070_0000642 3300049586 Bacteria 32168
394 Ga0501070_0619002 3300049586 Bacteria 862
395 Ga0501073_0016559 3300049589 Bacteria 5343
396 Ga0501077_0133252 3300049593 Bacteria 1576
397 Ga0501035_0709301 3300049822 Bacteria 811
398 Ga0501044_0033874 3300049823 Bacteria 5363
399 nmdc:mga03n38_106480_c1 3300050490 Bacteria 1359
400 nmdc:mga03n38_155546_c1 3300050490 Bacteria 1154
401 nmdc:mga03n38_20873_c1 3300050490 Bacteria 2627
402 nmdc:mga03n38_209360_c1 3300050490 Bacteria 1013
403 nmdc:mga03n38_321260_c1 3300050490 Bacteria 836
404 nmdc:mga03n38_36659_c1 3300050490 Bacteria 2110
405 nmdc:mga00v17_1257_c1 3300050491 Bacteria 13287
406 nmdc:mga00v17_173747_c1 3300050491 Bacteria 1390
407 nmdc:mga00v17_466921_c1 3300050491 Bacteria 819
408 nmdc:mga0yw44_151119_c1 3300050492 Bacteria 1515
409 nmdc:mga0yw44_91731_c1 3300050492 Bacteria 1187
410 nmdc:mga06z11_13411_c1 3300050494 Bacteria 3598
411 nmdc:mga06z11_529824_c1 3300050494 Bacteria 714
412 nmdc:mga07m45_281396_c1 3300050496 Bacteria 967
413 nmdc:mga07m45_595181_c1 3300050496 Bacteria 639
414 nmdc:mga07m45_64201_c1 3300050496 Bacteria 2083
415 nmdc:mga05p37_265221_c1 3300050507 Bacteria 2054
416 nmdc:mga0qj67_290122_c1 3300050509 Bacteria 1326
417 nmdc:mga06r32_107381_c1 3300050510 Bacteria 2743
418 nmdc:mga08y16_322456_c1 3300050511 Bacteria 1590
419 nmdc:mga0sz30_111697_c1 3300050516 Bacteria 843
420 nmdc:mga0sz30_15713_c1 3300050516 Bacteria 2995
421 nmdc:mga0sz30_2044_c1 3300050516 Bacteria 7207
422 nmdc:mga0sz30_32690_c1 3300050516 Bacteria 2159
423 nmdc:mga0sz30_3453_c1 3300050516 Bacteria 3625
424 nmdc:mga0sz30_53647_c1 3300050516 Bacteria 1283
425 Ga0500610_0007360 3300053079 Bacteria 4711
426 Ga0500635_0000430 3300053080 Bacteria 12188
427 Ga0495655_0058462 3300053083 Bacteria 1044
428 Ga0495619_0300140 3300053085 Bacteria 1113
429 Ga0500646_0136256 3300053090 Bacteria 802
430 Ga0500556_0025950 3300053104 Bacteria 1941
431 Ga0500562_005041 3300053108 Bacteria 3320
432 Ga0500652_000985 3300053131 Bacteria 9378
433 Ga0500652_022549 3300053131 Bacteria 2384
434 Ga0500616_0009492 3300053153 Bacteria 5915
435 Ga0500627_0017750 3300053158 Bacteria 2802
436 Ga0500645_000030 3300053730 Bacteria 121213
437 Ga0500645_128235 3300053730 Bacteria 705
438 Ga0466962_0014155 3300061719 Bacteria 3843
439 2738665132 2738541264 Bacteria 5935393
440 2738707620 2738541274 Bacteria 6909446
441 2739144266 2738541356 Bacteria 5935017
442 2739332632 2738543028 Bacteria 6917070
443 2902801034 2902799365 Bacteria 5419524
444 2902814944 2902810491 Bacteria 6794147
445 2929215509 2929212328 Bacteria 7708288
446 2946080801 2946080515 Bacteria 4310960
447 Ga0495629_0008622
448 JGI24746J21847_1002992
449 JGI24737J22298_10037621
450 JGI24034J26672_10002872
451 JGI24742J22300_10001807
452 JGI24751J29686_10001487
453 Ga0070676_10176761
454 Ga0070690_100181232
455 Ga0070690_100435985
456 Ga0070670_100261800
457 Ga0068869_100005048
458 Ga0068869_100059988
459 Ga0070680_100173873
460 Ga0070682_100110120
461 Ga0068868_100147117
462 Ga0068868_100588515
463 Ga0070689_100090925
464 Ga0070689_100093245
465 Ga0070691_10001448
466 Ga0070692_10127011
467 Ga0070668_100000568
468 Ga0070668_100183945
469 Ga0070668_100383867
470 Ga0070668_100677971
471 Ga0070669_100009018
472 Ga0070675_100074976
473 Ga0070671_100027334
474 Ga0070671_100044728
475 Ga0070671_100174854
476 Ga0070674_100001914
477 Ga0070674_100351538
478 Ga0070673_100876285
479 Ga0070688_100051988
480 Ga0070659_100099965
481 Ga0070667_100003391
482 Ga0070667_100005403
483 Ga0070667_100166644
484 Ga0070703_10013783
485 Ga0070709_10294370
486 Ga0070710_10000932
487 Ga0070710_10201351
488 Ga0070701_10014939
489 Ga0070711_100001643
490 Ga0070711_100014398
491 Ga0070705_100367406
492 Ga0070700_100002582
493 Ga0070663_100056245
494 Ga0070663_100068846
495 Ga0070663_100244274
496 Ga0070678_100001757
497 Ga0070678_100089151
498 Ga0070678_100517449
499 Ga0070678_100640969
500 Ga0070662_100001601
501 Ga0070662_100120682
502 Ga0070662_100645198
503 Ga0068867_100020871
504 Ga0070685_10057839
505 Ga0070698_100346879
506 Ga0070697_100393286
507 Ga0068853_100010926
508 Ga0070672_100469940
509 Ga0070686_100131918
510 Ga0070686_100306404
511 Ga0070695_100011006
512 Ga0070695_100026193
513 Ga0070696_100017971
514 Ga0070696_100032827
515 Ga0070693_100037896
516 Ga0070665_100004596
517 Ga0070665_100027133
518 Ga0070704_100012664
519 Ga0070704_100016151
520 Ga0070704_100991477
521 Ga0068855_100086324
522 Ga0068855_100664676
523 Ga0068854_100000704
524 Ga0068854_100202450
525 Ga0068854_100211153
526 Ga0070702_100027914
527 Ga0068852_100082950
528 Ga0068859_100005722
529 Ga0068859_101625809
530 Ga0068859_101680804
531 Ga0068864_100698572
532 Ga0068866_10001957
533 Ga0068866_10089446
534 Ga0068861_100000622
535 Ga0068861_100045107
536 Ga0068863_100000886
537 Ga0068858_100028212
538 Ga0068858_100401647
539 Ga0068860_100013606
540 Ga0068860_100108679
541 Ga0068860_100338305
542 Ga0068862_100030020
543 Ga0068862_100132653
544 Ga0068862_100193029
545 Ga0081540_1036399
546 Ga0075365_10033311
547 Ga0075365_10042254
548 Ga0075365_10470431
549 Ga0075363_100006370
550 Ga0075363_100014341
551 Ga0075363_100069613
552 Ga0075363_100136131
553 Ga0075363_100495954
554 Ga0075363_100596675
555 Ga0075364_10000234
556 Ga0075364_10077290
557 Ga0075432_10163310
558 Ga0070715_10225742
559 Ga0070715_10239062
560 Ga0070716_100007560
561 Ga0070716_100222708
562 Ga0070716_100279275
563 Ga0070716_100521102
564 Ga0070712_100009953
565 Ga0070712_100013437
566 Ga0070712_100050114
567 Ga0070712_100971515
568 Ga0075367_10054540
569 Ga0075369_10001288
570 Ga0075369_10011608
571 Ga0075369_10017858
572 Ga0075369_10033187
573 Ga0075369_10042309
574 Ga0075369_10210980
575 Ga0097621_100144689
576 Ga0068871_100870975
577 Ga0075428_100086149
578 Ga0075430_100185897
579 Ga0075430_100552476
580 Ga0075431_100084062
581 Ga0068865_100012022
582 Ga0068865_100366384
583 Ga0068865_100620449
584 Ga0068865_101196613
585 Ga0097620_100005722
586 Ga0097620_101625809
587 Ga0097620_101681174
588 Ga0105250_10070660
589 Ga0111539_10410530
590 Ga0111539_10860799
591 Ga0105245_10007406
592 Ga0105245_10398866
593 Ga0105247_10003220
594 Ga0105247_10227204
595 Ga0105247_10597969
596 Ga0114129_10052042
597 Ga0105243_10033352
598 Ga0105241_10151788
599 Ga0105242_10001104
600 Ga0105248_10010806
601 Ga0105248_10153551
602 Ga0105248_11235541
603 Ga0105237_10588047
604 Ga0105249_10000571
605 Ga0105249_10059665
606 Ga0105249_10137483
607 Ga0105249_11720535
608 Ga0099796_10003973
609 Ga0105239_10062405
610 Ga0105239_11012166
611 Ga0105246_10729884
612 Ga0157369_10488432
613 Ga0157378_10030839
614 Ga0163162_10151319
615 Ga0163162_10163330
616 Ga0163162_10543049
617 Ga0163162_11350696
618 Ga0157372_10208893
619 Ga0157372_11052004
620 Ga0157375_10005667
621 Ga0157375_10042543
622 Ga0157375_10426753
623 Ga0163163_10956220
624 Ga0157380_10017017
625 Ga0157380_10723406
626 Ga0157379_10018092
627 Ga0163161_10018132
628 Ga0207692_10007629
629 Ga0207642_10000205
630 Ga0207642_10004430
631 Ga0207710_10011183
632 Ga0207710_10216329
633 Ga0207688_10003825
634 Ga0207688_10004459
635 Ga0207688_10147166
636 Ga0207685_10028767
637 Ga0207699_10019740
638 Ga0207645_10061030
639 Ga0207654_10016336
640 Ga0207693_10000705
641 Ga0207693_10002182
642 Ga0207663_10012077
643 Ga0207663_10156414
644 Ga0207663_10474471
645 Ga0207681_10195745
646 Ga0207681_10245603
647 Ga0207694_10335555
648 Ga0207650_10607082
649 Ga0207659_10010437
650 Ga0207687_10002750
651 Ga0207700_10485417
652 Ga0207644_10022035
653 Ga0207644_10143843
654 Ga0207706_10052081
655 Ga0207706_10119370
656 Ga0207686_10004667
657 Ga0207670_10093770
658 Ga0207670_10568623
659 Ga0207669_10000318
660 Ga0207669_10013923
661 Ga0207669_10225459
662 Ga0207669_10497855
663 Ga0207704_10001564
664 Ga0207704_10333783
665 Ga0207665_10006323
666 Ga0207665_10025277
667 Ga0207665_10578646
668 Ga0207691_10073301
669 Ga0207691_10314959
670 Ga0207711_10450890
671 Ga0207711_10944554
672 Ga0207689_10008722
673 Ga0207689_10037220
674 Ga0207651_10976531
675 Ga0207712_10031697
676 Ga0207712_11054144
677 Ga0207668_10063791
678 Ga0207668_10126118
679 Ga0207668_10618420
680 Ga0207668_11043925
681 Ga0207640_10000920
682 Ga0207640_10221876
683 Ga0207640_10302518
684 Ga0207658_10208021
685 Ga0207677_10089110
686 Ga0207677_11093920
687 Ga0207703_10018029
688 Ga0207703_10218057
689 Ga0207639_10117959
690 Ga0207639_10273054
691 Ga0207678_10003485
692 Ga0207678_10039382
693 Ga0207678_10065341
694 Ga0207708_10003132
695 Ga0207708_10015051
696 Ga0207641_10004902
697 Ga0207648_10033020
698 Ga0207648_10294248
699 Ga0207676_10145975
700 Ga0207675_100000941
701 Ga0207675_100020330
702 Ga0207675_100022250
703 Ga0207683_10006869
704 Ga0207683_10027074
705 Ga0207683_10043502
706 Ga0207683_10661588
707 Ga0207698_10078765
708 Ga0207428_10175801
709 Ga0268266_10002908
710 Ga0268266_10033590
711 Ga0268265_10005537
712 Ga0268265_10141740
713 Ga0268265_10661622
714 Ga0268265_10946845
715 Ga0268265_11580412
716 Ga0268264_10004799
717 Ga0268264_10236976
718 Ga0268264_10631174
719 Ga0265327_10000081
720 Ga0265327_10009711
721 Ga0265327_10046265
722 Ga0316578_10235808
723 Ga0307413_10786408
724 Ga0307413_11107523
725 Ga0307406_10338895
726 Ga0307416_101507608
727 Ga0307414_10649774
728 Ga0373959_0029646
729 Ga0373932_0209813
730 Ga0373960_0081325
731 Ga0373931_0020790
732 Ga0436364_0610518
733 Ga0439461_0000435
734 Ga0439461_0006899
735 Ga0439465_0016274
736 Ga0439465_0060583
737 Ga0439431_0003883
738 Ga0439442_002369
739 Ga0439445_0001715
740 Ga0439445_0015111
741 Ga0439448_0086396
742 Ga0439435_0027625
743 Ga0466972_0020398
744 Ga0466965_0000977
745 Ga0466965_0084687
746 Ga0466963_0160430
747 Ga0466963_0170565
748 Ga0466964_0223531
749 Ga0466968_0001250
750 Ga0466968_0025389
751 Ga0466970_0011683
752 Ga0466970_0039512
753 Ga0466970_0105989
754 Ga0466957_0004000
755 Ga0466957_0050880
756 Ga0466960_0064038
757 Ga0466959_0008423
758 Ga0466959_0012199
759 Ga0466958_0033873
760 Ga0466967_0011056
761 Ga0466967_0070338
762 Ga0466967_0158661
763 Ga0466967_0220439
764 Ga0466967_1031798
765 Ga0495638_0030522
766 Ga0495582_0067322
767 Ga0495594_0123535
768 Ga0495630_0072647
769 Ga0495634_0176598
770 Ga0495588_0310130
771 Ga0495646_0307465
772 Ga0495581_0085003
773 Ga0495676_0130082
774 Ga0495686_0427572
775 Ga0496100_0034082
776 Ga0496100_0117842
777 Ga0496100_0529811
778 Ga0496101_0107635
779 Ga0496101_0160171
780 Ga0496101_0773091
781 Ga0496102_0003474
782 Ga0496102_0005951
783 Ga0496102_0324052
784 Ga0496102_0448203
785 Ga0496102_0984352
786 Ga0496103_0000932
787 Ga0496103_0157039
788 Ga0496103_0210841
789 Ga0496104_0117722
790 Ga0496104_0165521
791 Ga0496104_1584030
792 Ga0496105_0009686
793 Ga0496105_0072825
794 Ga0496106_0038341
795 Ga0496106_0371161
796 Ga0496107_0282360
797 Ga0496107_0507745
798 Ga0496108_0000404
799 Ga0496108_0010170
800 Ga0496108_0057461
801 Ga0496109_0000670
802 Ga0496109_0010226
803 Ga0496109_0137762
804 Ga0496109_0916073
805 Ga0496110_0097586
806 Ga0496110_0101964
807 Ga0496111_0064258
808 Ga0496111_0495234
809 Ga0496112_0042757
810 Ga0496112_0149106
811 Ga0496112_0150787
812 Ga0496112_0473131
813 Ga0496112_0806617
814 Ga0496112_1292041
815 Ga0496113_0025813
816 Ga0496113_0029053
817 Ga0496113_0104476
818 Ga0496113_0394308
819 Ga0496114_0002700
820 Ga0496114_0186370
821 Ga0496114_1071886
822 Ga0496115_0020339
823 Ga0496115_0154914
824 Ga0496118_0234103
825 Ga0496122_0024627
826 Ga0496123_0027858
827 Ga0496126_0006189
828 Ga0496126_0046596
829 Ga0501034_0002996
830 Ga0501034_0077942
831 Ga0501034_0193083
832 Ga0501034_0421466
833 Ga0501036_0009512
834 Ga0501037_0005727
835 Ga0501039_0001425
836 Ga0501043_0000337
837 Ga0501047_0126125
838 Ga0501069_0123966
839 Ga0501070_0000642
840 Ga0501070_0619002
841 Ga0501073_0016559
842 Ga0501077_0133252
843 Ga0501035_0709301
844 Ga0501044_0033874
845 nmdc:mga03n38_106480_c1
846 nmdc:mga03n38_155546_c1
847 nmdc:mga03n38_20873_c1
848 nmdc:mga03n38_209360_c1
849 nmdc:mga03n38_321260_c1
850 nmdc:mga03n38_36659_c1
851 nmdc:mga00v17_1257_c1
852 nmdc:mga00v17_173747_c1
853 nmdc:mga00v17_466921_c1
854 nmdc:mga0yw44_151119_c1
855 nmdc:mga0yw44_91731_c1
856 nmdc:mga06z11_13411_c1
857 nmdc:mga06z11_529824_c1
858 nmdc:mga07m45_281396_c1
859 nmdc:mga07m45_595181_c1
860 nmdc:mga07m45_64201_c1
861 nmdc:mga05p37_265221_c1
862 nmdc:mga0qj67_290122_c1
863 nmdc:mga06r32_107381_c1
864 nmdc:mga08y16_322456_c1
865 nmdc:mga0sz30_111697_c1
866 nmdc:mga0sz30_15713_c1
867 nmdc:mga0sz30_2044_c1
868 nmdc:mga0sz30_32690_c1
869 nmdc:mga0sz30_3453_c1
870 nmdc:mga0sz30_53647_c1
871 Ga0500610_0007360
872 Ga0500635_0000430
873 Ga0495655_0058462
874 Ga0495619_0300140
875 Ga0500646_0136256
876 Ga0500556_0025950
877 Ga0500562_005041
878 Ga0500652_000985
879 Ga0500652_022549
880 Ga0500616_0009492
881 Ga0500627_0017750
882 Ga0500645_000030
883 Ga0500645_128235
884 Ga0466962_0014155
885 2738665132
886 2738707620
887 2739144266
888 2739332632
889 2902801034
890 2902814944
891 2929215509
892 2946080801

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

39

85

0.96

PF02909

TetR_C_1

Tetracyclin repressor-like, C-terminal domain

91

219

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yek-assembly1.cif.gz_B crystal structure of bioq 0.9811 1 185
5xs9-assembly1.cif.gz_B crystal structure of mycobacterium smegmatis bioq 0.9728 3 187
5yek-assembly1.cif.gz_B crystal structure of bioq 0.9695 1 185
5yek-assembly1.cif.gz_A crystal structure of bioq 0.9641 2 187
5xs9-assembly1.cif.gz_B crystal structure of mycobacterium smegmatis bioq 0.9618 3 187
ID Description Score Start End Superfamily
3fiwB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 1.002 4 53 1.10.10.60
3fiwD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9967 4 53 1.10.10.60
3fiwA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9769 3 53 1.10.10.60
2y2zA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.968 3 57 1.10.10.60
3zqiA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9616 3 60 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A1S1N1U4-F1-model_v4 TetR family transcriptional regulator 0.9901 1 146 GO:0000976
GO:0003700
GO:0045892
GO:0046677
GO:0046872
AF-A0A7I7SZ01-F1-model_v4 HTH tetR-type domain-containing protein 0.9814 1 188 GO:0000976
GO:0003700
GO:0045892
GO:0046677
GO:0046872
AF-A0A1S1N1U4-F1-model_v4 TetR family transcriptional regulator 0.9703 1 146 GO:0000976
GO:0003700
GO:0045892
GO:0046677
GO:0046872
AF-A0A5N0IDE0-F1-model_v4 TetR family transcriptional regulator 0.9452 1 196 GO:0000976
GO:0003700
GO:0045892
GO:0046677
GO:0046872
AF-A0A1S1L3F5-F1-model_v4 TetR family transcriptional regulator 0.9452 2 190 GO:0000976
GO:0003700
GO:0045892
GO:0046677
GO:0046872

Map