F445642

General Info

Members Datasets Scaffolds Average Seq Length
446 391 153 310

Family's Representative Sequence

Representative Sequence 3300003578|Ga0006562J51391_1160326|Ga0006562J51391_11603262
Length 327
Sequence MRFKSPNNSEIDMTFRLYDLPEIEPSRSVGFSGNRIDRQSEKRQDDSAFTALELPETRIMLLGGNRLLLDYADEKAPRALFRLGEAKDFAPDLHEPIFLGLQDGAPLVALTTPLDPETMETPFRLQDYRSIYTEGLVSADLLGALAQAAALTAWHANHRFCGRCGTKTDMRAGGAKRQCPNCGAEHFPRTDPVAIMLPVRGEKCILARSPHFAPGSYSCLAGFIEHGETIEAAVRRESVEEMGLSIGRVAYHASQPWPFPYSLMIGCHAEVLSDDFTIDRSELEDGRWFSKAEVRTMLEGTHENGLRVPPSGAIATHLIKAWVYDAG

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
8 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
9 2512875024 Mesorhizobium loti R88b Isolate Nodule
10 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
11 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
12 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
13 2534681786 Brucella suis 92/29 Isolate Unclassified
14 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
15 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
16 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
17 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
18 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
19 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
20 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
21 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
22 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
23 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
24 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
25 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
26 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
27 2738543024 Aminobacter sp. AP02 Isolate Unclassified
28 2751185800 Brucella pituitosa AA2 Isolate Unclassified
29 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
30 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
31 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
32 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
33 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
34 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
35 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
36 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
37 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
38 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
39 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
40 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
41 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
42 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
43 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
44 2854911287 Brucella lupini LUP21 Isolate Unclassified
45 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
46 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
47 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
48 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
49 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
50 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
51 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
52 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
53 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
54 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
55 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
56 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
57 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
58 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
59 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
60 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
61 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
62 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
63 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
64 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
65 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
66 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
67 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
68 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
69 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
70 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
71 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
72 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
73 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
74 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
75 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
76 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
77 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
78 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
79 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
80 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
81 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
82 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
83 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
84 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
85 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
86 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
87 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
88 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
89 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
90 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
91 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
92 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
93 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
94 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
95 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
96 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
97 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
98 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
99 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
100 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
101 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
102 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
103 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
104 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
105 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
106 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
107 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
108 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
109 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
110 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
111 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
112 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
113 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
114 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
115 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
116 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
117 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
118 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
119 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
120 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
121 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
122 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
123 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
124 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
125 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
126 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
127 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
128 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
129 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
130 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
131 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
132 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
133 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
134 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
135 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
136 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
137 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
138 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
139 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
140 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
141 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
142 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
143 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
144 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
145 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
146 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
147 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
148 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
149 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
150 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
151 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
152 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
153 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
154 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
155 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
156 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
157 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
158 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
159 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
160 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
161 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
162 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
163 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
164 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
165 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
166 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
167 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
168 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
169 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
170 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
171 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
172 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
173 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
174 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
175 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
176 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
177 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
178 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
179 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
180 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
181 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
182 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
183 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
184 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
185 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
186 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
187 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
188 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
189 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
190 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
191 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
192 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
193 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
194 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
195 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
196 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
197 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
198 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
199 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
200 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
201 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
202 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
203 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
204 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
205 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
206 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
207 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
208 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
209 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
210 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
211 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
212 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
213 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
214 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
215 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
216 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
217 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
218 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
219 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
220 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
221 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
222 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
223 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
224 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
225 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
226 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
227 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
228 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
229 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
230 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
231 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
232 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
233 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
234 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
235 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
236 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
237 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
238 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
239 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
240 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
241 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
242 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
243 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
244 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
245 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
246 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
247 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
248 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
249 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
250 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
251 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
252 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
253 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
254 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
255 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
256 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
257 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
258 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
259 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
260 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
261 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
262 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
263 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
264 3004167301 Mesorhizobium loti 582 Isolate Unclassified
265 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
266 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
267 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
268 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
269 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
270 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
271 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
272 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
273 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
274 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
275 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
276 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
277 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
278 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
279 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
280 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
281 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
282 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
283 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
284 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
285 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
286 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
287 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
288 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
289 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
290 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
291 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
292 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
293 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
294 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
295 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
296 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
297 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
298 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
299 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
300 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
301 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
302 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
303 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
314 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
316 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
317 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
318 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
319 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
320 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
321 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
322 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
323 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
324 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
325 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
326 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
327 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
328 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
329 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
330 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
331 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
332 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
333 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
334 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
335 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
336 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
337 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
338 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
339 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
340 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
341 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
354 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
355 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
356 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
357 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
358 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
359 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
360 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
361 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
362 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
365 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
366 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
367 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
368 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
369 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
370 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
371 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
372 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
373 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
374 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
375 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
376 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
377 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
378 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
379 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
380 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
381 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
382 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
383 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
384 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
385 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
386 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
387 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
388 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
389 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
390 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
391 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 34.08
Metatranscriptomes 0.22
Isolates 65.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.85
Nodule 52.91
Rhizoplane 1.79
Rhizosphere 24.89
Stem 0
Stem Tuber 0
Unclassified 12.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1001703 3300002741 Bacteria 7415
2 JGI25406J46586_10012845 3300003203 Bacteria 3617
3 JGI25165J46597_1000019 3300003214 Bacteria 371528
4 Ga0006562J51391_1160326 3300003578 Bacteria 1720
5 Ga0055542_1000625 3300003762 Bacteria 29738
6 Ga0070663_100020270 3300005455 Bacteria 4400
7 Ga0070665_100010479 3300005548 Bacteria 9378
8 Ga0070665_100044246 3300005548 Bacteria 4471
9 Ga0070665_100132015 3300005548 Bacteria 2499
10 Ga0068857_100077636 3300005577 Bacteria 2963
11 Ga0068854_100267610 3300005578 Bacteria 1371
12 Ga0068860_100591992 3300005843 Bacteria 1114
13 Ga0081539_10000410 3300005985 Bacteria 91484
14 Ga0075365_10002469 3300006038 Bacteria 9082
15 Ga0075365_10008459 3300006038 Bacteria 5846
16 Ga0075365_10018442 3300006038 Bacteria 4290
17 Ga0075365_10021658 3300006038 Bacteria 4013
18 Ga0075365_10340868 3300006038 Bacteria 1056
19 Ga0075363_100018547 3300006048 Bacteria 3469
20 Ga0075363_100046888 3300006048 Bacteria 2293
21 Ga0075363_100159380 3300006048 Bacteria 1277
22 Ga0075364_10024277 3300006051 Bacteria 3847
23 Ga0075364_10063456 3300006051 Bacteria 2425
24 Ga0075362_10107025 3300006177 Bacteria 1313
25 Ga0075367_10027169 3300006178 Bacteria 3253
26 Ga0075367_10032910 3300006178 Bacteria 2986
27 Ga0075367_10069460 3300006178 Bacteria 2115
28 Ga0105248_10378858 3300009177 Bacteria 1593
29 Ga0105238_10065945 3300009551 Bacteria 3622
30 Ga0105249_10370922 3300009553 Bacteria 1455
31 Ga0105239_10135892 3300010375 Bacteria 2737
32 Ga0105239_10239630 3300010375 Bacteria 2036
33 Ga0182008_10044070 3300014497 Bacteria 2219
34 Ga0209026_1000013 3300025250 Bacteria 415633
35 Ga0209148_1000032 3300025254 Bacteria 557660
36 Ga0209759_1000058 3300025256 Bacteria 203580
37 Ga0209233_1000034 3300025261 Bacteria 578898
38 Ga0209455_1000098 3300025272 Bacteria 213890
39 Ga0209758_1003869 3300025297 Bacteria 13112
40 Ga0207647_10045609 3300025904 Bacteria 2734
41 Ga0207705_10058343 3300025909 Bacteria 2785
42 Ga0207671_10157012 3300025914 Bacteria 1760
43 Ga0207657_10191723 3300025919 Bacteria 1648
44 Ga0207649_10149479 3300025920 Bacteria 1607
45 Ga0207694_10023400 3300025924 Bacteria 4689
46 Ga0207639_10075937 3300026041 Bacteria 2644
47 Ga0207678_10045832 3300026067 Bacteria 3781
48 Ga0207674_10106364 3300026116 Bacteria 2783
49 Ga0207698_10092806 3300026142 Bacteria 2476
50 Ga0209813_10013924 3300027866 Bacteria 2157
51 Ga0268266_10035412 3300028379 Bacteria 4246
52 Ga0268266_10044655 3300028379 Bacteria 3788
53 Ga0268266_10252133 3300028379 Bacteria 1633
54 Ga0316574_0089052 3300035398 Bacteria 1966
55 Ga0395899_0000014 3300037312 Bacteria 488813
56 Ga0395900_0000007 3300037418 Bacteria 488860
57 Ga0395900_0012123 3300037418 Bacteria 8808
58 Ga0395900_0601448 3300037418 Bacteria 1040
59 Ga0395898_0000011 3300037466 Bacteria 488860
60 Ga0395905_0000008 3300037471 Bacteria 488860
61 Ga0395905_0060689 3300037471 Bacteria 3536
62 Ga0395905_0083016 3300037471 Bacteria 3002
63 Ga0395905_0120943 3300037471 Bacteria 2461
64 Ga0395901_0000020 3300038443 Bacteria 314918
65 Ga0395901_0137149 3300038443 Bacteria 2571
66 Ga0439465_0045728 3300041413 Bacteria 1424
67 Ga0466972_0025807 3300044658 Bacteria 2911
68 Ga0495638_0037557 3300046460 Bacteria 3080
69 Ga0495637_0081136 3300046520 Bacteria 1293
70 Ga0495597_0022565 3300046542 Bacteria 2918
71 Ga0495670_0056027 3300046691 Bacteria 1977
72 Ga0495681_0063910 3300047470 Bacteria 1688
73 Ga0495686_0067638 3300047472 Bacteria 2205
74 Ga0495626_0040254 3300048091 Bacteria 2208
75 Ga0496102_0062875 3300048905 Bacteria 3399
76 Ga0496103_0216537 3300048906 Bacteria 1232
77 Ga0496105_0335871 3300048908 Bacteria 1209
78 Ga0496112_0080011 3300048915 Bacteria 3232
79 Ga0496112_0228823 3300048915 Bacteria 1814
80 Ga0496118_0164187 3300048921 Bacteria 1368
81 Ga0496119_0010625 3300048922 Bacteria 7720
82 Ga0496120_0005806 3300048923 Bacteria 9674
83 Ga0496120_0118975 3300048923 Bacteria 1368
84 Ga0496122_0066441 3300048925 Bacteria 2605
85 Ga0496124_0213751 3300048927 Bacteria 1457
86 Ga0496124_0351086 3300048927 Bacteria 1043
87 Ga0496125_0164729 3300048928 Bacteria 1500
88 Ga0496126_0103067 3300048929 Bacteria 2494
89 Ga0496126_0198360 3300048929 Bacteria 1696
90 Ga0501031_0000076 3300049568 Bacteria 51870
91 Ga0501032_0000004 3300049569 Bacteria 310855
92 Ga0501032_0001730 3300049569 Bacteria 17269
93 Ga0501033_0000156 3300049570 Bacteria 65847
94 Ga0501033_0018009 3300049570 Bacteria 5333
95 Ga0501033_0065273 3300049570 Bacteria 2678
96 Ga0501033_0213104 3300049570 Bacteria 1377
97 Ga0501034_0000011 3300049571 Bacteria 310855
98 Ga0501034_0016156 3300049571 Bacteria 7658
99 Ga0501034_0058466 3300049571 Bacteria 3875
100 Ga0501034_0076165 3300049571 Bacteria 3362
101 Ga0501034_0217595 3300049571 Bacteria 1863
102 Ga0501034_0355151 3300049571 Bacteria 1393
103 Ga0501036_0000001 3300049572 Bacteria 310855
104 Ga0501036_0022807 3300049572 Bacteria 5270
105 Ga0501037_0000064 3300049573 Bacteria 97087
106 Ga0501038_0000003 3300049574 Bacteria 310855
107 Ga0501038_0049366 3300049574 Bacteria 3638
108 Ga0501038_0290565 3300049574 Bacteria 1285
109 Ga0501038_0290855 3300049574 Bacteria 1284
110 Ga0501039_0000004 3300049575 Bacteria 310855
111 Ga0501039_0071860 3300049575 Bacteria 2688
112 Ga0501040_0010928 3300049576 Bacteria 5936
113 Ga0501043_0000417 3300049579 Bacteria 38233
114 Ga0501043_0078984 3300049579 Bacteria 2586
115 Ga0501047_0002889 3300049581 Bacteria 16294
116 Ga0501047_0061516 3300049581 Bacteria 3623
117 Ga0501047_0225249 3300049581 Bacteria 1730
118 Ga0501048_0006355 3300049582 Bacteria 8982
119 Ga0501067_0080323 3300049583 Bacteria 1808
120 Ga0501069_0005987 3300049585 Bacteria 6345
121 Ga0501070_0007807 3300049586 Bacteria 9069
122 Ga0501070_0009102 3300049586 Bacteria 8397
123 Ga0501070_0062989 3300049586 Bacteria 3072
124 Ga0501070_0187504 3300049586 Bacteria 1701
125 Ga0501071_0021753 3300049587 Bacteria 4470
126 Ga0501072_0162910 3300049588 Bacteria 1779
127 Ga0501073_0036359 3300049589 Bacteria 3499
128 Ga0501074_0022436 3300049590 Bacteria 4586
129 Ga0501079_0074809 3300049741 Bacteria 2619
130 Ga0501083_0038807 3300049744 Bacteria 3236
131 Ga0501035_0000009 3300049822 Bacteria 310827
132 Ga0501035_0014973 3300049822 Bacteria 7156
133 Ga0501035_0040762 3300049822 Bacteria 4194
134 Ga0501035_0330784 3300049822 Bacteria 1278
135 Ga0501044_0000005 3300049823 Bacteria 310855
136 Ga0501044_0037294 3300049823 Bacteria 5081
137 Ga0501044_0190897 3300049823 Bacteria 2011
138 Ga0501044_0346303 3300049823 Bacteria 1406
139 Ga0501045_0005304 3300049824 Bacteria 8932
140 nmdc:mga03683_34683_c1 3300050489 Bacteria 2043
141 nmdc:mga0yw44_11553_c1 3300050492 Bacteria 4565
142 nmdc:mga0yw44_150999_c1 3300050492 Bacteria 1515
143 nmdc:mga0yw44_36177_c1 3300050492 Bacteria 2908
144 nmdc:mga0yw44_55055_c1 3300050492 Bacteria 2420
145 nmdc:mga0sz30_23981_c3 3300050516 Bacteria 982
146 Ga0500643_017331 3300053087 Bacteria 2414
147 Ga0500658_0063262 3300053134 Bacteria 1544
148 Ga0500568_0000052 3300053139 Bacteria 112079
149 Ga0500604_0061160 3300053151 Bacteria 1183
150 Ga0500604_0107615 3300053151 Bacteria 924
151 Ga0500616_0078569 3300053153 Bacteria 1664
152 Ga0500620_000113 3300053155 Bacteria 15929
153 Ga0500627_0013430 3300053158 Bacteria 3105

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025920 Ga0207649_10149479 Ga0207649_101494791 255
2 iso_pu_bacteria 2885326080 2885329220 262
3 3300041413 Ga0439465_0045728 Ga0439465_0045728_600_1394 263
4 3300050516 nmdc:mga0sz30_23981_c3 nmdc:mga0sz30_23981_c3_169_963 264
5 3300053151 Ga0500604_0107615 Ga0500604_0107615_94_894 266
6 3300035398 Ga0316574_0089052 Ga0316574_0089052_642_1535 277
7 iso_pu_bacteria 8004727605 8004734538 282
8 iso_pu_bacteria 2937891427 2937895892 283
9 iso_pu_bacteria 2922185730 2922188953 284
10 3300028379 Ga0268266_10252133 Ga0268266_102521332 291
11 3300005548 Ga0070665_100044246 Ga0070665_1000442465 297
12 3300028379 Ga0268266_10044655 Ga0268266_100446553 297
13 3300027866 Ga0209813_10013924 Ga0209813_100139242 301
14 3300049586 Ga0501070_0007807 Ga0501070_0007807_3309_4259 302
15 3300009177 Ga0105248_10378858 Ga0105248_103788583 303
16 3300010375 Ga0105239_10135892 Ga0105239_101358924 303
17 3300014497 Ga0182008_10044070 Ga0182008_100440702 303
18 3300048908 Ga0496105_0335871 Ga0496105_0335871_31_975 303
19 3300048915 Ga0496112_0080011 Ga0496112_0080011_232_1176 303
20 3300053087 Ga0500643_017331 Ga0500643_017331_1013_1954 303
21 3300053155 Ga0500620_000113 Ga0500620_000113_11617_12561 303
22 3300003762 Ga0055542_1000625 Ga0055542_100062515 304
23 3300005578 Ga0068854_100267610 Ga0068854_1002676102 304
24 3300006038 Ga0075365_10021658 Ga0075365_100216584 304
25 3300006048 Ga0075363_100018547 Ga0075363_1000185474 304
26 3300006178 Ga0075367_10032910 Ga0075367_100329101 304
27 3300025254 Ga0209148_1000032 Ga0209148_100003260 304
28 3300025272 Ga0209455_1000098 Ga0209455_1000098151 304
29 3300025909 Ga0207705_10058343 Ga0207705_100583432 304
30 3300025919 Ga0207657_10191723 Ga0207657_101917233 304
31 3300026142 Ga0207698_10092806 Ga0207698_100928062 304
32 3300048927 Ga0496124_0213751 Ga0496124_0213751_413_1357 304
33 3300048927 Ga0496124_0351086 Ga0496124_0351086_17_961 304
34 3300049570 Ga0501033_0213104 Ga0501033_0213104_28_960 304
35 3300049586 Ga0501070_0187504 Ga0501070_0187504_516_1448 304
36 3300049822 Ga0501035_0040762 Ga0501035_0040762_1604_2536 304
37 iso_pu_bacteria 2894652903 2894653011 304
38 3300053153 Ga0500616_0078569 Ga0500616_0078569_21_947 306
39 iso_pu_bacteria 2889790730 2889792542 306
40 iso_pu_bacteria 2889914905 2889916209 306
41 iso_pu_bacteria 2904578770 2904579267 306
42 iso_pu_bacteria 2919119836 2919121906 306
43 iso_pu_bacteria 2511231027 2511389200 307
44 iso_pu_bacteria 2765235802 2765464088 307
45 iso_pu_bacteria 2767802442 2770196738 307
46 iso_pu_bacteria 2775506902 2776272769 307
47 iso_pu_bacteria 2775506904 2776284713 307
48 iso_pu_bacteria 2840764183 2840769543 307
49 iso_pu_bacteria 2842871566 2842873192 307
50 iso_pu_bacteria 2996310559 2996314468 307
51 iso_pu_bacteria 2643221551 2643777734 308
52 iso_pu_bacteria 2643221555 2643796182 308
53 iso_pu_bacteria 2751185800 2753358359 308
54 iso_pu_bacteria 2758568016 2758640584 308
55 iso_pu_bacteria 2839993093 2839994017 308
56 iso_pu_bacteria 2915650412 2915650742 308
57 iso_pu_bacteria 2928521798 2928522121 308
58 iso_pu_bacteria 2954011201 2954014459 308
59 iso_pu_bacteria 2996336353 2996336798 308
60 iso_pu_bacteria 2503198000 2503198061 309
61 iso_pu_bacteria 2508501123 2509113652 309
62 iso_pu_bacteria 2508501127 2509140273 309
63 iso_pu_bacteria 2509276018 2509370574 309
64 iso_pu_bacteria 2509276022 2509392989 309
65 iso_pu_bacteria 2510065059 2510314407 309
66 iso_pu_bacteria 2512875016 2512934456 309
67 iso_pu_bacteria 2512875024 2512962802 309
68 iso_pu_bacteria 2513237090 2513609522 309
69 iso_pu_bacteria 2513237164 2514037525 309
70 iso_pu_bacteria 2513237351 2514586134 309
71 iso_pu_bacteria 2534681786 2535485656 309
72 iso_pu_bacteria 2588253730 2588520627 309
73 iso_pu_bacteria 2597489875 2597810145 309
74 iso_pu_bacteria 2599185301 2599935737 309
75 iso_pu_bacteria 2643221550 2643770747 309
76 iso_pu_bacteria 2643221564 2643839671 309
77 iso_pu_bacteria 2643221595 2643985018 309
78 iso_pu_bacteria 2643221623 2644133600 309
79 iso_pu_bacteria 2643221627 2644154052 309
80 iso_pu_bacteria 2687453392 2688595374 309
81 iso_pu_bacteria 2693429783 2694628498 309
82 iso_pu_bacteria 2693429784 2694640628 309
83 iso_pu_bacteria 2738543024 2739308440 309
84 iso_pu_bacteria 2756170246 2756674552 309
85 iso_pu_bacteria 2791355123 2792746570 309
86 iso_pu_bacteria 2841734538 2841735841 309
87 iso_pu_bacteria 2844002411 2844004112 309
88 iso_pu_bacteria 2844009547 2844010096 309
89 iso_pu_bacteria 2847670302 2847672965 309
90 iso_pu_bacteria 2847686936 2847689447 309
91 iso_pu_bacteria 2854911287 2854913867 309
92 iso_pu_bacteria 2856314179 2856320003 309
93 iso_pu_bacteria 2856320880 2856327858 309
94 iso_pu_bacteria 2856328259 2856332033 309
95 iso_pu_bacteria 2856334872 2856339326 309
96 iso_pu_bacteria 2856342000 2856345441 309
97 iso_pu_bacteria 2856364286 2856371253 309
98 iso_pu_bacteria 2857349434 2857354349 309
99 iso_pu_bacteria 2857367948 2857374114 309
100 iso_pu_bacteria 2869162929 2869168714 309
101 iso_pu_bacteria 2869169390 2869175029 309
102 iso_pu_bacteria 2869234852 2869239810 309
103 iso_pu_bacteria 2869242130 2869246299 309
104 iso_pu_bacteria 2869249662 2869256051 309
105 iso_pu_bacteria 2869256925 2869261194 309
106 iso_pu_bacteria 2869264136 2869264379 309
107 iso_pu_bacteria 2869271264 2869271840 309
108 iso_pu_bacteria 2869278585 2869279809 309
109 iso_pu_bacteria 2869285874 2869292476 309
110 iso_pu_bacteria 2871429161 2871429291 309
111 iso_pu_bacteria 2871435913 2871436158 309
112 iso_pu_bacteria 2871444079 2871445529 309
113 iso_pu_bacteria 2871451962 2871459256 309
114 iso_pu_bacteria 2871459585 2871463958 309
115 iso_pu_bacteria 2871466892 2871469812 309
116 iso_pu_bacteria 2871474448 2871478397 309
117 iso_pu_bacteria 2871481445 2871484470 309
118 iso_pu_bacteria 2871488783 2871490812 309
119 iso_pu_bacteria 2871495908 2871499386 309
120 iso_pu_bacteria 2874102143 2874109035 309
121 iso_pu_bacteria 2874109183 2874112570 309
122 iso_pu_bacteria 2874116593 2874117345 309
123 iso_pu_bacteria 2874123672 2874129510 309
124 iso_pu_bacteria 2874131515 2874138873 309
125 iso_pu_bacteria 2874139085 2874145698 309
126 iso_pu_bacteria 2874146452 2874154197 309
127 iso_pu_bacteria 2874155637 2874161699 309
128 iso_pu_bacteria 2874162495 2874162559 309
129 iso_pu_bacteria 2874168670 2874171768 309
130 iso_pu_bacteria 2876363079 2876363282 309
131 iso_pu_bacteria 2876369609 2876374970 309
132 iso_pu_bacteria 2876386047 2876387101 309
133 iso_pu_bacteria 2876392853 2876392916 309
134 iso_pu_bacteria 2876399893 2876405102 309
135 iso_pu_bacteria 2876406927 2876409461 309
136 iso_pu_bacteria 2876413966 2876419881 309
137 iso_pu_bacteria 2876420981 2876423640 309
138 iso_pu_bacteria 2878035449 2878035573 309
139 iso_pu_bacteria 2878730984 2878737517 309
140 iso_pu_bacteria 2878738818 2878740348 309
141 iso_pu_bacteria 2878745973 2878752819 309
142 iso_pu_bacteria 2878753008 2878755216 309
143 iso_pu_bacteria 2878760144 2878763576 309
144 iso_pu_bacteria 2878767105 2878770574 309
145 iso_pu_bacteria 2878774303 2878776156 309
146 iso_pu_bacteria 2878781027 2878782593 309
147 iso_pu_bacteria 2878788777 2878795370 309
148 iso_pu_bacteria 2881147464 2881147626 309
149 iso_pu_bacteria 2881155292 2881158726 309
150 iso_pu_bacteria 2881161766 2881164401 309
151 iso_pu_bacteria 2881845957 2881852620 309
152 iso_pu_bacteria 2881861095 2881863202 309
153 iso_pu_bacteria 2882632389 2882632764 309
154 iso_pu_bacteria 2882912400 2882912471 309
155 iso_pu_bacteria 2885305155 2885306264 309
156 iso_pu_bacteria 2885312484 2885314688 309
157 iso_pu_bacteria 2885318864 2885321019 309
158 iso_pu_bacteria 2885334103 2885335834 309
159 iso_pu_bacteria 2885342637 2885344783 309
160 iso_pu_bacteria 2885350715 2885357097 309
161 iso_pu_bacteria 2888337043 2888342710 309
162 iso_pu_bacteria 2888343758 2888343814 309
163 iso_pu_bacteria 2888350351 2888352287 309
164 iso_pu_bacteria 2889010040 2889014277 309
165 iso_pu_bacteria 2889016732 2889021018 309
166 iso_pu_bacteria 2903448605 2903454643 309
167 iso_pu_bacteria 2903492973 2903494918 309
168 iso_pu_bacteria 2903492973 2903499304 309
169 iso_pu_bacteria 2903513507 2903521275 309
170 iso_pu_bacteria 2903521522 2903525232 309
171 iso_pu_bacteria 2903528002 2903532023 309
172 iso_pu_bacteria 2903540706 2903544191 309
173 iso_pu_bacteria 2904659560 2904659622 309
174 iso_pu_bacteria 2906308376 2906315210 309
175 iso_pu_bacteria 2906321335 2906321466 309
176 iso_pu_bacteria 2906328253 2906334542 309
177 iso_pu_bacteria 2906363423 2906369883 309
178 iso_pu_bacteria 2906370794 2906374462 309
179 iso_pu_bacteria 2906378014 2906382266 309
180 iso_pu_bacteria 2906386501 2906390612 309
181 iso_pu_bacteria 2906393657 2906398354 309
182 iso_pu_bacteria 2906401398 2906404652 309
183 iso_pu_bacteria 2906408224 2906412476 309
184 iso_pu_bacteria 2906414383 2906420779 309
185 iso_pu_bacteria 2906427513 2906433775 309
186 iso_pu_bacteria 2922130491 2922138569 309
187 iso_pu_bacteria 2922151315 2922158326 309
188 iso_pu_bacteria 2922158528 2922162342 309
189 iso_pu_bacteria 2922172374 2922173409 309
190 iso_pu_bacteria 2924710171 2924716824 309
191 iso_pu_bacteria 2924718760 2924724978 309
192 iso_pu_bacteria 2924726620 2924732875 309
193 iso_pu_bacteria 2924733363 2924734282 309
194 iso_pu_bacteria 2924741084 2924743880 309
195 iso_pu_bacteria 2924748358 2924751509 309
196 iso_pu_bacteria 2924754689 2924756126 309
197 iso_pu_bacteria 2924762789 2924767708 309
198 iso_pu_bacteria 2924776078 2924777949 309
199 iso_pu_bacteria 2924784321 2924791437 309
200 iso_pu_bacteria 2937813078 2937821752 309
201 iso_pu_bacteria 2937822353 2937826027 309
202 iso_pu_bacteria 2937836603 2937839135 309
203 iso_pu_bacteria 2937848649 2937849824 309
204 iso_pu_bacteria 2937861824 2937864145 309
205 iso_pu_bacteria 2937868953 2937874134 309
206 iso_pu_bacteria 2937877337 2937884511 309
207 iso_pu_bacteria 2937972304 2937980534 309
208 iso_pu_bacteria 2937980651 2937986353 309
209 iso_pu_bacteria 2937994558 2937998035 309
210 iso_pu_bacteria 2938014810 2938017576 309
211 iso_pu_bacteria 2958034702 2958035677 309
212 iso_pu_bacteria 2958041894 2958044708 309
213 iso_pu_bacteria 2958064165 2958066735 309
214 iso_pu_bacteria 2958071322 2958076294 309
215 iso_pu_bacteria 2958084443 2958091822 309
216 iso_pu_bacteria 2958100919 2958101463 309
217 iso_pu_bacteria 2958108152 2958112756 309
218 iso_pu_bacteria 2958115193 2958119665 309
219 iso_pu_bacteria 2958122699 2958128493 309
220 iso_pu_bacteria 2958130278 2958136876 309
221 iso_pu_bacteria 2958137437 2958138572 309
222 iso_pu_bacteria 2958158011 2958158633 309
223 iso_pu_bacteria 2958165035 2958168510 309
224 iso_pu_bacteria 2958172287 2958173736 309
225 iso_pu_bacteria 2958179912 2958186759 309
226 iso_pu_bacteria 2961077736 2961085260 309
227 iso_pu_bacteria 2961114664 2961114947 309
228 iso_pu_bacteria 2961127735 2961135821 309
229 iso_pu_bacteria 2961163497 2961166974 309
230 iso_pu_bacteria 2961170736 2961176742 309
231 iso_pu_bacteria 2961183825 2961189640 309
232 iso_pu_bacteria 2963644680 2963644742 309
233 iso_pu_bacteria 2965018300 2965021798 309
234 iso_pu_bacteria 2965025482 2965028841 309
235 iso_pu_bacteria 2965040258 2965046671 309
236 iso_pu_bacteria 2965047637 2965053194 309
237 iso_pu_bacteria 2965062239 2965064621 309
238 iso_pu_bacteria 2965089291 2965093060 309
239 iso_pu_bacteria 2965102966 2965107735 309
240 iso_pu_bacteria 2965110997 2965118101 309
241 iso_pu_bacteria 2965119406 2965121457 309
242 iso_pu_bacteria 2967996073 2968001149 309
243 iso_pu_bacteria 2968003550 2968007202 309
244 iso_pu_bacteria 2968016561 2968021634 309
245 iso_pu_bacteria 2968083720 2968088982 309
246 iso_pu_bacteria 2968091066 2968094089 309
247 iso_pu_bacteria 2968097103 2968100680 309
248 iso_pu_bacteria 2968110612 2968110675 309
249 iso_pu_bacteria 2968117919 2968121599 309
250 iso_pu_bacteria 2968128360 2968131296 309
251 iso_pu_bacteria 2968138860 2968145085 309
252 iso_pu_bacteria 2968171901 2968175380 309
253 iso_pu_bacteria 2970469710 2970476687 309
254 iso_pu_bacteria 2970489779 2970494144 309
255 iso_pu_bacteria 2970503327 2970509415 309
256 iso_pu_bacteria 2970510686 2970516317 309
257 iso_pu_bacteria 2970524798 2970525521 309
258 iso_pu_bacteria 2970532167 2970535004 309
259 iso_pu_bacteria 2970540015 2970545079 309
260 iso_pu_bacteria 2970547951 2970553798 309
261 iso_pu_bacteria 2970554993 2970558418 309
262 iso_pu_bacteria 2970593180 2970594409 309
263 iso_pu_bacteria 2970619444 2970622536 309
264 iso_pu_bacteria 2970627176 2970627914 309
265 iso_pu_bacteria 2977821940 2977824356 309
266 iso_pu_bacteria 2977828996 2977831156 309
267 iso_pu_bacteria 2977843712 2977850023 309
268 iso_pu_bacteria 2977851361 2977855080 309
269 iso_pu_bacteria 2977858184 2977858395 309
270 iso_pu_bacteria 2977864932 2977868305 309
271 iso_pu_bacteria 2977872689 2977879982 309
272 iso_pu_bacteria 2977898635 2977906449 309
273 iso_pu_bacteria 2977907340 2977912346 309
274 iso_pu_bacteria 2977915119 2977915175 309
275 iso_pu_bacteria 2977922695 2977925368 309
276 iso_pu_bacteria 2977935797 2977938287 309
277 iso_pu_bacteria 2977942078 2977943635 309
278 iso_pu_bacteria 2977950692 2977953096 309
279 iso_pu_bacteria 2977957713 2977959920 309
280 iso_pu_bacteria 2977971508 2977977374 309
281 iso_pu_bacteria 2977986579 2977987337 309
282 iso_pu_bacteria 2979710463 2979716937 309
283 iso_pu_bacteria 2979742915 2979750541 309
284 iso_pu_bacteria 2979764755 2979768852 309
285 iso_pu_bacteria 2979772303 2979778661 309
286 iso_pu_bacteria 2979779861 2979784643 309
287 iso_pu_bacteria 2979793036 2979794293 309
288 iso_pu_bacteria 2979808191 2979814202 309
289 iso_pu_bacteria 2987636660 2987642242 309
290 iso_pu_bacteria 2987645492 2987650222 309
291 iso_pu_bacteria 2987652177 2987658216 309
292 iso_pu_bacteria 2987659509 2987662986 309
293 iso_pu_bacteria 2987666974 2987668393 309
294 iso_pu_bacteria 2987673487 2987674810 309
295 iso_pu_bacteria 2996341866 2996346142 309
296 iso_pu_bacteria 2996348954 2996356110 309
297 iso_pu_bacteria 2996386984 2996388486 309
298 iso_pu_bacteria 3000135777 3000135942 309
299 iso_pu_bacteria 3004167301 3004172550 309
300 iso_pu_bacteria 3004188549 3004192038 309
301 iso_pu_bacteria 3004195979 3004198422 309
302 iso_pu_bacteria 3004203850 3004210328 309
303 iso_pu_bacteria 3004211236 3004216687 309
304 iso_pu_bacteria 3004218560 3004219720 309
305 iso_pu_bacteria 3004232784 3004233557 309
306 iso_pu_bacteria 3004239961 3004245738 309
307 iso_pu_bacteria 3004248173 3004253453 309
308 iso_pu_bacteria 3004268573 3004273067 309
309 iso_pu_bacteria 3004275668 3004282424 309
310 iso_pu_bacteria 3004334049 3004338054 309
311 iso_pu_bacteria 637000159 637077628 309
312 iso_pu_bacteria 649633066 649869934 309
313 iso_pu_bacteria 8002285264 8002291235 309
314 iso_pu_bacteria 8004300914 8004307137 309
315 iso_pu_bacteria 8004312739 8004319624 309
316 iso_pu_bacteria 8004361976 8004365381 309
317 iso_pu_bacteria 8004374579 8004376795 309
318 iso_pu_bacteria 8004387939 8004395150 309
319 iso_pu_bacteria 8004395343 8004401206 309
320 iso_pu_bacteria 8004445564 8004449749 309
321 iso_pu_bacteria 8004633249 8004638733 309
322 iso_pu_bacteria 8004640170 8004646908 309
323 iso_pu_bacteria 8004695233 8004701655 309
324 iso_pu_bacteria 8004703790 8004707249 309
325 iso_pu_bacteria 8004714634 8004721471 309
326 iso_pu_bacteria 8055617313 8055617370 309
327 3300006038 Ga0075365_10340868 Ga0075365_103408681 310
328 3300046691 Ga0495670_0056027 Ga0495670_0056027_713_1657 312
329 3300048922 Ga0496119_0010625 Ga0496119_0010625_4968_5909 312
330 3300048923 Ga0496120_0118975 Ga0496120_0118975_196_1137 312
331 3300048925 Ga0496122_0066441 Ga0496122_0066441_593_1534 312
332 3300048929 Ga0496126_0103067 Ga0496126_0103067_682_1623 312
333 3300049574 Ga0501038_0290565 Ga0501038_0290565_74_1012 312
334 3300002741 JGI25157J39369_1001703 JGI25157J39369_10017034 313
335 3300003203 JGI25406J46586_10012845 JGI25406J46586_100128452 313
336 3300003214 JGI25165J46597_1000019 JGI25165J46597_1000019201 313
337 3300003578 Ga0006562J51391_1160326 Ga0006562J51391_11603262 313
338 3300005455 Ga0070663_100020270 Ga0070663_1000202703 313
339 3300005548 Ga0070665_100010479 Ga0070665_1000104798 313
340 3300005548 Ga0070665_100132015 Ga0070665_1001320151 313
341 3300005577 Ga0068857_100077636 Ga0068857_1000776363 313
342 3300005843 Ga0068860_100591992 Ga0068860_1005919922 313
343 3300005985 Ga0081539_10000410 Ga0081539_1000041086 313
344 3300006038 Ga0075365_10002469 Ga0075365_100024699 313
345 3300006038 Ga0075365_10008459 Ga0075365_100084595 313
346 3300006038 Ga0075365_10018442 Ga0075365_100184422 313
347 3300006048 Ga0075363_100046888 Ga0075363_1000468883 313
348 3300006048 Ga0075363_100159380 Ga0075363_1001593802 313
349 3300006051 Ga0075364_10024277 Ga0075364_100242775 313
350 3300006051 Ga0075364_10063456 Ga0075364_100634562 313
351 3300006177 Ga0075362_10107025 Ga0075362_101070252 313
352 3300006178 Ga0075367_10027169 Ga0075367_100271694 313
353 3300006178 Ga0075367_10069460 Ga0075367_100694603 313
354 3300009551 Ga0105238_10065945 Ga0105238_100659455 313
355 3300009553 Ga0105249_10370922 Ga0105249_103709221 313
356 3300010375 Ga0105239_10239630 Ga0105239_102396302 313
357 3300025250 Ga0209026_1000013 Ga0209026_1000013194 313
358 3300025256 Ga0209759_1000058 Ga0209759_1000058122 313
359 3300025261 Ga0209233_1000034 Ga0209233_1000034385 313
360 3300025297 Ga0209758_1003869 Ga0209758_100386912 313
361 3300025904 Ga0207647_10045609 Ga0207647_100456092 313
362 3300025914 Ga0207671_10157012 Ga0207671_101570122 313
363 3300025924 Ga0207694_10023400 Ga0207694_100234006 313
364 3300026041 Ga0207639_10075937 Ga0207639_100759372 313
365 3300026067 Ga0207678_10045832 Ga0207678_100458322 313
366 3300026116 Ga0207674_10106364 Ga0207674_101063642 313
367 3300028379 Ga0268266_10035412 Ga0268266_100354123 313
368 3300037312 Ga0395899_0000014 Ga0395899_0000014_428555_429496 313
369 3300037418 Ga0395900_0000007 Ga0395900_0000007_428574_429515 313
370 3300037418 Ga0395900_0012123 Ga0395900_0012123_2229_3170 313
371 3300037418 Ga0395900_0601448 Ga0395900_0601448_53_994 313
372 3300037466 Ga0395898_0000011 Ga0395898_0000011_59346_60287 313
373 3300037471 Ga0395905_0000008 Ga0395905_0000008_428574_429515 313
374 3300037471 Ga0395905_0060689 Ga0395905_0060689_2249_3190 313
375 3300037471 Ga0395905_0083016 Ga0395905_0083016_1847_2788 313
376 3300037471 Ga0395905_0120943 Ga0395905_0120943_1279_2220 313
377 3300038443 Ga0395901_0000020 Ga0395901_0000020_254632_255573 313
378 3300038443 Ga0395901_0137149 Ga0395901_0137149_1321_2262 313
379 3300044658 Ga0466972_0025807 Ga0466972_0025807_444_1385 313
380 3300046460 Ga0495638_0037557 Ga0495638_0037557_2104_3045 313
381 3300046520 Ga0495637_0081136 Ga0495637_0081136_139_1080 313
382 3300046542 Ga0495597_0022565 Ga0495597_0022565_1835_2776 313
383 3300047470 Ga0495681_0063910 Ga0495681_0063910_67_1008 313
384 3300047472 Ga0495686_0067638 Ga0495686_0067638_119_1060 313
385 3300048091 Ga0495626_0040254 Ga0495626_0040254_84_1025 313
386 3300048905 Ga0496102_0062875 Ga0496102_0062875_1047_1988 313
387 3300048906 Ga0496103_0216537 Ga0496103_0216537_113_1054 313
388 3300048915 Ga0496112_0228823 Ga0496112_0228823_366_1307 313
389 3300048921 Ga0496118_0164187 Ga0496118_0164187_161_1102 313
390 3300048923 Ga0496120_0005806 Ga0496120_0005806_757_1698 313
391 3300048928 Ga0496125_0164729 Ga0496125_0164729_525_1466 313
392 3300048929 Ga0496126_0198360 Ga0496126_0198360_147_1088 313
393 3300049568 Ga0501031_0000076 Ga0501031_0000076_27756_28703 313
394 3300049569 Ga0501032_0000004 Ga0501032_0000004_286741_287688 313
395 3300049569 Ga0501032_0001730 Ga0501032_0001730_320_1270 313
396 3300049570 Ga0501033_0000156 Ga0501033_0000156_41733_42680 313
397 3300049570 Ga0501033_0018009 Ga0501033_0018009_453_1403 313
398 3300049570 Ga0501033_0065273 Ga0501033_0065273_1004_1969 313
399 3300049571 Ga0501034_0000011 Ga0501034_0000011_286741_287688 313
400 3300049571 Ga0501034_0016156 Ga0501034_0016156_6312_7253 313
401 3300049571 Ga0501034_0058466 Ga0501034_0058466_2868_3812 313
402 3300049571 Ga0501034_0076165 Ga0501034_0076165_535_1479 313
403 3300049571 Ga0501034_0217595 Ga0501034_0217595_117_1058 313
404 3300049571 Ga0501034_0355151 Ga0501034_0355151_311_1252 313
405 3300049572 Ga0501036_0000001 Ga0501036_0000001_286741_287688 313
406 3300049572 Ga0501036_0022807 Ga0501036_0022807_1716_2666 313
407 3300049573 Ga0501037_0000064 Ga0501037_0000064_26793_27740 313
408 3300049574 Ga0501038_0000003 Ga0501038_0000003_286741_287688 313
409 3300049574 Ga0501038_0049366 Ga0501038_0049366_1716_2666 313
410 3300049574 Ga0501038_0290855 Ga0501038_0290855_21_965 313
411 3300049575 Ga0501039_0000004 Ga0501039_0000004_286741_287688 313
412 3300049575 Ga0501039_0071860 Ga0501039_0071860_1546_2496 313
413 3300049576 Ga0501040_0010928 Ga0501040_0010928_1930_2877 313
414 3300049579 Ga0501043_0000417 Ga0501043_0000417_11121_12068 313
415 3300049579 Ga0501043_0078984 Ga0501043_0078984_1158_2102 313
416 3300049581 Ga0501047_0002889 Ga0501047_0002889_10426_11373 313
417 3300049581 Ga0501047_0061516 Ga0501047_0061516_1515_2456 313
418 3300049581 Ga0501047_0225249 Ga0501047_0225249_183_1124 313
419 3300049582 Ga0501048_0006355 Ga0501048_0006355_6533_7483 313
420 3300049583 Ga0501067_0080323 Ga0501067_0080323_766_1716 313
421 3300049585 Ga0501069_0005987 Ga0501069_0005987_2696_3646 313
422 3300049586 Ga0501070_0009102 Ga0501070_0009102_1408_2358 313
423 3300049586 Ga0501070_0062989 Ga0501070_0062989_1844_2791 313
424 3300049587 Ga0501071_0021753 Ga0501071_0021753_2039_2989 313
425 3300049588 Ga0501072_0162910 Ga0501072_0162910_154_1104 313
426 3300049589 Ga0501073_0036359 Ga0501073_0036359_779_1729 313
427 3300049590 Ga0501074_0022436 Ga0501074_0022436_3445_4395 313
428 3300049741 Ga0501079_0074809 Ga0501079_0074809_273_1223 313
429 3300049744 Ga0501083_0038807 Ga0501083_0038807_420_1370 313
430 3300049822 Ga0501035_0000009 Ga0501035_0000009_23140_24087 313
431 3300049822 Ga0501035_0014973 Ga0501035_0014973_3695_4645 313
432 3300049822 Ga0501035_0330784 Ga0501035_0330784_56_1006 313
433 3300049823 Ga0501044_0000005 Ga0501044_0000005_286741_287688 313
434 3300049823 Ga0501044_0037294 Ga0501044_0037294_169_1119 313
435 3300049823 Ga0501044_0190897 Ga0501044_0190897_256_1200 313
436 3300049823 Ga0501044_0346303 Ga0501044_0346303_169_1119 313
437 3300049824 Ga0501045_0005304 Ga0501045_0005304_2875_3825 313
438 3300050489 nmdc:mga03683_34683_c1 nmdc:mga03683_34683_c1_494_1435 313
439 3300050492 nmdc:mga0yw44_11553_c1 nmdc:mga0yw44_11553_c1_337_1278 313
440 3300050492 nmdc:mga0yw44_150999_c1 nmdc:mga0yw44_150999_c1_50_991 313
441 3300050492 nmdc:mga0yw44_36177_c1 nmdc:mga0yw44_36177_c1_986_1927 313
442 3300050492 nmdc:mga0yw44_55055_c1 nmdc:mga0yw44_55055_c1_54_995 313
443 3300053134 Ga0500658_0063262 Ga0500658_0063262_92_1033 313
444 3300053139 Ga0500568_0000052 Ga0500568_0000052_3028_3969 313
445 3300053151 Ga0500604_0061160 Ga0500604_0061160_15_956 313
446 3300053158 Ga0500627_0013430 Ga0500627_0013430_1353_2294 313

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09296

NUDIX-like

NADH pyrophosphatase-like rudimentary NUDIX domain

56

154

0.98

PF09297

zf-NADH-PPase

NADH pyrophosphatase zinc ribbon domain

156

187

0.98

PF00293

NUDIX

NUDIX domain

189

308

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wy6-assembly1.cif.gz_A crystal structure of atnudx1 (e56a) 0.8664 178 277
6ypf-assembly1.cif.gz_A nudix1 hydrolase from rosa x hybrida in complex with geranyl pyrophosphate 0.8654 178 279
4kyx-assembly1.cif.gz_A crystal structure of adp-ribose pyrophosphatase mutt from rickettsia felis 0.8507 178 279
5gp0-assembly1.cif.gz_I crystal structure of geraniol-nudx1 complex 0.8497 178 277
4kyx-assembly1.cif.gz_B crystal structure of adp-ribose pyrophosphatase mutt from rickettsia felis 0.8419 178 276
ID Description Score Start End Superfamily
af_I1MUA9_246_385_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9646 178 285 3.90.79.10
af_A0A0R4ISD4_291_431_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9597 178 311 3.90.79.10
af_Q94A82_242_424_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9338 178 313 3.90.79.10
af_Q9Y7J0_225_368_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9264 177 310 3.90.79.10
af_A4I7A0_174_307_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9231 178 309 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A7X6EJC4-F1-model_v4 deleted 0.964 198 313
AF-A0A358MEV2-F1-model_v4 NAD(+) diphosphatase (EC 3.6.1.22) 0.9525 199 305 GO:0005829
GO:0006734
GO:0006742
GO:0019677
GO:0035529
GO:0046872
AF-A0A3C0FX59-F1-model_v4 NAD(+) diphosphatase (EC 3.6.1.22) 0.9482 177 310 GO:0005829
GO:0006734
GO:0006742
GO:0019677
GO:0035529
GO:0046872
AF-A0A383CFI2-F1-model_v4 NAD(+) diphosphatase (EC 3.6.1.22) 0.9437 192 311 GO:0005777
GO:0005829
GO:0006734
GO:0006742
GO:0019677
GO:0035529
GO:0046872
AF-A0A7X6EJC4-F1-model_v4 deleted 0.9402 198 313

Feature Viewer

pLDDT pTM Quality
87.38 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map