F445618

General Info

Members Datasets Scaffolds Average Seq Length
445 181 890 208

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_134588_c1|nmdc:mga0n895_134588_c1_480_1109
Length 195
Sequence MQRFDIITEADARVLPRGETVMLARGGHVTPLAADTLRERRVLVIHEGGTSPDDSSLAPRAEIRTIAVGSDHTGAALRRRLVAFLRGRGLTVRDLGGEEGVVVDYPDVAASVATSVTRGESDAANKVAGVRAAMCTNETLARYSREHNGANVLTLGSTLVTADEAQAIVLTWLTTPMREPRYIRRLAKIRDLEKR

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
140 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
141 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
142 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
143 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
144 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
154 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
155 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
179 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.92
Rhizosphere 97.08
Stem 0
Stem Tuber 0
Unclassified 7.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_134588_c1 3300050512 Bacteria 2497
2 Ga0065712_10067826 3300005290 Bacteria 27846
3 Ga0065715_10001091 3300005293 Bacteria 9278
4 Ga0065707_10027415 3300005295 Unclassified 982
5 Ga0070676_10002514 3300005328 Bacteria 9414
6 Ga0070683_100596202 3300005329 Bacteria 1057
7 Ga0070690_100024456 3300005330 Bacteria 3713
8 Ga0070690_100026268 3300005330 Unclassified 3591
9 Ga0070670_100001157 3300005331 Bacteria 20903
10 Ga0070670_100047002 3300005331 Bacteria 3713
11 Ga0070677_10000434 3300005333 Bacteria 14385
12 Ga0070677_10136468 3300005333 Bacteria 1126
13 Ga0068869_100001429 3300005334 Bacteria 14144
14 Ga0068869_100009875 3300005334 Bacteria 6199
15 Ga0068869_100146541 3300005334 Bacteria 1828
16 Ga0068869_100323028 3300005334 Unclassified 1252
17 Ga0068869_100361786 3300005334 Bacteria 1185
18 Ga0068869_100392267 3300005334 Unclassified 1140
19 Ga0070666_10001709 3300005335 Bacteria 13392
20 Ga0070666_10015963 3300005335 Bacteria 4797
21 Ga0070666_10066121 3300005335 Bacteria 2453
22 Ga0070680_100461561 3300005336 Bacteria 1085
23 Ga0068868_100003970 3300005338 Bacteria 10329
24 Ga0068868_100043532 3300005338 Bacteria 3507
25 Ga0070689_100006234 3300005340 Bacteria 8231
26 Ga0070689_100079286 3300005340 Bacteria 2575
27 Ga0070689_100259469 3300005340 Bacteria 1436
28 Ga0070687_100002549 3300005343 Bacteria 6872
29 Ga0070687_100109151 3300005343 Bacteria 1563
30 Ga0070687_100468954 3300005343 Bacteria 841
31 Ga0070661_100013969 3300005344 Bacteria 5646
32 Ga0070661_100093566 3300005344 Bacteria 2227
33 Ga0070668_100039635 3300005347 Bacteria 3602
34 Ga0070668_100645007 3300005347 Bacteria 930
35 Ga0070669_100000985 3300005353 Bacteria 20776
36 Ga0070669_100013232 3300005353 Bacteria 5865
37 Ga0070669_100242373 3300005353 Bacteria 1433
38 Ga0070669_100478578 3300005353 Bacteria 1030
39 Ga0070669_100534166 3300005353 Bacteria 976
40 Ga0070675_100001019 3300005354 Bacteria 20145
41 Ga0070675_100018889 3300005354 Bacteria 5489
42 Ga0070675_100021726 3300005354 Bacteria 5127
43 Ga0070671_100007203 3300005355 Bacteria 8894
44 Ga0070674_100126576 3300005356 Bacteria 1899
45 Ga0070674_100154264 3300005356 Bacteria 1736
46 Ga0070674_100358454 3300005356 Bacteria 1180
47 Ga0070673_100040268 3300005364 Bacteria 3583
48 Ga0070673_100044033 3300005364 Bacteria 3453
49 Ga0070673_100427059 3300005364 Unclassified 1189
50 Ga0070688_100003136 3300005365 Bacteria 8455
51 Ga0070688_100025205 3300005365 Bacteria 3519
52 Ga0070659_100761875 3300005366 Unclassified 840
53 Ga0070667_100022694 3300005367 Bacteria 5204
54 Ga0070667_100116822 3300005367 Bacteria 2317
55 Ga0070667_100260051 3300005367 Bacteria 1554
56 Ga0070667_100294324 3300005367 Bacteria 1461
57 Ga0070701_10003750 3300005438 Bacteria 6071
58 Ga0070701_10012102 3300005438 Bacteria 3880
59 Ga0070705_100221196 3300005440 Bacteria 1311
60 Ga0070700_100010640 3300005441 Bacteria 5081
61 Ga0070700_100153854 3300005441 Bacteria 1576
62 Ga0070694_100002830 3300005444 Bacteria 10303
63 Ga0070694_100089460 3300005444 Bacteria 2157
64 Ga0070694_100387763 3300005444 Bacteria 1091
65 Ga0070708_100074638 3300005445 Bacteria 3059
66 Ga0070678_100032050 3300005456 Bacteria 3633
67 Ga0070678_100774009 3300005456 Unclassified 870
68 Ga0068867_100001729 3300005459 Bacteria 15211
69 Ga0068867_100067293 3300005459 Bacteria 2670
70 Ga0068867_100229525 3300005459 Bacteria 1500
71 Ga0068867_100819917 3300005459 Bacteria 831
72 Ga0070685_10023745 3300005466 Bacteria 3360
73 Ga0070685_10154317 3300005466 Bacteria 1458
74 Ga0070706_100652427 3300005467 Bacteria 977
75 Ga0070707_100012543 3300005468 Bacteria 7916
76 Ga0070697_100083836 3300005536 Bacteria 2629
77 Ga0070672_100001095 3300005543 Bacteria 16521
78 Ga0070672_100056887 3300005543 Bacteria 3069
79 Ga0070672_100105451 3300005543 Bacteria 2292
80 Ga0070672_100131015 3300005543 Bacteria 2061
81 Ga0070686_100005664 3300005544 Bacteria 6919
82 Ga0070686_100070430 3300005544 Bacteria 2287
83 Ga0070695_100207259 3300005545 Bacteria 1405
84 Ga0070695_100332288 3300005545 Bacteria 1133
85 Ga0070696_100074610 3300005546 Bacteria 2392
86 Ga0070665_100011255 3300005548 Bacteria 9048
87 Ga0070665_100015158 3300005548 Bacteria 7738
88 Ga0070665_100044465 3300005548 Bacteria 4460
89 Ga0070704_100119686 3300005549 Bacteria 2020
90 Ga0070704_100280065 3300005549 Bacteria 1381
91 Ga0070704_100621573 3300005549 Bacteria 951
92 Ga0070664_100002638 3300005564 Bacteria 14464
93 Ga0070664_100004803 3300005564 Bacteria 10831
94 Ga0070664_100054570 3300005564 Bacteria 3390
95 Ga0070664_100092572 3300005564 Bacteria 2618
96 Ga0070664_100591874 3300005564 Bacteria 1028
97 Ga0068854_100332778 3300005578 Bacteria 1238
98 Ga0068856_100309563 3300005614 Bacteria 1597
99 Ga0070702_100076810 3300005615 Bacteria 1989
100 Ga0070702_100294323 3300005615 Bacteria 1120
101 Ga0068852_100181419 3300005616 Bacteria 1980
102 Ga0068859_100004833 3300005617 Bacteria 13719
103 Ga0068859_100020533 3300005617 Bacteria 6629
104 Ga0068864_100024558 3300005618 Bacteria 5071
105 Ga0068864_100190253 3300005618 Bacteria 1881
106 Ga0068864_100223053 3300005618 Bacteria 1740
107 Ga0068864_100478016 3300005618 Unclassified 1195
108 Ga0068866_10113991 3300005718 Bacteria 1513
109 Ga0068861_100047545 3300005719 Bacteria 3239
110 Ga0068861_100081450 3300005719 Bacteria 2534
111 Ga0068861_100106100 3300005719 Bacteria 2243
112 Ga0068861_100606971 3300005719 Bacteria 1005
113 Ga0068870_10377438 3300005840 Bacteria 917
114 Ga0068863_100014491 3300005841 Bacteria 7592
115 Ga0068863_100022970 3300005841 Bacteria 5961
116 Ga0068863_100085412 3300005841 Bacteria 2991
117 Ga0068863_100129213 3300005841 Bacteria 2412
118 Ga0068858_100024275 3300005842 Bacteria 5651
119 Ga0068858_100028800 3300005842 Bacteria 5157
120 Ga0068858_100191886 3300005842 Bacteria 1930
121 Ga0068860_100003450 3300005843 Bacteria 16260
122 Ga0068860_100312255 3300005843 Bacteria 1542
123 Ga0068862_101247424 3300005844 Bacteria 743
124 Ga0081539_10003749 3300005985 Bacteria 18053
125 Ga0081539_10107171 3300005985 Bacteria 1413
126 Ga0070716_100285454 3300006173 Bacteria 1141
127 Ga0097621_100036288 3300006237 Bacteria 3944
128 Ga0097621_100240643 3300006237 Bacteria 1582
129 Ga0097621_100476243 3300006237 Bacteria 1128
130 Ga0068871_100012716 3300006358 Bacteria 6222
131 Ga0068871_100026556 3300006358 Bacteria 4519
132 Ga0068871_100042953 3300006358 Bacteria 3631
133 Ga0068871_100090622 3300006358 Bacteria 2547
134 Ga0075428_100026289 3300006844 Bacteria 6445
135 Ga0075428_100180687 3300006844 Bacteria 2284
136 Ga0075428_101052180 3300006844 Bacteria 860
137 Ga0075428_101244293 3300006844 Unclassified 784
138 Ga0075430_100001195 3300006846 Bacteria 20824
139 Ga0075431_100097745 3300006847 Bacteria 3032
140 Ga0075431_100323811 3300006847 Bacteria 1554
141 Ga0075433_10000087 3300006852 Bacteria 42396
142 Ga0075433_10000414 3300006852 Bacteria 27216
143 Ga0075433_10015183 3300006852 Bacteria 6311
144 Ga0075433_10107739 3300006852 Bacteria 2471
145 Ga0075434_100000626 3300006871 Bacteria 27295
146 Ga0075434_100012503 3300006871 Bacteria 8052
147 Ga0075434_100012663 3300006871 Bacteria 7999
148 Ga0075434_100040577 3300006871 Bacteria 4609
149 Ga0075434_100208665 3300006871 Bacteria 1974
150 Ga0075429_100043050 3300006880 Bacteria 3929
151 Ga0075429_100126501 3300006880 Bacteria 2235
152 Ga0075429_100233616 3300006880 Bacteria 1611
153 Ga0075429_101160181 3300006880 Unclassified 674
154 Ga0068865_100012806 3300006881 Bacteria 5287
155 Ga0068865_100266930 3300006881 Bacteria 1357
156 Ga0068865_100318220 3300006881 Unclassified 1251
157 Ga0068865_100670014 3300006881 Unclassified 883
158 Ga0075436_100000266 3300006914 Bacteria 32724
159 Ga0075436_100306695 3300006914 Bacteria 1138
160 Ga0075436_100358299 3300006914 Unclassified 1052
161 Ga0097620_100004833 3300006931 Bacteria 13719
162 Ga0097620_100020533 3300006931 Bacteria 6629
163 Ga0075435_100000009 3300007076 Bacteria 114381
164 Ga0075435_100015712 3300007076 Bacteria 5695
165 Ga0075435_100033442 3300007076 Bacteria 4066
166 Ga0075435_100040052 3300007076 Bacteria 3741
167 Ga0075435_100332219 3300007076 Bacteria 1302
168 Ga0111539_10000161 3300009094 Bacteria 76584
169 Ga0111539_10011889 3300009094 Bacteria 10910
170 Ga0111539_10016933 3300009094 Bacteria 9022
171 Ga0111539_10026054 3300009094 Bacteria 7157
172 Ga0111539_10094462 3300009094 Bacteria 3513
173 Ga0111539_10285762 3300009094 Bacteria 1920
174 Ga0105245_10053672 3300009098 Bacteria 3618
175 Ga0105245_10069305 3300009098 Bacteria 3198
176 Ga0105245_10149671 3300009098 Bacteria 2206
177 Ga0105245_10158901 3300009098 Bacteria 2143
178 Ga0105245_10328879 3300009098 Bacteria 1508
179 Ga0105245_10425865 3300009098 Bacteria 1331
180 Ga0105245_11001609 3300009098 Bacteria 880
181 Ga0105247_10195887 3300009101 Bacteria 1355
182 Ga0105247_10258819 3300009101 Bacteria 1192
183 Ga0114129_10008842 3300009147 Bacteria 14372
184 Ga0114129_10012536 3300009147 Bacteria 12073
185 Ga0114129_10023167 3300009147 Bacteria 8807
186 Ga0114129_10133974 3300009147 Bacteria 3401
187 Ga0114129_10203181 3300009147 Bacteria 2682
188 Ga0114129_10322850 3300009147 Unclassified 2052
189 Ga0114129_11049477 3300009147 Bacteria 1023
190 Ga0105243_10015170 3300009148 Bacteria 5831
191 Ga0105243_10714442 3300009148 Bacteria 978
192 Ga0105243_11268619 3300009148 Unclassified 753
193 Ga0105241_10039584 3300009174 Bacteria 3556
194 Ga0105242_10020323 3300009176 Bacteria 5206
195 Ga0105242_10022829 3300009176 Bacteria 4926
196 Ga0105242_10037605 3300009176 Bacteria 3888
197 Ga0105242_10088761 3300009176 Bacteria 2598
198 Ga0105242_10127881 3300009176 Bacteria 2189
199 Ga0105242_10277838 3300009176 Bacteria 1520
200 Ga0105248_10019547 3300009177 Bacteria 7497
201 Ga0105248_10023221 3300009177 Bacteria 6888
202 Ga0105248_10070590 3300009177 Bacteria 3922
203 Ga0105248_10164328 3300009177 Bacteria 2503
204 Ga0105248_10190659 3300009177 Bacteria 2310
205 Ga0105248_10747120 3300009177 Bacteria 1104
206 Ga0105249_10000849 3300009553 Bacteria 27295
207 Ga0105249_10321609 3300009553 Bacteria 1558
208 Ga0105249_10418419 3300009553 Unclassified 1373
209 Ga0105246_10039091 3300011119 Bacteria 3193
210 Ga0157374_10030541 3300013296 Bacteria 4894
211 Ga0163162_10182118 3300013306 Bacteria 2227
212 Ga0163162_10538849 3300013306 Bacteria 1296
213 Ga0163162_10992678 3300013306 Bacteria 949
214 Ga0157375_10590832 3300013308 Bacteria 1270
215 Ga0157375_10979438 3300013308 Bacteria 986
216 Ga0157375_11146392 3300013308 Unclassified 911
217 Ga0163163_10008809 3300014325 Bacteria 8982
218 Ga0163163_10021206 3300014325 Bacteria 6128
219 Ga0163163_10318469 3300014325 Bacteria 1609
220 Ga0163163_10373774 3300014325 Bacteria 1482
221 Ga0157380_10007939 3300014326 Bacteria 7556
222 Ga0157380_10016962 3300014326 Bacteria 5380
223 Ga0157380_10062355 3300014326 Bacteria 2986
224 Ga0157380_10071915 3300014326 Bacteria 2799
225 Ga0157380_10209611 3300014326 Bacteria 1735
226 Ga0157380_10331557 3300014326 Bacteria 1415
227 Ga0157380_10489562 3300014326 Bacteria 1192
228 Ga0157377_10044302 3300014745 Bacteria 2480
229 Ga0157379_10027012 3300014968 Bacteria 5108
230 Ga0157379_10053237 3300014968 Bacteria 3616
231 Ga0157376_10177108 3300014969 Bacteria 1946
232 Ga0157376_10202563 3300014969 Bacteria 1827
233 Ga0207673_1006520 3300025290 Bacteria 1446
234 Ga0207697_10000700 3300025315 Bacteria 19071
235 Ga0207682_10001270 3300025893 Bacteria 11594
236 Ga0207710_10260627 3300025900 Unclassified 869
237 Ga0207688_10004180 3300025901 Bacteria 7866
238 Ga0207680_10008194 3300025903 Bacteria 5121
239 Ga0207680_10066318 3300025903 Bacteria 2220
240 Ga0207680_10095313 3300025903 Bacteria 1901
241 Ga0207685_10094764 3300025905 Bacteria 1265
242 Ga0207699_10035634 3300025906 Bacteria 2832
243 Ga0207645_10002538 3300025907 Bacteria 14289
244 Ga0207645_10006287 3300025907 Bacteria 8537
245 Ga0207643_10000138 3300025908 Bacteria 49379
246 Ga0207643_10050644 3300025908 Bacteria 2355
247 Ga0207643_10077683 3300025908 Bacteria 1919
248 Ga0207705_10450461 3300025909 Unclassified 998
249 Ga0207662_10001333 3300025918 Bacteria 11911
250 Ga0207662_10117297 3300025918 Bacteria 1666
251 Ga0207657_10414096 3300025919 Bacteria 1060
252 Ga0207649_10013889 3300025920 Bacteria 4505
253 Ga0207649_10156929 3300025920 Bacteria 1573
254 Ga0207649_10215049 3300025920 Bacteria 1366
255 Ga0207646_10164131 3300025922 Bacteria 2005
256 Ga0207681_10019145 3300025923 Bacteria 4322
257 Ga0207681_10071627 3300025923 Bacteria 2418
258 Ga0207681_10093885 3300025923 Bacteria 2149
259 Ga0207681_10525690 3300025923 Bacteria 971
260 Ga0207650_10001847 3300025925 Bacteria 14927
261 Ga0207659_10001457 3300025926 Bacteria 14140
262 Ga0207659_10003705 3300025926 Bacteria 9214
263 Ga0207659_10010656 3300025926 Bacteria 5780
264 Ga0207659_10011494 3300025926 Bacteria 5593
265 Ga0207659_10011758 3300025926 Bacteria 5541
266 Ga0207659_10049431 3300025926 Bacteria 2983
267 Ga0207659_10157875 3300025926 Bacteria 1778
268 Ga0207687_10046109 3300025927 Bacteria 3016
269 Ga0207687_10126203 3300025927 Bacteria 1921
270 Ga0207687_10161632 3300025927 Bacteria 1719
271 Ga0207687_10211603 3300025927 Bacteria 1521
272 Ga0207687_10312045 3300025927 Bacteria 1270
273 Ga0207644_10004034 3300025931 Bacteria 9527
274 Ga0207706_10002156 3300025933 Bacteria 19227
275 Ga0207686_10003019 3300025934 Bacteria 9069
276 Ga0207686_10477809 3300025934 Bacteria 963
277 Ga0207686_10566274 3300025934 Unclassified 890
278 Ga0207709_10011708 3300025935 Bacteria 4837
279 Ga0207709_10110313 3300025935 Bacteria 1838
280 Ga0207670_10005191 3300025936 Bacteria 7124
281 Ga0207670_10661442 3300025936 Bacteria 862
282 Ga0207670_10930520 3300025936 Bacteria 729
283 Ga0207669_10011625 3300025937 Bacteria 4292
284 Ga0207669_10311734 3300025937 Bacteria 1200
285 Ga0207704_10002413 3300025938 Bacteria 8406
286 Ga0207704_10247918 3300025938 Bacteria 1335
287 Ga0207704_10270865 3300025938 Bacteria 1286
288 Ga0207704_10296607 3300025938 Bacteria 1236
289 Ga0207691_10002649 3300025940 Bacteria 17491
290 Ga0207691_10018147 3300025940 Bacteria 6665
291 Ga0207691_10028470 3300025940 Bacteria 5232
292 Ga0207691_10069065 3300025940 Bacteria 3192
293 Ga0207691_10092617 3300025940 Bacteria 2706
294 Ga0207711_10033242 3300025941 Bacteria 4363
295 Ga0207711_10101736 3300025941 Bacteria 2543
296 Ga0207711_10190414 3300025941 Bacteria 1869
297 Ga0207711_10420961 3300025941 Unclassified 1242
298 Ga0207711_10431364 3300025941 Bacteria 1226
299 Ga0207689_10001347 3300025942 Bacteria 23609
300 Ga0207689_10008111 3300025942 Bacteria 9161
301 Ga0207689_10092992 3300025942 Bacteria 2477
302 Ga0207689_10223107 3300025942 Bacteria 1557
303 Ga0207679_10137860 3300025945 Bacteria 1967
304 Ga0207651_10005003 3300025960 Bacteria 6759
305 Ga0207651_10007223 3300025960 Bacteria 5906
306 Ga0207651_10065420 3300025960 Bacteria 2549
307 Ga0207651_10161505 3300025960 Bacteria 1757
308 Ga0207651_10178073 3300025960 Bacteria 1684
309 Ga0207712_10009601 3300025961 Bacteria 6127
310 Ga0207712_10402010 3300025961 Unclassified 1151
311 Ga0207712_10558505 3300025961 Bacteria 985
312 Ga0207668_10585128 3300025972 Bacteria 971
313 Ga0207658_10010408 3300025986 Bacteria 6318
314 Ga0207658_10057155 3300025986 Bacteria 2898
315 Ga0207658_10222502 3300025986 Bacteria 1589
316 Ga0207677_10028815 3300026023 Bacteria 3519
317 Ga0207677_10051405 3300026023 Unclassified 2794
318 Ga0207677_10086281 3300026023 Bacteria 2268
319 Ga0207703_10062857 3300026035 Bacteria 3042
320 Ga0207703_10148233 3300026035 Bacteria 2043
321 Ga0207703_10240138 3300026035 Bacteria 1629
322 Ga0207703_10471115 3300026035 Bacteria 1176
323 Ga0207708_10029599 3300026075 Bacteria 4151
324 Ga0207708_10569150 3300026075 Bacteria 957
325 Ga0207641_10028218 3300026088 Bacteria 4636
326 Ga0207641_10158116 3300026088 Bacteria 2058
327 Ga0207641_10448503 3300026088 Bacteria 1246
328 Ga0207648_10001667 3300026089 Bacteria 24343
329 Ga0207648_10033002 3300026089 Bacteria 4568
330 Ga0207648_10059553 3300026089 Bacteria 3330
331 Ga0207648_10281115 3300026089 Bacteria 1488
332 Ga0207648_10332091 3300026089 Bacteria 1368
333 Ga0207676_10009893 3300026095 Bacteria 6784
334 Ga0207676_10039823 3300026095 Bacteria 3598
335 Ga0207676_10131305 3300026095 Bacteria 2130
336 Ga0207676_10161872 3300026095 Bacteria 1940
337 Ga0207676_10717165 3300026095 Bacteria 970
338 Ga0207675_100003681 3300026118 Bacteria 14938
339 Ga0207675_100027414 3300026118 Bacteria 5306
340 Ga0207675_100111678 3300026118 Bacteria 2579
341 Ga0207675_100190162 3300026118 Bacteria 1969
342 Ga0207675_100217815 3300026118 Bacteria 1838
343 Ga0207675_100460877 3300026118 Bacteria 1261
344 Ga0207683_10017416 3300026121 Bacteria 6124
345 Ga0207683_10070562 3300026121 Bacteria 3087
346 Ga0207683_10247703 3300026121 Bacteria 1626
347 Ga0207698_10191963 3300026142 Bacteria 1820
348 Ga0210002_1027233 3300027617 Unclassified 941
349 Ga0209974_10011030 3300027876 Bacteria 3042
350 Ga0209974_10065407 3300027876 Bacteria 1235
351 Ga0207428_10006937 3300027907 Bacteria 10379
352 Ga0207428_10040990 3300027907 Bacteria 3751
353 Ga0268266_10044128 3300028379 Bacteria 3810
354 Ga0268265_10029973 3300028380 Bacteria 3914
355 Ga0268265_10473989 3300028380 Bacteria 1174
356 Ga0268265_10483043 3300028380 Unclassified 1164
357 Ga0268264_11161142 3300028381 Bacteria 781
358 Ga0307409_100673752 3300031995 Bacteria 1031
359 Ga0373929_0052049 3300035085 Unclassified 938
360 Ga0373940_0085857 3300035088 Bacteria 937
361 Ga0373949_0022951 3300035090 Bacteria 1442
362 Ga0373932_0016075 3300035112 Bacteria 1906
363 Ga0373939_0013721 3300035114 Bacteria 2090
364 Ga0373960_0032379 3300035121 Bacteria 1468
365 Ga0373955_0051497 3300035172 Bacteria 2243
366 Ga0373955_0191853 3300035172 Bacteria 1215
367 Ga0373962_0012723 3300035242 Bacteria 2124
368 Ga0373962_0079520 3300035242 Bacteria 993
369 Ga0373931_0195593 3300035691 Bacteria 1205
370 Ga0373931_0311332 3300035691 Unclassified 975
371 Ga0439433_0011938 3300041999 Bacteria 1903
372 Ga0451576_0272649 3300045051 Bacteria 1769
373 Ga0451576_1198266 3300045051 Bacteria 793
374 Ga0495603_0452997 3300046455 Bacteria 735
375 Ga0495580_0397866 3300046472 Bacteria 929
376 Ga0495594_0062723 3300046499 Bacteria 2058
377 Ga0495598_0100828 3300046537 Bacteria 955
378 Ga0495656_0035759 3300046615 Bacteria 2042
379 Ga0495656_0127344 3300046615 Unclassified 1209
380 Ga0495659_0063743 3300046664 Bacteria 1367
381 Ga0495658_0046335 3300046683 Bacteria 2444
382 Ga0495674_0364025 3300047319 Bacteria 1172
383 Ga0496100_0023812 3300048903 Bacteria 3726
384 Ga0496100_0244315 3300048903 Bacteria 1326
385 Ga0496101_0001450 3300048904 Bacteria 14154
386 Ga0496102_0214851 3300048905 Bacteria 1812
387 Ga0496104_0030810 3300048907 Bacteria 4987
388 Ga0496104_0380922 3300048907 Bacteria 1323
389 Ga0496104_1032076 3300048907 Bacteria 726
390 Ga0496107_0742930 3300048910 Bacteria 720
391 Ga0496108_0724637 3300048911 Bacteria 861
392 Ga0496109_0054505 3300048912 Bacteria 3648
393 Ga0496109_0609571 3300048912 Bacteria 1028
394 Ga0496114_0012458 3300048917 Bacteria 6807
395 Ga0496114_0280559 3300048917 Bacteria 1469
396 Ga0501040_1019930 3300049576 Unclassified 600
397 Ga0501048_0125196 3300049582 Bacteria 1817
398 Ga0501072_0076863 3300049588 Bacteria 2642
399 Ga0501076_0323324 3300049592 Unclassified 1265
400 Ga0501081_0004819 3300049743 Bacteria 8671
401 Ga0501081_0295373 3300049743 Bacteria 1188
402 nmdc:mga05p37_1189558_c1 3300050507 Bacteria 789
403 nmdc:mga05p37_133704_c1 3300050507 Bacteria 3043
404 nmdc:mga05p37_189705_c1 3300050507 Bacteria 2496
405 nmdc:mga05p37_24822_c1 3300050507 Bacteria 6265
406 nmdc:mga05p37_48514_c1 3300050507 Bacteria 5222
407 nmdc:mga05p37_711521_c1 3300050507 Bacteria 1114
408 nmdc:mga05p37_762036_c1 3300050507 Bacteria 1065
409 nmdc:mga05p37_82816_c1 3300050507 Bacteria 3953
410 nmdc:mga09592_21714_c1 3300050508 Bacteria 5292
411 nmdc:mga09592_24939_c1 3300050508 Bacteria 4946
412 nmdc:mga09592_84262_c1 3300050508 Bacteria 2710
413 nmdc:mga0qj67_1228_c1 3300050509 Bacteria 17870
414 nmdc:mga0qj67_317200_c1 3300050509 Bacteria 1262
415 nmdc:mga06r32_1311_c1 3300050510 Bacteria 22452
416 nmdc:mga06r32_988661_c1 3300050510 Bacteria 794
417 nmdc:mga08y16_11410_c1 3300050511 Bacteria 9336
418 nmdc:mga08y16_1170_c1 3300050511 Bacteria 25854
419 nmdc:mga08y16_16556_c1 3300050511 Bacteria 7755
420 nmdc:mga08y16_211895_c1 3300050511 Bacteria 2007
421 nmdc:mga08y16_52006_c1 3300050511 Bacteria 4286
422 nmdc:mga0n895_121784_c1 3300050512 Bacteria 2630
423 nmdc:mga0n895_19525_c1 3300050512 Bacteria 6301
424 nmdc:mga0n895_38241_c1 3300050512 Unclassified 4648
425 nmdc:mga0n895_570204_c1 3300050512 Bacteria 1137
426 nmdc:mga0n895_76_c1 3300050512 Bacteria 56942
427 nmdc:mga0rr50_105686_c1 3300050513 Bacteria 2220
428 nmdc:mga0rr50_11116_c1 3300050513 Bacteria 5745
429 nmdc:mga0rr50_174356_c1 3300050513 Unclassified 1754
430 nmdc:mga0rr50_25_c1 3300050513 Bacteria 114931
431 nmdc:mga0rr50_3825_c1 3300050513 Bacteria 8739
432 nmdc:mga0rr50_386219_c1 3300050513 Bacteria 1181
433 nmdc:mga0rr50_433484_c1 3300050513 Bacteria 1113
434 nmdc:mga08x19_13897_c1 3300050514 Bacteria 4876
435 nmdc:mga08x19_339_c1 3300050514 Bacteria 33785
436 nmdc:mga08x19_43329_c1 3300050514 Bacteria 2871
437 nmdc:mga0a205_151_c1 3300050515 Bacteria 29511
438 nmdc:mga0a205_169673_c1 3300050515 Bacteria 2078
439 nmdc:mga0a205_17824_c1 3300050515 Bacteria 6665
440 nmdc:mga0a205_5532_c1 3300050515 Bacteria 11382
441 nmdc:mga0a205_58538_c1 3300050515 Bacteria 3721
442 nmdc:mga0a205_6986_c1 3300050515 Bacteria 10203
443 Ga0495595_0261727 3300053084 Bacteria 867
444 Ga0501084_0211043 3300054114 Bacteria 1638
445 Ga0590075_004621 3300059424 Bacteria 3260
446 nmdc:mga0n895_134588_c1
447 Ga0065712_10067826
448 Ga0065715_10001091
449 Ga0065707_10027415
450 Ga0070676_10002514
451 Ga0070683_100596202
452 Ga0070690_100024456
453 Ga0070690_100026268
454 Ga0070670_100001157
455 Ga0070670_100047002
456 Ga0070677_10000434
457 Ga0070677_10136468
458 Ga0068869_100001429
459 Ga0068869_100009875
460 Ga0068869_100146541
461 Ga0068869_100323028
462 Ga0068869_100361786
463 Ga0068869_100392267
464 Ga0070666_10001709
465 Ga0070666_10015963
466 Ga0070666_10066121
467 Ga0070680_100461561
468 Ga0068868_100003970
469 Ga0068868_100043532
470 Ga0070689_100006234
471 Ga0070689_100079286
472 Ga0070689_100259469
473 Ga0070687_100002549
474 Ga0070687_100109151
475 Ga0070687_100468954
476 Ga0070661_100013969
477 Ga0070661_100093566
478 Ga0070668_100039635
479 Ga0070668_100645007
480 Ga0070669_100000985
481 Ga0070669_100013232
482 Ga0070669_100242373
483 Ga0070669_100478578
484 Ga0070669_100534166
485 Ga0070675_100001019
486 Ga0070675_100018889
487 Ga0070675_100021726
488 Ga0070671_100007203
489 Ga0070674_100126576
490 Ga0070674_100154264
491 Ga0070674_100358454
492 Ga0070673_100040268
493 Ga0070673_100044033
494 Ga0070673_100427059
495 Ga0070688_100003136
496 Ga0070688_100025205
497 Ga0070659_100761875
498 Ga0070667_100022694
499 Ga0070667_100116822
500 Ga0070667_100260051
501 Ga0070667_100294324
502 Ga0070701_10003750
503 Ga0070701_10012102
504 Ga0070705_100221196
505 Ga0070700_100010640
506 Ga0070700_100153854
507 Ga0070694_100002830
508 Ga0070694_100089460
509 Ga0070694_100387763
510 Ga0070708_100074638
511 Ga0070678_100032050
512 Ga0070678_100774009
513 Ga0068867_100001729
514 Ga0068867_100067293
515 Ga0068867_100229525
516 Ga0068867_100819917
517 Ga0070685_10023745
518 Ga0070685_10154317
519 Ga0070706_100652427
520 Ga0070707_100012543
521 Ga0070697_100083836
522 Ga0070672_100001095
523 Ga0070672_100056887
524 Ga0070672_100105451
525 Ga0070672_100131015
526 Ga0070686_100005664
527 Ga0070686_100070430
528 Ga0070695_100207259
529 Ga0070695_100332288
530 Ga0070696_100074610
531 Ga0070665_100011255
532 Ga0070665_100015158
533 Ga0070665_100044465
534 Ga0070704_100119686
535 Ga0070704_100280065
536 Ga0070704_100621573
537 Ga0070664_100002638
538 Ga0070664_100004803
539 Ga0070664_100054570
540 Ga0070664_100092572
541 Ga0070664_100591874
542 Ga0068854_100332778
543 Ga0068856_100309563
544 Ga0070702_100076810
545 Ga0070702_100294323
546 Ga0068852_100181419
547 Ga0068859_100004833
548 Ga0068859_100020533
549 Ga0068864_100024558
550 Ga0068864_100190253
551 Ga0068864_100223053
552 Ga0068864_100478016
553 Ga0068866_10113991
554 Ga0068861_100047545
555 Ga0068861_100081450
556 Ga0068861_100106100
557 Ga0068861_100606971
558 Ga0068870_10377438
559 Ga0068863_100014491
560 Ga0068863_100022970
561 Ga0068863_100085412
562 Ga0068863_100129213
563 Ga0068858_100024275
564 Ga0068858_100028800
565 Ga0068858_100191886
566 Ga0068860_100003450
567 Ga0068860_100312255
568 Ga0068862_101247424
569 Ga0081539_10003749
570 Ga0081539_10107171
571 Ga0070716_100285454
572 Ga0097621_100036288
573 Ga0097621_100240643
574 Ga0097621_100476243
575 Ga0068871_100012716
576 Ga0068871_100026556
577 Ga0068871_100042953
578 Ga0068871_100090622
579 Ga0075428_100026289
580 Ga0075428_100180687
581 Ga0075428_101052180
582 Ga0075428_101244293
583 Ga0075430_100001195
584 Ga0075431_100097745
585 Ga0075431_100323811
586 Ga0075433_10000087
587 Ga0075433_10000414
588 Ga0075433_10015183
589 Ga0075433_10107739
590 Ga0075434_100000626
591 Ga0075434_100012503
592 Ga0075434_100012663
593 Ga0075434_100040577
594 Ga0075434_100208665
595 Ga0075429_100043050
596 Ga0075429_100126501
597 Ga0075429_100233616
598 Ga0075429_101160181
599 Ga0068865_100012806
600 Ga0068865_100266930
601 Ga0068865_100318220
602 Ga0068865_100670014
603 Ga0075436_100000266
604 Ga0075436_100306695
605 Ga0075436_100358299
606 Ga0097620_100004833
607 Ga0097620_100020533
608 Ga0075435_100000009
609 Ga0075435_100015712
610 Ga0075435_100033442
611 Ga0075435_100040052
612 Ga0075435_100332219
613 Ga0111539_10000161
614 Ga0111539_10011889
615 Ga0111539_10016933
616 Ga0111539_10026054
617 Ga0111539_10094462
618 Ga0111539_10285762
619 Ga0105245_10053672
620 Ga0105245_10069305
621 Ga0105245_10149671
622 Ga0105245_10158901
623 Ga0105245_10328879
624 Ga0105245_10425865
625 Ga0105245_11001609
626 Ga0105247_10195887
627 Ga0105247_10258819
628 Ga0114129_10008842
629 Ga0114129_10012536
630 Ga0114129_10023167
631 Ga0114129_10133974
632 Ga0114129_10203181
633 Ga0114129_10322850
634 Ga0114129_11049477
635 Ga0105243_10015170
636 Ga0105243_10714442
637 Ga0105243_11268619
638 Ga0105241_10039584
639 Ga0105242_10020323
640 Ga0105242_10022829
641 Ga0105242_10037605
642 Ga0105242_10088761
643 Ga0105242_10127881
644 Ga0105242_10277838
645 Ga0105248_10019547
646 Ga0105248_10023221
647 Ga0105248_10070590
648 Ga0105248_10164328
649 Ga0105248_10190659
650 Ga0105248_10747120
651 Ga0105249_10000849
652 Ga0105249_10321609
653 Ga0105249_10418419
654 Ga0105246_10039091
655 Ga0157374_10030541
656 Ga0163162_10182118
657 Ga0163162_10538849
658 Ga0163162_10992678
659 Ga0157375_10590832
660 Ga0157375_10979438
661 Ga0157375_11146392
662 Ga0163163_10008809
663 Ga0163163_10021206
664 Ga0163163_10318469
665 Ga0163163_10373774
666 Ga0157380_10007939
667 Ga0157380_10016962
668 Ga0157380_10062355
669 Ga0157380_10071915
670 Ga0157380_10209611
671 Ga0157380_10331557
672 Ga0157380_10489562
673 Ga0157377_10044302
674 Ga0157379_10027012
675 Ga0157379_10053237
676 Ga0157376_10177108
677 Ga0157376_10202563
678 Ga0207673_1006520
679 Ga0207697_10000700
680 Ga0207682_10001270
681 Ga0207710_10260627
682 Ga0207688_10004180
683 Ga0207680_10008194
684 Ga0207680_10066318
685 Ga0207680_10095313
686 Ga0207685_10094764
687 Ga0207699_10035634
688 Ga0207645_10002538
689 Ga0207645_10006287
690 Ga0207643_10000138
691 Ga0207643_10050644
692 Ga0207643_10077683
693 Ga0207705_10450461
694 Ga0207662_10001333
695 Ga0207662_10117297
696 Ga0207657_10414096
697 Ga0207649_10013889
698 Ga0207649_10156929
699 Ga0207649_10215049
700 Ga0207646_10164131
701 Ga0207681_10019145
702 Ga0207681_10071627
703 Ga0207681_10093885
704 Ga0207681_10525690
705 Ga0207650_10001847
706 Ga0207659_10001457
707 Ga0207659_10003705
708 Ga0207659_10010656
709 Ga0207659_10011494
710 Ga0207659_10011758
711 Ga0207659_10049431
712 Ga0207659_10157875
713 Ga0207687_10046109
714 Ga0207687_10126203
715 Ga0207687_10161632
716 Ga0207687_10211603
717 Ga0207687_10312045
718 Ga0207644_10004034
719 Ga0207706_10002156
720 Ga0207686_10003019
721 Ga0207686_10477809
722 Ga0207686_10566274
723 Ga0207709_10011708
724 Ga0207709_10110313
725 Ga0207670_10005191
726 Ga0207670_10661442
727 Ga0207670_10930520
728 Ga0207669_10011625
729 Ga0207669_10311734
730 Ga0207704_10002413
731 Ga0207704_10247918
732 Ga0207704_10270865
733 Ga0207704_10296607
734 Ga0207691_10002649
735 Ga0207691_10018147
736 Ga0207691_10028470
737 Ga0207691_10069065
738 Ga0207691_10092617
739 Ga0207711_10033242
740 Ga0207711_10101736
741 Ga0207711_10190414
742 Ga0207711_10420961
743 Ga0207711_10431364
744 Ga0207689_10001347
745 Ga0207689_10008111
746 Ga0207689_10092992
747 Ga0207689_10223107
748 Ga0207679_10137860
749 Ga0207651_10005003
750 Ga0207651_10007223
751 Ga0207651_10065420
752 Ga0207651_10161505
753 Ga0207651_10178073
754 Ga0207712_10009601
755 Ga0207712_10402010
756 Ga0207712_10558505
757 Ga0207668_10585128
758 Ga0207658_10010408
759 Ga0207658_10057155
760 Ga0207658_10222502
761 Ga0207677_10028815
762 Ga0207677_10051405
763 Ga0207677_10086281
764 Ga0207703_10062857
765 Ga0207703_10148233
766 Ga0207703_10240138
767 Ga0207703_10471115
768 Ga0207708_10029599
769 Ga0207708_10569150
770 Ga0207641_10028218
771 Ga0207641_10158116
772 Ga0207641_10448503
773 Ga0207648_10001667
774 Ga0207648_10033002
775 Ga0207648_10059553
776 Ga0207648_10281115
777 Ga0207648_10332091
778 Ga0207676_10009893
779 Ga0207676_10039823
780 Ga0207676_10131305
781 Ga0207676_10161872
782 Ga0207676_10717165
783 Ga0207675_100003681
784 Ga0207675_100027414
785 Ga0207675_100111678
786 Ga0207675_100190162
787 Ga0207675_100217815
788 Ga0207675_100460877
789 Ga0207683_10017416
790 Ga0207683_10070562
791 Ga0207683_10247703
792 Ga0207698_10191963
793 Ga0210002_1027233
794 Ga0209974_10011030
795 Ga0209974_10065407
796 Ga0207428_10006937
797 Ga0207428_10040990
798 Ga0268266_10044128
799 Ga0268265_10029973
800 Ga0268265_10473989
801 Ga0268265_10483043
802 Ga0268264_11161142
803 Ga0307409_100673752
804 Ga0373929_0052049
805 Ga0373940_0085857
806 Ga0373949_0022951
807 Ga0373932_0016075
808 Ga0373939_0013721
809 Ga0373960_0032379
810 Ga0373955_0051497
811 Ga0373955_0191853
812 Ga0373962_0012723
813 Ga0373962_0079520
814 Ga0373931_0195593
815 Ga0373931_0311332
816 Ga0439433_0011938
817 Ga0451576_0272649
818 Ga0451576_1198266
819 Ga0495603_0452997
820 Ga0495580_0397866
821 Ga0495594_0062723
822 Ga0495598_0100828
823 Ga0495656_0035759
824 Ga0495656_0127344
825 Ga0495659_0063743
826 Ga0495658_0046335
827 Ga0495674_0364025
828 Ga0496100_0023812
829 Ga0496100_0244315
830 Ga0496101_0001450
831 Ga0496102_0214851
832 Ga0496104_0030810
833 Ga0496104_0380922
834 Ga0496104_1032076
835 Ga0496107_0742930
836 Ga0496108_0724637
837 Ga0496109_0054505
838 Ga0496109_0609571
839 Ga0496114_0012458
840 Ga0496114_0280559
841 Ga0501040_1019930
842 Ga0501048_0125196
843 Ga0501072_0076863
844 Ga0501076_0323324
845 Ga0501081_0004819
846 Ga0501081_0295373
847 nmdc:mga05p37_1189558_c1
848 nmdc:mga05p37_133704_c1
849 nmdc:mga05p37_189705_c1
850 nmdc:mga05p37_24822_c1
851 nmdc:mga05p37_48514_c1
852 nmdc:mga05p37_711521_c1
853 nmdc:mga05p37_762036_c1
854 nmdc:mga05p37_82816_c1
855 nmdc:mga09592_21714_c1
856 nmdc:mga09592_24939_c1
857 nmdc:mga09592_84262_c1
858 nmdc:mga0qj67_1228_c1
859 nmdc:mga0qj67_317200_c1
860 nmdc:mga06r32_1311_c1
861 nmdc:mga06r32_988661_c1
862 nmdc:mga08y16_11410_c1
863 nmdc:mga08y16_1170_c1
864 nmdc:mga08y16_16556_c1
865 nmdc:mga08y16_211895_c1
866 nmdc:mga08y16_52006_c1
867 nmdc:mga0n895_121784_c1
868 nmdc:mga0n895_19525_c1
869 nmdc:mga0n895_38241_c1
870 nmdc:mga0n895_570204_c1
871 nmdc:mga0n895_76_c1
872 nmdc:mga0rr50_105686_c1
873 nmdc:mga0rr50_11116_c1
874 nmdc:mga0rr50_174356_c1
875 nmdc:mga0rr50_25_c1
876 nmdc:mga0rr50_3825_c1
877 nmdc:mga0rr50_386219_c1
878 nmdc:mga0rr50_433484_c1
879 nmdc:mga08x19_13897_c1
880 nmdc:mga08x19_339_c1
881 nmdc:mga08x19_43329_c1
882 nmdc:mga0a205_151_c1
883 nmdc:mga0a205_169673_c1
884 nmdc:mga0a205_17824_c1
885 nmdc:mga0a205_5532_c1
886 nmdc:mga0a205_58538_c1
887 nmdc:mga0a205_6986_c1
888 Ga0495595_0261727
889 Ga0501084_0211043
890 Ga0590075_004621

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02502

LacAB_rpiB

Ribose/Galactose Isomerase

66

189

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ifz-assembly1.cif.gz_B crystal structure of ribose-5-phosphate isomerase from brucella melitensis 16m 0.9687 59 181
3ph4-assembly1.cif.gz_A clostridium thermocellum ribose-5-phosphate isomerase b with d-allose 0.9619 59 201
2vvr-assembly1.cif.gz_A crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate 0.9561 57 203
2vvr-assembly1.cif.gz_A crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate 0.9498 57 203
4lfk-assembly1.cif.gz_B crystal structure of d-galactose-6-phosphate isomerase in a substrate-free form 0.9486 59 200
ID Description Score Start End Superfamily
5ifzB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9687 59 181 3.40.1400.10
4lfkB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9486 59 200 3.40.1400.10
af_P9WKD7_1_162_3.40.1400.10 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9472 56 203 3.40.1400.10
3s5pB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9435 54 186 3.40.1400.10
1o1xA00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9427 58 199 3.40.1400.10
ID Description Score Start End GO Terms
AF-A0A5Q4GAX0-F1-model_v4 Ribose 5-phosphate isomerase B (EC 5.3.1.6) 0.9754 59 183 GO:0004751
GO:0005975
AF-A0A7X6X9T7-F1-model_v4 Ribose 5-phosphate isomerase B (EC 5.3.1.6) 0.9733 59 173 GO:0004751
GO:0009052
GO:0019316
AF-A0A3B9JH88-F1-model_v4 Ribose-5-phosphate isomerase 0.9726 57 202 GO:0005975
GO:0016861
AF-A0A521WPV9-F1-model_v4 RpiB/LacA/LacB family sugar-phosphate isomerase 0.9725 59 177 GO:0005975
GO:0016861
AF-A0A1F2VLC0-F1-model_v4 Ribose 5-phosphate isomerase B 0.9719 57 204 GO:0005975
GO:0016861

Map