F445643

General Info

Members Datasets Scaffolds Average Seq Length
446 372 892 226

Family's Representative Sequence

Representative Sequence 3300003763|Ga0055529_1002810|Ga0055529_10028102
Length 239
Sequence MSNMTSLGLQSDGCRLGFGDIEEALAVHGLVLRGGFNFATDEAPPLGLSGAPAKSVLLVGQAGAAPWPHFLRWREQQPSTITNPLDSWSRQVIGDVAEAFGARAVSPSDKPYLPFQQWAMRAEGLKPSPLGILMHPQYGLWHAYRGALLFEDEIALPEHGEAVHLCDACVEKPCLKSCPVDAYSRAGFAYQACLAHVRGGNGEPCRSGGCLDRNACPYGTEYRYPPDVQAFHMAAFADP

Samples

Sample ID Description Type Environment
1 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
13 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
15 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
32 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
33 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
34 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
35 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
36 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
38 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
39 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
41 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
57 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
58 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
59 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
60 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
61 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
62 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
63 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
64 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
65 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
66 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
67 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
68 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
69 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
70 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
71 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
72 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
73 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
74 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
75 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
76 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
77 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
89 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
90 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
91 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
92 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
93 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
94 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
95 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
96 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
98 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
99 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
100 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
101 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
102 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
103 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
104 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
105 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
106 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
107 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
108 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
109 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
110 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
111 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
112 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
113 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
114 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
115 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
116 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
117 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
118 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
119 2512875024
120 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
121 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
122 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
123 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
124 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
125 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
126 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
127 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
128 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
129 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
130 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
131 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
132 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
133 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
134 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
135 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
136 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
137 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
138 2738543024 Aminobacter sp. AP02 Isolate Unclassified
139 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
140 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
141 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
142 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
143 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
144 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
145 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
146 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
147 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
148 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
149 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
150 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
151 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
152 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
153 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
154 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
155 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
156 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
157 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
158 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
159 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
160 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
161 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
162 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
163 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
164 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
165 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
166 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
167 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
168 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
169 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
170 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
171 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
172 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
173 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
174 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
175 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
176 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
177 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
178 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
179 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
180 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
181 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
182 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
183 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
184 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
185 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
186 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
187 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
188 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
189 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
190 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
191 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
192 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
193 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
194 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
195 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
196 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
197 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
198 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
199 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
200 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
201 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
202 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
203 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
204 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
205 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
206 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
207 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
208 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
209 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
210 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
211 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
212 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
213 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
214 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
215 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
216 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
217 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
218 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
219 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
220 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
221 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
222 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
223 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
224 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
225 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
226 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
227 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
228 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
229 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
230 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
231 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
232 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
233 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
234 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
235 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
236 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
237 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
238 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
239 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
240 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
241 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
242 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
243 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
244 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
245 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
246 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
247 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
248 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
249 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
250 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
251 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
252 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
253 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
254 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
255 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
256 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
257 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
258 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
259 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
260 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
261 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
262 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
263 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
264 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
265 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
266 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
267 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
268 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
269 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
270 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
271 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
272 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
273 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
274 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
275 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
276 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
277 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
278 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
279 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
280 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
281 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
282 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
283 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
284 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
285 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
286 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
287 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
288 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
289 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
290 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
291 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
292 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
293 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
294 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
295 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
296 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
297 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
298 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
299 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
300 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
301 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
302 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
303 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
304 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
305 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
306 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
307 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
308 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
309 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
310 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
311 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
312 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
313 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
314 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
315 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
316 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
317 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
318 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
319 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
320 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
321 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
322 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
323 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
324 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
325 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
326 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
327 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
328 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
329 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
330 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
331 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
332 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
333 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
334 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
335 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
336 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
337 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
338 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
339 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
340 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
341 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
342 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
343 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
344 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
345 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
346 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
347 3004167301 Mesorhizobium loti 582 Isolate Unclassified
348 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
349 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
350 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
351 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
352 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
353 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
354 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
355 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
356 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
357 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
358 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
359 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
360 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
361 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
362 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
363 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
364 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
365 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
366 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
367 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
368 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
369 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
370 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
371 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
372 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 41.03
Metatranscriptomes 0
Isolates 58.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.31
Nodule 50
Rhizoplane 1.12
Rhizosphere 28.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055529_1002810 3300003763 Bacteria 3151
2 JGI25157J39369_1001938 3300002741 Bacteria 6196
3 JGI25406J46586_10012533 3300003203 Bacteria 3674
4 JGI25165J46597_1000062 3300003214 Bacteria 206459
5 Ga0070658_10448411 3300005327 Bacteria 1111
6 Ga0070660_100045304 3300005339 Bacteria 3366
7 Ga0070674_100101659 3300005356 Bacteria 2096
8 Ga0070663_100017854 3300005455 Bacteria 4638
9 Ga0070663_100076265 3300005455 Bacteria 2451
10 Ga0068853_100001788 3300005539 Bacteria 15811
11 Ga0068853_100156408 3300005539 Bacteria 2054
12 Ga0070665_100033628 3300005548 Bacteria 5158
13 Ga0070665_100083099 3300005548 Bacteria 3207
14 Ga0070665_100576783 3300005548 Bacteria 1138
15 Ga0068856_100283421 3300005614 Bacteria 1674
16 Ga0068852_100150265 3300005616 Bacteria 2165
17 Ga0081539_10001801 3300005985 Bacteria 33917
18 Ga0075365_10007380 3300006038 Bacteria 6150
19 Ga0075365_10030393 3300006038 Bacteria 3459
20 Ga0075365_10061779 3300006038 Bacteria 2503
21 Ga0075365_10162745 3300006038 Bacteria 1555
22 Ga0075365_10173237 3300006038 Bacteria 1507
23 Ga0075368_10021418 3300006042 Bacteria 2455
24 Ga0075363_100021082 3300006048 Bacteria 3277
25 Ga0075364_10241245 3300006051 Bacteria 1228
26 Ga0075362_10132788 3300006177 Bacteria 1185
27 Ga0075367_10029548 3300006178 Bacteria 3136
28 Ga0075367_10155103 3300006178 Bacteria 1422
29 Ga0075367_10164170 3300006178 Bacteria 1381
30 Ga0075369_10008246 3300006186 Bacteria 4004
31 Ga0075370_10079440 3300006353 Bacteria 1884
32 Ga0075370_10277295 3300006353 Bacteria 996
33 Ga0105240_10038269 3300009093 Bacteria 6154
34 Ga0105240_10327369 3300009093 Bacteria 1745
35 Ga0105240_10561002 3300009093 Bacteria 1262
36 Ga0105241_10189420 3300009174 Bacteria 1711
37 Ga0105241_10428409 3300009174 Bacteria 1166
38 Ga0105237_10004482 3300009545 Bacteria 16141
39 Ga0105237_10093868 3300009545 Bacteria 2990
40 Ga0105238_10230556 3300009551 Bacteria 1829
41 Ga0105249_10546499 3300009553 Bacteria 1208
42 Ga0105239_10004313 3300010375 Bacteria 17054
43 Ga0105239_10171453 3300010375 Bacteria 2426
44 Ga0105239_10181399 3300010375 Bacteria 2355
45 Ga0105239_10295948 3300010375 Bacteria 1822
46 Ga0105239_10493886 3300010375 Bacteria 1391
47 Ga0105239_10793480 3300010375 Bacteria 1085
48 Ga0105239_10877094 3300010375 Bacteria 1029
49 Ga0157369_10129607 3300013105 Bacteria 2673
50 Ga0157374_10263953 3300013296 Bacteria 1697
51 Ga0157372_10178625 3300013307 Bacteria 2457
52 Ga0157372_10565767 3300013307 Bacteria 1325
53 Ga0157380_10863776 3300014326 Bacteria 928
54 Ga0182008_10030913 3300014497 Bacteria 2697
55 Ga0157379_10525862 3300014968 Bacteria 1098
56 Ga0182006_1032404 3300015261 Bacteria 2100
57 Ga0209026_1000024 3300025250 Bacteria 355839
58 Ga0209148_1000050 3300025254 Bacteria 413178
59 Ga0209759_1000057 3300025256 Bacteria 205181
60 Ga0209233_1000129 3300025261 Bacteria 206511
61 Ga0209233_1023811 3300025261 Bacteria 1543
62 Ga0209455_1000228 3300025272 Bacteria 74611
63 Ga0209025_1055015 3300025294 Bacteria 1543
64 Ga0207647_10037903 3300025904 Bacteria 3052
65 Ga0207647_10039944 3300025904 Bacteria 2958
66 Ga0207695_10481868 3300025913 Bacteria 1123
67 Ga0207671_10061524 3300025914 Bacteria 2786
68 Ga0207671_10103174 3300025914 Bacteria 2162
69 Ga0207657_10071766 3300025919 Bacteria 2931
70 Ga0207694_10251672 3300025924 Bacteria 1446
71 Ga0207687_10239881 3300025927 Bacteria 1436
72 Ga0207669_10029207 3300025937 Bacteria 3046
73 Ga0207667_10212212 3300025949 Bacteria 1984
74 Ga0207667_10858853 3300025949 Bacteria 901
75 Ga0207639_10105365 3300026041 Bacteria 2288
76 Ga0207678_10031158 3300026067 Bacteria 4652
77 Ga0207678_10082803 3300026067 Bacteria 2745
78 Ga0207702_10190074 3300026078 Bacteria 1896
79 Ga0207702_10368583 3300026078 Bacteria 1378
80 Ga0207648_10254837 3300026089 Bacteria 1565
81 Ga0207698_10475501 3300026142 Bacteria 1211
82 Ga0209813_10038725 3300027866 Bacteria 1442
83 Ga0268266_10034604 3300028379 Bacteria 4296
84 Ga0268266_10071653 3300028379 Bacteria 3004
85 Ga0395899_0442210 3300037312 Bacteria 853
86 Ga0395900_0040567 3300037418 Bacteria 4797
87 Ga0395900_0074617 3300037418 Bacteria 3487
88 Ga0395900_0090102 3300037418 Bacteria 3153
89 Ga0395900_0142426 3300037418 Bacteria 2454
90 Ga0395900_0163404 3300037418 Bacteria 2270
91 Ga0395900_0338621 3300037418 Bacteria 1480
92 Ga0395898_0373839 3300037466 Bacteria 1359
93 Ga0395905_0100843 3300037471 Bacteria 2711
94 Ga0395905_0229231 3300037471 Bacteria 1737
95 Ga0395905_0360317 3300037471 Bacteria 1347
96 Ga0395901_0144560 3300038443 Bacteria 2500
97 Ga0395901_0144571 3300038443 Bacteria 2500
98 Ga0395901_0314792 3300038443 Bacteria 1620
99 Ga0395901_0345771 3300038443 Bacteria 1536
100 Ga0466972_0072875 3300044658 Bacteria 1637
101 Ga0466972_0105236 3300044658 Bacteria 1334
102 Ga0466970_0224946 3300044765 Bacteria 1048
103 Ga0495638_0007770 3300046460 Bacteria 7657
104 Ga0495620_0143671 3300046515 Bacteria 932
105 Ga0495643_0078921 3300046522 Bacteria 1717
106 Ga0495668_0123585 3300046616 Bacteria 1416
107 Ga0495625_0017610 3300046660 Bacteria 5591
108 Ga0495625_0304784 3300046660 Bacteria 1018
109 Ga0495660_0109167 3300046810 Bacteria 1414
110 Ga0495686_0085469 3300047472 Bacteria 1921
111 Ga0495686_0146216 3300047472 Bacteria 1391
112 Ga0496108_0239349 3300048911 Bacteria 1579
113 Ga0496112_0020064 3300048915 Bacteria 6328
114 Ga0496114_0333670 3300048917 Bacteria 1341
115 Ga0496119_0053952 3300048922 Bacteria 2451
116 Ga0496120_0004141 3300048923 Bacteria 12478
117 Ga0496125_0090343 3300048928 Bacteria 2299
118 Ga0496126_0119031 3300048929 Bacteria 2292
119 Ga0496126_0164620 3300048929 Bacteria 1893
120 Ga0501031_0290092 3300049568 Bacteria 1061
121 Ga0501032_0061745 3300049569 Bacteria 2512
122 Ga0501032_0199410 3300049569 Bacteria 1306
123 Ga0501033_0032239 3300049570 Bacteria 3935
124 Ga0501034_0029726 3300049571 Bacteria 5555
125 Ga0501034_0046497 3300049571 Bacteria 4384
126 Ga0501034_0072996 3300049571 Bacteria 3440
127 Ga0501034_0250120 3300049571 Bacteria 1717
128 Ga0501036_0350045 3300049572 Bacteria 1233
129 Ga0501037_0197127 3300049573 Bacteria 1424
130 Ga0501038_0218986 3300049574 Bacteria 1519
131 Ga0501039_0108312 3300049575 Bacteria 2171
132 Ga0501043_0036037 3300049579 Bacteria 3891
133 Ga0501043_0174463 3300049579 Bacteria 1676
134 Ga0501043_0318699 3300049579 Bacteria 1185
135 Ga0501046_0040925 3300049580 Bacteria 3700
136 Ga0501047_0043453 3300049581 Bacteria 4341
137 Ga0501047_0070306 3300049581 Bacteria 3370
138 Ga0501047_0317205 3300049581 Bacteria 1399
139 Ga0501069_0094000 3300049585 Bacteria 1697
140 Ga0501070_0002166 3300049586 Bacteria 17252
141 Ga0501070_0068696 3300049586 Bacteria 2933
142 Ga0501070_0197554 3300049586 Bacteria 1652
143 Ga0501072_0288651 3300049588 Bacteria 1304
144 Ga0501073_0132263 3300049589 Bacteria 1729
145 Ga0501074_0025071 3300049590 Bacteria 4333
146 Ga0501079_0086507 3300049741 Bacteria 2426
147 Ga0501080_0002010 3300049742 Bacteria 17571
148 Ga0501080_0046124 3300049742 Bacteria 4059
149 Ga0501083_0300274 3300049744 Bacteria 1044
150 Ga0501035_0004171 3300049822 Bacteria 13736
151 Ga0501035_0014759 3300049822 Bacteria 7213
152 Ga0501035_0016289 3300049822 Bacteria 6857
153 Ga0501035_0019269 3300049822 Bacteria 6280
154 Ga0501035_0121284 3300049822 Bacteria 2285
155 Ga0501044_0011679 3300049823 Bacteria 9518
156 Ga0501044_0013502 3300049823 Bacteria 8833
157 Ga0501044_0095900 3300049823 Bacteria 2988
158 Ga0501044_0250372 3300049823 Bacteria 1713
159 Ga0501044_0501892 3300049823 Bacteria 1114
160 nmdc:mga03n38_31394_c1 3300050490 Bacteria 2242
161 nmdc:mga00v17_184007_c1 3300050491 Bacteria 1348
162 nmdc:mga0yw44_153540_c1 3300050492 Bacteria 1503
163 nmdc:mga0yw44_24032_c1 3300050492 Bacteria 3442
164 nmdc:mga0yw44_268436_c1 3300050492 Bacteria 1139
165 nmdc:mga0yw44_421844_c1 3300050492 Bacteria 903
166 nmdc:mga0yw44_5682_c1 3300050492 Bacteria 5936
167 nmdc:mga0yw44_634693_c1 3300050492 Bacteria 726
168 nmdc:mga06z11_187114_c1 3300050494 Bacteria 1197
169 nmdc:mga06z11_250790_c1 3300050494 Bacteria 1042
170 nmdc:mga06z11_75516_c1 3300050494 Bacteria 1795
171 nmdc:mga04h51_12555_c1 3300050495 Bacteria 2380
172 nmdc:mga07m45_14456_c1 3300050496 Bacteria 4204
173 nmdc:mga0sz30_56689_c2 3300050516 Bacteria 1132
174 nmdc:mga0sz30_8408_c1 3300050516 Bacteria 3898
175 Ga0495655_0022963 3300053083 Bacteria 1432
176 Ga0500643_012203 3300053087 Bacteria 3086
177 Ga0500658_0025382 3300053134 Bacteria 2277
178 Ga0500568_0000283 3300053139 Bacteria 42124
179 Ga0500604_0019344 3300053151 Bacteria 1906
180 Ga0500604_0044741 3300053151 Bacteria 1349
181 Ga0500616_0096599 3300053153 Bacteria 1452
182 Ga0500620_000068 3300053155 Bacteria 19837
183 Ga0500620_115955 3300053155 Bacteria 938
184 2503201901 2503198000 Bacteria 6884444
185 2509118119 2508501123 Bacteria 6283661
186 2509144156 2508501127 Bacteria 7037543
187 2509367558 2509276018 Bacteria 6910194
188 2509396578 2509276022 Bacteria 6200534
189 2510313657 2510065059 Bacteria 6847884
190 2512931205 2512875016 Bacteria 6529530
191 2512959025 2512875024 Bacteria 7195110
192 2513610835 2513237090 Bacteria 7096802
193 2514038304 2513237164 Bacteria 7563725
194 2514420150 2513237305 Bacteria 7293571
195 2514589035 2513237351 Bacteria 6968952
196 2588516985 2588253730 Bacteria 6881675
197 2597813471 2597489875 Bacteria 7010078
198 2599938452 2599185301 Bacteria 6161860
199 2643773141 2643221550 Bacteria 4619371
200 2643775869 2643221551 Bacteria 3750538
201 2643794316 2643221555 Bacteria 3749717
202 2643839864 2643221564 Bacteria 4193379
203 2643984662 2643221595 Bacteria 6565519
204 2644129148 2643221623 Bacteria 5239945
205 2644158514 2643221627 Bacteria 6761570
206 2688598714 2687453392 Bacteria 6880454
207 2694633200 2693429783 Bacteria 7019804
208 2694638227 2693429784 Bacteria 7241525
209 2723575665 2721755686 Bacteria 7343952
210 2739308244 2738543024 Bacteria 5603683
211 2756675965 2756170246 Bacteria 7451806
212 2770195302 2767802442 Bacteria 5747986
213 2776270753 2775506902 Bacteria 6208009
214 2776280424 2775506904 Bacteria 5954060
215 2792749525 2791355123 Bacteria 8049106
216 2840767554 2840764183 Bacteria 6358399
217 2841739548 2841734538 Bacteria 6784580
218 2844007143 2844002411 Bacteria 7168230
219 2844014019 2844009547 Bacteria 6728125
220 2847675864 2847670302 Bacteria 6165597
221 2847692509 2847686936 Bacteria 6278406
222 2856314592 2856314179 Bacteria 6477897
223 2856325532 2856320880 Bacteria 7263508
224 2856331370 2856328259 Bacteria 6528202
225 2856339350 2856334872 Bacteria 7037011
226 2856347327 2856342000 Bacteria 7176905
227 2856355271 2856349417 Bacteria 6230045
228 2856362666 2856356410 Bacteria 6297484
229 2856370415 2856364286 Bacteria 6939991
230 2857350799 2857349434 Bacteria 7926032
231 2857373844 2857367948 Bacteria 6965560
232 2869168903 2869162929 Bacteria 6399702
233 2869172656 2869169390 Bacteria 6659796
234 2869240005 2869234852 Bacteria 6654993
235 2869255000 2869249662 Bacteria 6868783
236 2869264088 2869256925 Bacteria 6981691
237 2869265930 2869264136 Bacteria 6880765
238 2869272413 2869271264 Bacteria 6908218
239 2869291858 2869285874 Bacteria 6901219
240 2871435067 2871429161 Bacteria 6547891
241 2871440231 2871435913 Bacteria 6880295
242 2871447538 2871444079 Bacteria 6423508
243 2871452244 2871451962 Bacteria 7336357
244 2871463212 2871459585 Bacteria 6866887
245 2871468384 2871466892 Bacteria 6923287
246 2871474763 2871474448 Bacteria 6806570
247 2871486644 2871481445 Bacteria 6700002
248 2871491262 2871488783 Bacteria 6929816
249 2871502968 2871495908 Bacteria 6935695
250 2874102546 2874102143 Bacteria 6342645
251 2874116173 2874109183 Bacteria 6517025
252 2874123190 2874116593 Bacteria 6674494
253 2874123770 2874123672 Bacteria 7238285
254 2874132482 2874131515 Bacteria 6820270
255 2874149458 2874146452 Bacteria 7533118
256 2874157721 2874155637 Bacteria 6724144
257 2874164361 2874162495 Bacteria 6174670
258 2874174521 2874168670 Bacteria 8062617
259 2876369263 2876363079 Bacteria 6544991
260 2876370142 2876369609 Bacteria 6807521
261 2876392457 2876386047 Bacteria 6698674
262 2876394513 2876392853 Bacteria 6660880
263 2876405917 2876399893 Bacteria 6927900
264 2876407225 2876406927 Bacteria 6191900
265 2876415924 2876413966 Bacteria 6831344
266 2876427516 2876420981 Bacteria 6687741
267 2878039935 2878035449 Bacteria 6555736
268 2878734692 2878730984 Bacteria 6380721
269 2878745540 2878738818 Bacteria 7136951
270 2878752202 2878745973 Bacteria 6867388
271 2878757697 2878753008 Bacteria 6922523
272 2878766860 2878760144 Bacteria 6823465
273 2878774057 2878767105 Bacteria 6898628
274 2878777375 2878774303 Bacteria 6108671
275 2878788429 2878781027 Bacteria 6834456
276 2878795392 2878788777 Bacteria 6567085
277 2881151804 2881147464 Bacteria 7779814
278 2881155585 2881155292 Bacteria 6461656
279 2881852036 2881845957 Bacteria 6611900
280 2881856806 2881853255 Bacteria 6698367
281 2881866647 2881861095 Bacteria 7128710
282 2882636550 2882632389 Bacteria 8154593
283 2882916224 2882912400 Bacteria 6801539
284 2885309709 2885305155 Bacteria 7348390
285 2885317717 2885312484 Bacteria 6415165
286 2885320145 2885318864 Bacteria 6729568
287 2885342057 2885334103 Bacteria 7216818
288 2885349815 2885342637 Bacteria 7011821
289 2885354344 2885350715 Bacteria 6787678
290 2888339711 2888337043 Bacteria 6629336
291 2888347080 2888343758 Bacteria 6611049
292 2888356046 2888350351 Bacteria 7372807
293 2889017330 2889016732 Bacteria 6700763
294 2903455325 2903448605 Bacteria 7357801
295 2903493240 2903492973 Bacteria 13473544
296 2903506372 2903492973 Bacteria 13473544
297 2903516462 2903513507 Bacteria 6344008
298 2903523130 2903521522 Bacteria 6525694
299 2903534410 2903528002 Bacteria 6586099
300 2903548107 2903540706 Bacteria 7062119
301 2904661147 2904659560 Bacteria 6685615
302 2906314596 2906308376 Bacteria 6841989
303 2906327764 2906321335 Bacteria 6579571
304 2906329760 2906328253 Bacteria 6585166
305 2906359220 2906354277 Bacteria 6991324
306 2906370632 2906363423 Bacteria 6856682
307 2906390591 2906386501 Bacteria 5977019
308 2906395352 2906393657 Bacteria 6790866
309 2906401798 2906401398 Bacteria 6693206
310 2906412191 2906408224 Bacteria 6162342
311 2906414545 2906414383 Bacteria 6580790
312 2922151395 2922151315 Bacteria 6902399
313 2922158632 2922158528 Bacteria 6573167
314 2922174526 2922172374 Bacteria 6167644
315 2922192913 2922185730 Bacteria 7113964
316 2924723042 2924718760 Bacteria 6331356
317 2924731990 2924726620 Bacteria 6271473
318 2924739445 2924733363 Bacteria 7574837
319 2924744383 2924741084 Bacteria 6661321
320 2924753967 2924748358 Bacteria 6154725
321 2924759651 2924754689 Bacteria 6774424
322 2924764144 2924762789 Bacteria 6561353
323 2924783784 2924776078 Bacteria 7492003
324 2924789365 2924784321 Bacteria 7416538
325 2937816101 2937813078 Bacteria 7783518
326 2937824762 2937822353 Bacteria 7290551
327 2937838260 2937836603 Bacteria 6811263
328 2937852901 2937848649 Bacteria 6983481
329 2937863426 2937861824 Bacteria 6660327
330 2937880485 2937877337 Bacteria 7246526
331 2937893695 2937891427 Bacteria 6357007
332 2937975576 2937972304 Bacteria 7532020
333 2937983610 2937980651 Bacteria 6517427
334 2938001983 2937994558 Bacteria 7036190
335 2958040926 2958034702 Bacteria 6989922
336 2958048301 2958041894 Bacteria 13082850
337 2958057008 2958041894 Bacteria 13082850
338 2958067698 2958064165 Bacteria 7158582
339 2958072961 2958071322 Bacteria 6815895
340 2958087619 2958084443 Bacteria 7312792
341 2958093482 2958092219 Bacteria 6861151
342 2958106865 2958100919 Bacteria 6800575
343 2958111621 2958108152 Bacteria 6681128
344 2958118705 2958115193 Bacteria 6923548
345 2958125799 2958122699 Bacteria 7280457
346 2958136256 2958130278 Bacteria 6897202
347 2958144050 2958137437 Bacteria 6050276
348 2958145310 2958144490 Bacteria 6677056
349 2958164753 2958158011 Bacteria 6058449
350 2958172038 2958165035 Bacteria 6906348
351 2958185724 2958179912 Bacteria 6874908
352 2961084101 2961077736 Bacteria 7079850
353 2961116298 2961114664 Bacteria 6680456
354 2961133815 2961127735 Bacteria 7196641
355 2961142660 2961136820 Bacteria 6775228
356 2961170484 2961163497 Bacteria 6901077
357 2961174240 2961170736 Bacteria 7072258
358 2961184592 2961183825 Bacteria 6688536
359 2963648014 2963644680 Bacteria 6530403
360 2965025230 2965018300 Bacteria 6883036
361 2965026428 2965025482 Bacteria 6532201
362 2965038004 2965032056 Bacteria 6887443
363 2965041615 2965040258 Bacteria 6855979
364 2965053315 2965047637 Bacteria 6623551
365 2965065500 2965062239 Bacteria 7412989
366 2965113907 2965110997 Bacteria 6693150
367 2965119629 2965119406 Bacteria 6956431
368 2968000187 2967996073 Bacteria 6787468
369 2968005541 2968003550 Bacteria 6929263
370 2968018154 2968016561 Bacteria 7022047
371 2968090835 2968083720 Bacteria 7351627
372 2968096520 2968091066 Bacteria 6052692
373 2968098990 2968097103 Bacteria 6107094
374 2968112204 2968110612 Bacteria 6814636
375 2968120967 2968117919 Bacteria 6536078
376 2968132571 2968128360 Bacteria 6270294
377 2968146015 2968138860 Bacteria 6605449
378 2968178871 2968171901 Bacteria 6894245
379 2970471672 2970469710 Bacteria 6969209
380 2970495616 2970489779 Bacteria 6517260
381 2970506827 2970503327 Bacteria 7099517
382 2970517694 2970510686 Bacteria 7006402
383 2970530597 2970524798 Bacteria 6840927
384 2970532998 2970532167 Bacteria 6553173
385 2970545999 2970540015 Bacteria 6977556
386 2970549353 2970547951 Bacteria 6931819
387 2970561716 2970554993 Bacteria 6814252
388 2970599838 2970593180 Bacteria 7073582
389 2970619574 2970619444 Bacteria 6986144
390 2970633625 2970627176 Bacteria 6680862
391 2977822229 2977821940 Bacteria 6906439
392 2977835092 2977828996 Bacteria 7007971
393 2977846337 2977843712 Bacteria 6753583
394 2977857084 2977851361 Bacteria 6694324
395 2977860436 2977858184 Bacteria 6215359
396 2977877417 2977872689 Bacteria 7270173
397 2977901938 2977898635 Bacteria 6675551
398 2977921424 2977915119 Bacteria 6829656
399 2977924518 2977922695 Bacteria 6956781
400 2977941366 2977935797 Bacteria 6252826
401 2977947499 2977942078 Bacteria 7570577
402 2977951194 2977950692 Bacteria 6893264
403 2977960103 2977957713 Bacteria 6877875
404 2977988324 2977986579 Bacteria 6581278
405 2979714518 2979710463 Bacteria 6785254
406 2979769823 2979764755 Bacteria 6610066
407 2979773776 2979772303 Bacteria 6618277
408 2979785037 2979779861 Bacteria 6219781
409 2979797206 2979793036 Bacteria 6808957
410 2979812022 2979808191 Bacteria 7179355
411 2987637984 2987636660 Bacteria 8088555
412 2987651374 2987645492 Bacteria 6117018
413 2987655898 2987652177 Bacteria 6969023
414 2987666725 2987659509 Bacteria 6966464
415 2987668951 2987666974 Bacteria 6509233
416 2996341002 2996336353 Bacteria 5511628
417 2996347368 2996341866 Bacteria 6643098
418 2996350457 2996348954 Bacteria 7239054
419 2996389939 2996386984 Bacteria 6978667
420 3000140317 3000135777 Bacteria 6891109
421 3004169203 3004167301 Bacteria 8330599
422 3004195727 3004188549 Bacteria 6952365
423 3004205694 3004203850 Bacteria 7307914
424 3004216251 3004211236 Bacteria 7417683
425 3004224001 3004218560 Bacteria 7421728
426 3004235100 3004232784 Bacteria 6662140
427 3004248542 3004248173 Bacteria 6563236
428 3004269641 3004268573 Bacteria 7043476
429 3004277155 3004275668 Bacteria 7114440
430 3004341415 3004334049 Bacteria 8449246
431 637074307 637000159 Bacteria 7596297
432 649873231 649633066 Bacteria 6690028
433 8002288792 8002285264 Bacteria 6717907
434 8004306644 8004300914 Bacteria 6132239
435 8004317750 8004312739 Bacteria 7444653
436 8004362650 8004361976 Bacteria 6858373
437 8004379208 8004374579 Bacteria 6898112
438 8004394416 8004387939 Bacteria 7049250
439 8004396579 8004395343 Bacteria 6620908
440 8004451062 8004445564 Bacteria 6322258
441 8004634877 8004633249 Bacteria 6723080
442 8004640533 8004640170 Bacteria 6723001
443 8004709607 8004703790 Bacteria 8006957
444 8004720857 8004714634 Bacteria 6776161
445 8004731939 8004727605 Bacteria 6643904
446 8055621043 8055617313 Bacteria 7548464
447 Ga0055529_1002810
448 JGI25157J39369_1001938
449 JGI25406J46586_10012533
450 JGI25165J46597_1000062
451 Ga0070658_10448411
452 Ga0070660_100045304
453 Ga0070674_100101659
454 Ga0070663_100017854
455 Ga0070663_100076265
456 Ga0068853_100001788
457 Ga0068853_100156408
458 Ga0070665_100033628
459 Ga0070665_100083099
460 Ga0070665_100576783
461 Ga0068856_100283421
462 Ga0068852_100150265
463 Ga0081539_10001801
464 Ga0075365_10007380
465 Ga0075365_10030393
466 Ga0075365_10061779
467 Ga0075365_10162745
468 Ga0075365_10173237
469 Ga0075368_10021418
470 Ga0075363_100021082
471 Ga0075364_10241245
472 Ga0075362_10132788
473 Ga0075367_10029548
474 Ga0075367_10155103
475 Ga0075367_10164170
476 Ga0075369_10008246
477 Ga0075370_10079440
478 Ga0075370_10277295
479 Ga0105240_10038269
480 Ga0105240_10327369
481 Ga0105240_10561002
482 Ga0105241_10189420
483 Ga0105241_10428409
484 Ga0105237_10004482
485 Ga0105237_10093868
486 Ga0105238_10230556
487 Ga0105249_10546499
488 Ga0105239_10004313
489 Ga0105239_10171453
490 Ga0105239_10181399
491 Ga0105239_10295948
492 Ga0105239_10493886
493 Ga0105239_10793480
494 Ga0105239_10877094
495 Ga0157369_10129607
496 Ga0157374_10263953
497 Ga0157372_10178625
498 Ga0157372_10565767
499 Ga0157380_10863776
500 Ga0182008_10030913
501 Ga0157379_10525862
502 Ga0182006_1032404
503 Ga0209026_1000024
504 Ga0209148_1000050
505 Ga0209759_1000057
506 Ga0209233_1000129
507 Ga0209233_1023811
508 Ga0209455_1000228
509 Ga0209025_1055015
510 Ga0207647_10037903
511 Ga0207647_10039944
512 Ga0207695_10481868
513 Ga0207671_10061524
514 Ga0207671_10103174
515 Ga0207657_10071766
516 Ga0207694_10251672
517 Ga0207687_10239881
518 Ga0207669_10029207
519 Ga0207667_10212212
520 Ga0207667_10858853
521 Ga0207639_10105365
522 Ga0207678_10031158
523 Ga0207678_10082803
524 Ga0207702_10190074
525 Ga0207702_10368583
526 Ga0207648_10254837
527 Ga0207698_10475501
528 Ga0209813_10038725
529 Ga0268266_10034604
530 Ga0268266_10071653
531 Ga0395899_0442210
532 Ga0395900_0040567
533 Ga0395900_0074617
534 Ga0395900_0090102
535 Ga0395900_0142426
536 Ga0395900_0163404
537 Ga0395900_0338621
538 Ga0395898_0373839
539 Ga0395905_0100843
540 Ga0395905_0229231
541 Ga0395905_0360317
542 Ga0395901_0144560
543 Ga0395901_0144571
544 Ga0395901_0314792
545 Ga0395901_0345771
546 Ga0466972_0072875
547 Ga0466972_0105236
548 Ga0466970_0224946
549 Ga0495638_0007770
550 Ga0495620_0143671
551 Ga0495643_0078921
552 Ga0495668_0123585
553 Ga0495625_0017610
554 Ga0495625_0304784
555 Ga0495660_0109167
556 Ga0495686_0085469
557 Ga0495686_0146216
558 Ga0496108_0239349
559 Ga0496112_0020064
560 Ga0496114_0333670
561 Ga0496119_0053952
562 Ga0496120_0004141
563 Ga0496125_0090343
564 Ga0496126_0119031
565 Ga0496126_0164620
566 Ga0501031_0290092
567 Ga0501032_0061745
568 Ga0501032_0199410
569 Ga0501033_0032239
570 Ga0501034_0029726
571 Ga0501034_0046497
572 Ga0501034_0072996
573 Ga0501034_0250120
574 Ga0501036_0350045
575 Ga0501037_0197127
576 Ga0501038_0218986
577 Ga0501039_0108312
578 Ga0501043_0036037
579 Ga0501043_0174463
580 Ga0501043_0318699
581 Ga0501046_0040925
582 Ga0501047_0043453
583 Ga0501047_0070306
584 Ga0501047_0317205
585 Ga0501069_0094000
586 Ga0501070_0002166
587 Ga0501070_0068696
588 Ga0501070_0197554
589 Ga0501072_0288651
590 Ga0501073_0132263
591 Ga0501074_0025071
592 Ga0501079_0086507
593 Ga0501080_0002010
594 Ga0501080_0046124
595 Ga0501083_0300274
596 Ga0501035_0004171
597 Ga0501035_0014759
598 Ga0501035_0016289
599 Ga0501035_0019269
600 Ga0501035_0121284
601 Ga0501044_0011679
602 Ga0501044_0013502
603 Ga0501044_0095900
604 Ga0501044_0250372
605 Ga0501044_0501892
606 nmdc:mga03n38_31394_c1
607 nmdc:mga00v17_184007_c1
608 nmdc:mga0yw44_153540_c1
609 nmdc:mga0yw44_24032_c1
610 nmdc:mga0yw44_268436_c1
611 nmdc:mga0yw44_421844_c1
612 nmdc:mga0yw44_5682_c1
613 nmdc:mga0yw44_634693_c1
614 nmdc:mga06z11_187114_c1
615 nmdc:mga06z11_250790_c1
616 nmdc:mga06z11_75516_c1
617 nmdc:mga04h51_12555_c1
618 nmdc:mga07m45_14456_c1
619 nmdc:mga0sz30_56689_c2
620 nmdc:mga0sz30_8408_c1
621 Ga0495655_0022963
622 Ga0500643_012203
623 Ga0500658_0025382
624 Ga0500568_0000283
625 Ga0500604_0019344
626 Ga0500604_0044741
627 Ga0500616_0096599
628 Ga0500620_000068
629 Ga0500620_115955
630 2503201901
631 2509118119
632 2509144156
633 2509367558
634 2509396578
635 2510313657
636 2512931205
637 2512959025
638 2513610835
639 2514038304
640 2514420150
641 2514589035
642 2588516985
643 2597813471
644 2599938452
645 2643773141
646 2643775869
647 2643794316
648 2643839864
649 2643984662
650 2644129148
651 2644158514
652 2688598714
653 2694633200
654 2694638227
655 2723575665
656 2739308244
657 2756675965
658 2770195302
659 2776270753
660 2776280424
661 2792749525
662 2840767554
663 2841739548
664 2844007143
665 2844014019
666 2847675864
667 2847692509
668 2856314592
669 2856325532
670 2856331370
671 2856339350
672 2856347327
673 2856355271
674 2856362666
675 2856370415
676 2857350799
677 2857373844
678 2869168903
679 2869172656
680 2869240005
681 2869255000
682 2869264088
683 2869265930
684 2869272413
685 2869291858
686 2871435067
687 2871440231
688 2871447538
689 2871452244
690 2871463212
691 2871468384
692 2871474763
693 2871486644
694 2871491262
695 2871502968
696 2874102546
697 2874116173
698 2874123190
699 2874123770
700 2874132482
701 2874149458
702 2874157721
703 2874164361
704 2874174521
705 2876369263
706 2876370142
707 2876392457
708 2876394513
709 2876405917
710 2876407225
711 2876415924
712 2876427516
713 2878039935
714 2878734692
715 2878745540
716 2878752202
717 2878757697
718 2878766860
719 2878774057
720 2878777375
721 2878788429
722 2878795392
723 2881151804
724 2881155585
725 2881852036
726 2881856806
727 2881866647
728 2882636550
729 2882916224
730 2885309709
731 2885317717
732 2885320145
733 2885342057
734 2885349815
735 2885354344
736 2888339711
737 2888347080
738 2888356046
739 2889017330
740 2903455325
741 2903493240
742 2903506372
743 2903516462
744 2903523130
745 2903534410
746 2903548107
747 2904661147
748 2906314596
749 2906327764
750 2906329760
751 2906359220
752 2906370632
753 2906390591
754 2906395352
755 2906401798
756 2906412191
757 2906414545
758 2922151395
759 2922158632
760 2922174526
761 2922192913
762 2924723042
763 2924731990
764 2924739445
765 2924744383
766 2924753967
767 2924759651
768 2924764144
769 2924783784
770 2924789365
771 2937816101
772 2937824762
773 2937838260
774 2937852901
775 2937863426
776 2937880485
777 2937893695
778 2937975576
779 2937983610
780 2938001983
781 2958040926
782 2958048301
783 2958057008
784 2958067698
785 2958072961
786 2958087619
787 2958093482
788 2958106865
789 2958111621
790 2958118705
791 2958125799
792 2958136256
793 2958144050
794 2958145310
795 2958164753
796 2958172038
797 2958185724
798 2961084101
799 2961116298
800 2961133815
801 2961142660
802 2961170484
803 2961174240
804 2961184592
805 2963648014
806 2965025230
807 2965026428
808 2965038004
809 2965041615
810 2965053315
811 2965065500
812 2965113907
813 2965119629
814 2968000187
815 2968005541
816 2968018154
817 2968090835
818 2968096520
819 2968098990
820 2968112204
821 2968120967
822 2968132571
823 2968146015
824 2968178871
825 2970471672
826 2970495616
827 2970506827
828 2970517694
829 2970530597
830 2970532998
831 2970545999
832 2970549353
833 2970561716
834 2970599838
835 2970619574
836 2970633625
837 2977822229
838 2977835092
839 2977846337
840 2977857084
841 2977860436
842 2977877417
843 2977901938
844 2977921424
845 2977924518
846 2977941366
847 2977947499
848 2977951194
849 2977960103
850 2977988324
851 2979714518
852 2979769823
853 2979773776
854 2979785037
855 2979797206
856 2979812022
857 2987637984
858 2987651374
859 2987655898
860 2987666725
861 2987668951
862 2996341002
863 2996347368
864 2996350457
865 2996389939
866 3000140317
867 3004169203
868 3004195727
869 3004205694
870 3004216251
871 3004224001
872 3004235100
873 3004248542
874 3004269641
875 3004277155
876 3004341415
877 637074307
878 649873231
879 8002288792
880 8004306644
881 8004317750
882 8004362650
883 8004379208
884 8004394416
885 8004396579
886 8004451062
887 8004634877
888 8004640533
889 8004709607
890 8004720857
891 8004731939
892 8055621043

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p78-assembly1.cif.gz_C hica3 and hicb3 toxin-antitoxin complex 0.645 9 53
4ras-assembly4.cif.gz_C reductive dehalogenase structure suggests a mechanism for b12-dependent dehalogenation 0.5155 7 157
6zy1-assembly3.cif.gz_C catabolic reductive dehalogenase nprdha, n-terminally tagged in complex with 3-bromo-4-hydroxybenzoic acid 0.5079 7 158
6zxx-assembly1.cif.gz_A catabolic reductive dehalogenase nprdha, n-terminally tagged. 0.4935 7 158
4ras-assembly4.cif.gz_B reductive dehalogenase structure suggests a mechanism for b12-dependent dehalogenation 0.4931 7 158
ID Description Score Start End Superfamily
af_Q12680_89_232_1.10.1060.10 Mainly Alpha;Orthogonal Bundle;Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2;Alpha-helical ferredoxin 0.5424 6 88 1.10.1060.10
af_P27249_815_877_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.5211 9 85 3.30.70.260
af_Q9LMA1_8_278_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.5032 19 55 3.50.50.60
af_O53289_94_177_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.47 1 89 3.30.70.260
af_Q57901_1_89_3.30.70.60 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.4694 2 56 3.30.70.60
ID Description Score Start End GO Terms
AF-A0A526YJ58-F1-model_v4 Uncharacterized protein 0.9508 8 94
AF-A0A2W4QZC3-F1-model_v4 deleted 0.9261 8 102
AF-A0A526YJ58-F1-model_v4 Uncharacterized protein 0.9202 8 94
AF-A0A441TJM9-F1-model_v4 Uncharacterized protein 0.8929 21 96
AF-A0A528MN68-F1-model_v4 4Fe-4S dicluster domain-containing protein 0.8844 9 138

Map