F445603

General Info

Members Datasets Scaffolds Average Seq Length
445 243 890 114

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0349748|Ga0501032_0349748_29_415
Length 109
Sequence MMPYTDEYSLVEVDADYLTKAVKPKQFIHIDQTECIMCEGCVDICPWKCIHMVTPDAIAEAIGTELPGEDPSDHVVFTVIILGKVGAPSATGDQHVRTNSHGYAYGMRF

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
75 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
76 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
127 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
128 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
132 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
133 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
134 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
136 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
137 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
138 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
139 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
142 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
143 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
146 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
147 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
150 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
151 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
152 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
153 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
154 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
155 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
156 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
157 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
158 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
161 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
170 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
220 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
225 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
231 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
232 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
233 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.63
Metatranscriptomes 3.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.48
Nodule 0
Rhizoplane 8.99
Rhizosphere 73.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0349748 3300049569 Bacteria 952
2 Ga0058859_11813066 3300004798 Bacteria 829
3 Ga0058860_12165146 3300004801 Bacteria 583
4 Ga0058860_12203220 3300004801 Bacteria 1387
5 Ga0065704_10129882 3300005289 Bacteria 1643
6 Ga0070676_10528001 3300005328 Bacteria 842
7 Ga0070690_100097380 3300005330 Bacteria 1945
8 Ga0070677_10105095 3300005333 Bacteria 1252
9 Ga0068869_100320071 3300005334 Bacteria 1258
10 Ga0070666_10434632 3300005335 Bacteria 947
11 Ga0070682_100892744 3300005337 Bacteria 730
12 Ga0068868_100682212 3300005338 Bacteria 917
13 Ga0070689_100222554 3300005340 Bacteria 1548
14 Ga0070687_100181664 3300005343 Bacteria 1260
15 Ga0070692_10518329 3300005345 Bacteria 776
16 Ga0070668_100473455 3300005347 Bacteria 1080
17 Ga0070668_100711221 3300005347 Bacteria 887
18 Ga0070669_100242337 3300005353 Bacteria 1433
19 Ga0070675_101031092 3300005354 Bacteria 756
20 Ga0070671_100028294 3300005355 Bacteria 4615
21 Ga0070671_100427675 3300005355 Bacteria 1134
22 Ga0070671_101660771 3300005355 Bacteria 567
23 Ga0070674_100079935 3300005356 Bacteria 2333
24 Ga0070673_100094082 3300005364 Bacteria 2456
25 Ga0070688_100492216 3300005365 Bacteria 923
26 Ga0070688_100528461 3300005365 Bacteria 894
27 Ga0070659_100329858 3300005366 Bacteria 1277
28 Ga0070667_100441363 3300005367 Bacteria 1188
29 Ga0070701_10320746 3300005438 Bacteria 959
30 Ga0070700_100096477 3300005441 Bacteria 1940
31 Ga0070700_100658245 3300005441 Bacteria 828
32 Ga0070662_100105587 3300005457 Bacteria 2138
33 Ga0068867_100114701 3300005459 Bacteria 2074
34 Ga0068867_100403947 3300005459 Bacteria 1153
35 Ga0070685_10182669 3300005466 Bacteria 1352
36 Ga0070685_10394784 3300005466 Bacteria 957
37 Ga0070697_101208811 3300005536 Bacteria 674
38 Ga0068853_101627446 3300005539 Bacteria 626
39 Ga0070672_100434614 3300005543 Bacteria 1129
40 Ga0070672_100469334 3300005543 Bacteria 1086
41 Ga0070672_100869099 3300005543 Bacteria 796
42 Ga0070686_100087786 3300005544 Bacteria 2074
43 Ga0070665_100732744 3300005548 Bacteria 1002
44 Ga0070665_101359425 3300005548 Bacteria 720
45 Ga0070664_100582670 3300005564 Bacteria 1036
46 Ga0070664_100636501 3300005564 Bacteria 991
47 Ga0070664_100762294 3300005564 Bacteria 904
48 Ga0070702_100294581 3300005615 Bacteria 1120
49 Ga0068852_100403901 3300005616 Bacteria 1344
50 Ga0068852_102151529 3300005616 Bacteria 580
51 Ga0068859_100174301 3300005617 Bacteria 2233
52 Ga0068859_101638515 3300005617 Bacteria 711
53 Ga0068864_100977727 3300005618 Bacteria 839
54 Ga0068864_102718010 3300005618 Bacteria 501
55 Ga0068866_10048925 3300005718 Bacteria 2139
56 Ga0068861_100039785 3300005719 Bacteria 3512
57 Ga0068861_100095778 3300005719 Bacteria 2351
58 Ga0068861_100224811 3300005719 Bacteria 1588
59 Ga0068863_100855304 3300005841 Bacteria 908
60 Ga0068858_100351629 3300005842 Bacteria 1411
61 Ga0068858_100674718 3300005842 Bacteria 1005
62 Ga0068860_100033890 3300005843 Bacteria 4899
63 Ga0068860_100060244 3300005843 Bacteria 3608
64 Ga0068860_100948246 3300005843 Bacteria 878
65 Ga0068862_100028598 3300005844 Bacteria 4695
66 Ga0081455_10239482 3300005937 Bacteria 1334
67 Ga0075365_10172406 3300006038 Bacteria 1510
68 Ga0075365_10193054 3300006038 Bacteria 1425
69 Ga0075365_10378006 3300006038 Bacteria 999
70 Ga0075365_10416547 3300006038 Bacteria 948
71 Ga0075368_10124889 3300006042 Bacteria 1067
72 Ga0075368_10289912 3300006042 Bacteria 704
73 Ga0075363_100248274 3300006048 Bacteria 1024
74 Ga0075363_100250654 3300006048 Bacteria 1019
75 Ga0075363_100338305 3300006048 Bacteria 877
76 Ga0075363_100469863 3300006048 Bacteria 745
77 Ga0075363_100620720 3300006048 Bacteria 649
78 Ga0075364_10062816 3300006051 Bacteria 2437
79 Ga0075364_10150531 3300006051 Bacteria 1568
80 Ga0075364_10209281 3300006051 Bacteria 1323
81 Ga0075364_10342771 3300006051 Bacteria 1018
82 Ga0075364_10688809 3300006051 Bacteria 698
83 Ga0075364_11130462 3300006051 Bacteria 531
84 Ga0075362_10104709 3300006177 Bacteria 1326
85 Ga0075362_10153776 3300006177 Bacteria 1105
86 Ga0075362_10217367 3300006177 Bacteria 933
87 Ga0075362_10267464 3300006177 Bacteria 843
88 Ga0075367_10016920 3300006178 Bacteria 3991
89 Ga0075367_10255906 3300006178 Bacteria 1098
90 Ga0075367_10336155 3300006178 Bacteria 952
91 Ga0075369_10039187 3300006186 Bacteria 2023
92 Ga0075366_10202532 3300006195 Bacteria 1207
93 Ga0075366_10258399 3300006195 Bacteria 1063
94 Ga0075366_10362179 3300006195 Bacteria 891
95 Ga0097621_100201359 3300006237 Bacteria 1729
96 Ga0097621_101923543 3300006237 Bacteria 565
97 Ga0075370_10139565 3300006353 Bacteria 1416
98 Ga0068871_100191063 3300006358 Bacteria 1764
99 Ga0068865_100199709 3300006881 Bacteria 1552
100 Ga0097620_100174305 3300006931 Bacteria 2233
101 Ga0097620_101638621 3300006931 Bacteria 711
102 Ga0105251_10104817 3300009011 Bacteria 1291
103 Ga0105240_11086788 3300009093 Bacteria 852
104 Ga0111539_10470892 3300009094 Bacteria 1463
105 Ga0105245_10073414 3300009098 Bacteria 3111
106 Ga0105245_10282134 3300009098 Bacteria 1624
107 Ga0105245_10677534 3300009098 Bacteria 1063
108 Ga0105247_10134555 3300009101 Bacteria 1614
109 Ga0114129_11987487 3300009147 Bacteria 703
110 Ga0114129_12600213 3300009147 Bacteria 604
111 Ga0105243_10012373 3300009148 Bacteria 6450
112 Ga0105243_10119176 3300009148 Bacteria 2222
113 Ga0105243_10163629 3300009148 Bacteria 1921
114 Ga0105243_12541842 3300009148 Bacteria 551
115 Ga0105241_11109809 3300009174 Bacteria 745
116 Ga0105242_10150698 3300009176 Bacteria 2027
117 Ga0105242_11049902 3300009176 Bacteria 826
118 Ga0105248_10125132 3300009177 Bacteria 2900
119 Ga0105248_10841786 3300009177 Bacteria 1035
120 Ga0105248_11084326 3300009177 Bacteria 905
121 Ga0105248_11378284 3300009177 Bacteria 798
122 Ga0105248_12937135 3300009177 Bacteria 543
123 Ga0105237_10756728 3300009545 Bacteria 978
124 Ga0105238_10460063 3300009551 Bacteria 1270
125 Ga0105238_10612878 3300009551 Bacteria 1097
126 Ga0105249_10253526 3300009553 Bacteria 1745
127 Ga0105249_10317647 3300009553 Bacteria 1568
128 Ga0105249_10753972 3300009553 Bacteria 1036
129 Ga0105239_11371610 3300010375 Bacteria 816
130 Ga0105239_12283453 3300010375 Bacteria 629
131 Ga0105246_10067851 3300011119 Bacteria 2500
132 Ga0105246_10990189 3300011119 Bacteria 760
133 Ga0157328_1029727 3300012478 Bacteria 511
134 Ga0157320_1029555 3300012481 Bacteria 546
135 Ga0157322_1006719 3300012490 Bacteria 832
136 Ga0157371_10864304 3300013102 Bacteria 684
137 Ga0157378_10016625 3300013297 Bacteria 6445
138 Ga0157378_10225630 3300013297 Bacteria 1783
139 Ga0157378_10315177 3300013297 Bacteria 1518
140 Ga0163162_10135587 3300013306 Bacteria 2572
141 Ga0163162_12915687 3300013306 Bacteria 550
142 Ga0163162_13356655 3300013306 Bacteria 512
143 Ga0157375_10088359 3300013308 Bacteria 3154
144 Ga0157375_10242629 3300013308 Bacteria 1961
145 Ga0157375_10494567 3300013308 Bacteria 1387
146 Ga0157375_11969293 3300013308 Bacteria 694
147 Ga0163163_10083479 3300014325 Bacteria 3200
148 Ga0163163_10567949 3300014325 Bacteria 1197
149 Ga0157380_11625280 3300014326 Bacteria 702
150 Ga0157380_11861743 3300014326 Bacteria 662
151 Ga0157380_12115979 3300014326 Bacteria 626
152 Ga0157377_10681844 3300014745 Bacteria 744
153 Ga0157377_11390919 3300014745 Bacteria 553
154 Ga0157379_10009858 3300014968 Bacteria 8322
155 Ga0157379_10054304 3300014968 Bacteria 3580
156 Ga0157379_10603154 3300014968 Bacteria 1025
157 Ga0157379_10798774 3300014968 Bacteria 891
158 Ga0157376_10561839 3300014969 Bacteria 1131
159 Ga0163161_10077989 3300017792 Bacteria 2434
160 Ga0163161_10244901 3300017792 Bacteria 1395
161 Ga0163161_11710735 3300017792 Bacteria 557
162 Ga0206353_11904902 3300020082 Bacteria 543
163 Ga0207666_1005241 3300025271 Bacteria 1650
164 Ga0207697_10043711 3300025315 Bacteria 1842
165 Ga0207682_10095636 3300025893 Bacteria 1293
166 Ga0207642_10176593 3300025899 Bacteria 1160
167 Ga0207710_10060005 3300025900 Bacteria 1723
168 Ga0207647_10228624 3300025904 Bacteria 1070
169 Ga0207645_10076564 3300025907 Bacteria 2143
170 Ga0207662_10082526 3300025918 Bacteria 1963
171 Ga0207659_10293174 3300025926 Bacteria 1334
172 Ga0207659_10353752 3300025926 Bacteria 1219
173 Ga0207659_10912725 3300025926 Bacteria 755
174 Ga0207687_10677625 3300025927 Bacteria 874
175 Ga0207644_10096685 3300025931 Bacteria 2211
176 Ga0207644_11710965 3300025931 Bacteria 527
177 Ga0207690_10463914 3300025932 Bacteria 1020
178 Ga0207706_10042117 3300025933 Bacteria 4046
179 Ga0207706_11456838 3300025933 Bacteria 560
180 Ga0207709_10118122 3300025935 Bacteria 1786
181 Ga0207670_10095512 3300025936 Bacteria 2111
182 Ga0207670_10945374 3300025936 Bacteria 723
183 Ga0207669_10215410 3300025937 Bacteria 1405
184 Ga0207691_10191039 3300025940 Bacteria 1786
185 Ga0207691_10327091 3300025940 Bacteria 1314
186 Ga0207711_10483817 3300025941 Bacteria 1153
187 Ga0207711_11498636 3300025941 Bacteria 618
188 Ga0207711_11904089 3300025941 Bacteria 537
189 Ga0207689_10065509 3300025942 Bacteria 2988
190 Ga0207679_10323796 3300025945 Bacteria 1335
191 Ga0207651_10761097 3300025960 Bacteria 857
192 Ga0207651_10951307 3300025960 Bacteria 766
193 Ga0207712_10518705 3300025961 Bacteria 1021
194 Ga0207668_10778134 3300025972 Bacteria 846
195 Ga0207668_11504760 3300025972 Bacteria 607
196 Ga0207658_10801389 3300025986 Bacteria 855
197 Ga0207677_10121910 3300026023 Bacteria 1963
198 Ga0207703_11611213 3300026035 Bacteria 624
199 Ga0207708_10007170 3300026075 Bacteria 8237
200 Ga0207641_10164547 3300026088 Bacteria 2019
201 Ga0207641_11161023 3300026088 Bacteria 771
202 Ga0207648_10028722 3300026089 Bacteria 4930
203 Ga0207648_10200081 3300026089 Bacteria 1771
204 Ga0207648_10843104 3300026089 Bacteria 855
205 Ga0207676_10660976 3300026095 Bacteria 1009
206 Ga0207675_100012667 3300026118 Bacteria 7879
207 Ga0207675_100032859 3300026118 Bacteria 4834
208 Ga0207675_100274991 3300026118 Bacteria 1635
209 Ga0207683_10743092 3300026121 Bacteria 910
210 Ga0207698_10498501 3300026142 Bacteria 1185
211 Ga0209813_10044844 3300027866 Bacteria 1360
212 Ga0209813_10071657 3300027866 Bacteria 1128
213 Ga0209813_10298646 3300027866 Bacteria 625
214 Ga0207428_10701356 3300027907 Bacteria 724
215 Ga0268266_10591245 3300028379 Bacteria 1066
216 Ga0268266_12031320 3300028379 Bacteria 548
217 Ga0268265_10120242 3300028380 Bacteria 2163
218 Ga0268264_10010255 3300028381 Bacteria 7756
219 Ga0268264_10026460 3300028381 Bacteria 4741
220 Ga0316576_10001784 3300031727 Bacteria 11902
221 Ga0316576_10017349 3300031727 Bacteria 4888
222 Ga0316576_10040475 3300031727 Bacteria 3350
223 Ga0316576_10131773 3300031727 Bacteria 1881
224 Ga0316578_10004385 3300031728 Bacteria 6656
225 Ga0316578_10151710 3300031728 Bacteria 1396
226 Ga0316578_10911904 3300031728 Bacteria 507
227 Ga0316577_10026940 3300031733 Bacteria 3203
228 Ga0316577_10501733 3300031733 Bacteria 690
229 Ga0307409_100675007 3300031995 Bacteria 1030
230 Ga0307409_100909655 3300031995 Bacteria 894
231 Ga0307415_101648188 3300032126 Bacteria 617
232 Ga0316583_10071224 3300032133 Bacteria 1216
233 Ga0316585_10089146 3300032137 Bacteria 1007
234 Ga0316580_10002228 3300032139 Bacteria 5294
235 Ga0316580_10071795 3300032139 Bacteria 1060
236 Ga0316592_1041446 3300033524 Bacteria 1019
237 Ga0373950_0125927 3300034818 Bacteria 570
238 Ga0373958_0117850 3300034819 Bacteria 639
239 Ga0373928_0267890 3300035084 Bacteria 514
240 Ga0373940_0272613 3300035088 Bacteria 576
241 Ga0373960_0344554 3300035121 Bacteria 564
242 Ga0373943_0376148 3300035170 Bacteria 817
243 Ga0373961_0113376 3300035241 Bacteria 891
244 Ga0316574_0024614 3300035398 Bacteria 3605
245 Ga0316574_0042712 3300035398 Bacteria 2799
246 Ga0316574_0044950 3300035398 Bacteria 2733
247 Ga0316574_0046861 3300035398 Bacteria 2682
248 Ga0316574_0092351 3300035398 Bacteria 1931
249 Ga0316574_0110191 3300035398 Bacteria 1764
250 Ga0316574_0594282 3300035398 Bacteria 684
251 Ga0373924_0384004 3300035410 Bacteria 627
252 Ga0373931_0462098 3300035691 Bacteria 813
253 Ga0316582_0126241 3300036647 Bacteria 1715
254 Ga0316582_0194686 3300036647 Bacteria 1382
255 Ga0316584_0004529 3300036712 Bacteria 9201
256 Ga0316584_0008267 3300036712 Bacteria 7166
257 Ga0400483_091223 3300039062 Bacteria 2346
258 Ga0400483_103120 3300039062 Bacteria 57797
259 Ga0400483_163497 3300039062 Bacteria 3196
260 Ga0400483_253115 3300039062 Bacteria 57701
261 Ga0436365_1781797 3300039437 Bacteria 985
262 Ga0451791_0018971 3300041451 Bacteria 1494
263 Ga0451797_1367574 3300041453 Bacteria 870
264 Ga0451798_0726180 3300041458 Bacteria 681
265 Ga0451807_1458850 3300041486 Bacteria 1341
266 Ga0451837_0071793 3300041494 Bacteria 1512
267 Ga0451841_0966991 3300041498 Bacteria 747
268 Ga0451847_0268285 3300041503 Bacteria 739
269 Ga0451849_0408945 3300041505 Bacteria 937
270 Ga0451851_1157988 3300041507 Bacteria 863
271 Ga0451843_1071674 3300041509 Bacteria 616
272 Ga0451853_2141878 3300041512 Bacteria 1343
273 Ga0451853_2336912 3300041512 Bacteria 604
274 Ga0450902_029147 3300042137 Bacteria 927
275 Ga0439446_0213055 3300042156 Bacteria 656
276 Ga0451577_0001220 3300042876 Bacteria 35873
277 Ga0453684_0007124 3300044712 Bacteria 20833
278 Ga0466957_0521813 3300044842 Bacteria 825
279 Ga0466958_1079418 3300045836 Bacteria 524
280 Ga0466967_0358839 3300045976 Bacteria 1412
281 Ga0495592_0629268 3300046454 Bacteria 652
282 Ga0495629_0229837 3300046459 Bacteria 1279
283 Ga0495641_0037524 3300046461 Bacteria 2270
284 Ga0495639_0176528 3300046475 Bacteria 1039
285 Ga0495630_1039667 3300046517 Bacteria 622
286 Ga0495599_0513448 3300046678 Bacteria 704
287 Ga0495674_0271953 3300047319 Bacteria 1390
288 Ga0495676_0364591 3300047321 Bacteria 964
289 Ga0495684_0870675 3300047471 Bacteria 583
290 Ga0496100_0029549 3300048903 Bacteria 3392
291 Ga0496101_0006431 3300048904 Bacteria 7560
292 Ga0496101_0175579 3300048904 Bacteria 1648
293 Ga0496102_0027097 3300048905 Bacteria 5118
294 Ga0496102_0634909 3300048905 Bacteria 991
295 Ga0496102_1382803 3300048905 Bacteria 623
296 Ga0496103_0147053 3300048906 Bacteria 1509
297 Ga0496104_0042558 3300048907 Bacteria 4263
298 Ga0496104_0054609 3300048907 Bacteria 3776
299 Ga0496104_0973681 3300048907 Bacteria 753
300 Ga0496105_0021050 3300048908 Bacteria 5275
301 Ga0496105_0051775 3300048908 Bacteria 3391
302 Ga0496107_0724361 3300048910 Bacteria 731
303 Ga0496108_0007069 3300048911 Bacteria 9090
304 Ga0496108_0165110 3300048911 Bacteria 1914
305 Ga0496108_0193765 3300048911 Bacteria 1762
306 Ga0496108_0566010 3300048911 Bacteria 991
307 Ga0496108_1695065 3300048911 Bacteria 520
308 Ga0496109_0170726 3300048912 Bacteria 2040
309 Ga0496110_0020023 3300048913 Bacteria 5641
310 Ga0496110_0061279 3300048913 Bacteria 3320
311 Ga0496110_0174236 3300048913 Bacteria 1952
312 Ga0496110_0235494 3300048913 Bacteria 1666
313 Ga0496110_0405525 3300048913 Bacteria 1243
314 Ga0496110_0574717 3300048913 Bacteria 1023
315 Ga0496110_0882487 3300048913 Bacteria 800
316 Ga0496111_0006414 3300048914 Bacteria 7636
317 Ga0496111_0040447 3300048914 Bacteria 3344
318 Ga0496111_0200116 3300048914 Bacteria 1485
319 Ga0496113_0102025 3300048916 Bacteria 2225
320 Ga0496114_0000919 3300048917 Bacteria 22059
321 Ga0496114_0008898 3300048917 Bacteria 7960
322 Ga0496114_0076162 3300048917 Bacteria 2827
323 Ga0496114_0119048 3300048917 Bacteria 2270
324 Ga0496114_0626591 3300048917 Bacteria 947
325 Ga0496115_0328146 3300048918 Bacteria 1251
326 Ga0496126_0830216 3300048929 Bacteria 707
327 Ga0501310_037179 3300049130 Bacteria 667
328 Ga0501318_063479 3300049534 Bacteria 571
329 Ga0501031_0033330 3300049568 Bacteria 3359
330 Ga0501031_0207563 3300049568 Bacteria 1277
331 Ga0501031_0334460 3300049568 Bacteria 981
332 Ga0501032_0239614 3300049569 Bacteria 1179
333 Ga0501033_0461059 3300049570 Bacteria 882
334 Ga0501034_0044431 3300049571 Bacteria 4494
335 Ga0501034_0052529 3300049571 Bacteria 4105
336 Ga0501034_0126966 3300049571 Bacteria 2535
337 Ga0501034_0182664 3300049571 Bacteria 2062
338 Ga0501036_0039133 3300049572 Bacteria 4015
339 Ga0501036_0039715 3300049572 Bacteria 3982
340 Ga0501036_0224074 3300049572 Bacteria 1578
341 Ga0501038_0062199 3300049574 Bacteria 3190
342 Ga0501039_0168553 3300049575 Bacteria 1722
343 Ga0501039_0194283 3300049575 Bacteria 1596
344 Ga0501040_0083440 3300049576 Bacteria 2216
345 Ga0501040_0142272 3300049576 Bacteria 1690
346 Ga0501040_0171721 3300049576 Bacteria 1535
347 Ga0501040_1228727 3300049576 Bacteria 544
348 Ga0501041_0009661 3300049577 Bacteria 5687
349 Ga0501041_0018060 3300049577 Bacteria 4200
350 Ga0501041_0020532 3300049577 Bacteria 3951
351 Ga0501041_0251744 3300049577 Bacteria 1110
352 Ga0501042_0008427 3300049578 Bacteria 6806
353 Ga0501042_0111350 3300049578 Bacteria 1971
354 Ga0501042_0865651 3300049578 Bacteria 658
355 Ga0501043_0333722 3300049579 Bacteria 1154
356 Ga0501046_0230725 3300049580 Bacteria 1368
357 Ga0501046_0316239 3300049580 Bacteria 1138
358 Ga0501046_0776708 3300049580 Bacteria 672
359 Ga0501046_0937583 3300049580 Bacteria 603
360 Ga0501047_0430117 3300049581 Bacteria 1151
361 Ga0501048_0115375 3300049582 Bacteria 1897
362 Ga0501048_0732185 3300049582 Bacteria 710
363 Ga0501048_1062327 3300049582 Bacteria 582
364 Ga0501068_0138514 3300049584 Bacteria 1525
365 Ga0501068_0262549 3300049584 Bacteria 1102
366 Ga0501069_0261620 3300049585 Bacteria 1010
367 Ga0501071_0009766 3300049587 Bacteria 6403
368 Ga0501071_0017745 3300049587 Bacteria 4915
369 Ga0501071_0409593 3300049587 Bacteria 1035
370 Ga0501071_1078108 3300049587 Bacteria 621
371 Ga0501072_0198847 3300049588 Bacteria 1598
372 Ga0501074_0174840 3300049590 Bacteria 1532
373 Ga0501074_0385458 3300049590 Bacteria 994
374 Ga0501074_0953686 3300049590 Bacteria 603
375 Ga0501074_1240419 3300049590 Bacteria 523
376 Ga0501075_0061935 3300049591 Bacteria 2820
377 Ga0501075_0080120 3300049591 Bacteria 2472
378 Ga0501075_0190270 3300049591 Bacteria 1565
379 Ga0501075_0350177 3300049591 Bacteria 1125
380 Ga0501076_0028680 3300049592 Bacteria 4324
381 Ga0501076_0247926 3300049592 Bacteria 1457
382 Ga0501077_0431588 3300049593 Bacteria 843
383 Ga0501079_0026593 3300049741 Bacteria 4436
384 Ga0501079_0079163 3300049741 Bacteria 2542
385 Ga0501079_0244224 3300049741 Bacteria 1403
386 Ga0501080_0973987 3300049742 Bacteria 737
387 Ga0501081_0330099 3300049743 Bacteria 1122
388 Ga0501081_0568700 3300049743 Bacteria 847
389 Ga0501081_0603410 3300049743 Bacteria 822
390 Ga0501081_1045304 3300049743 Bacteria 618
391 Ga0501035_0146225 3300049822 Bacteria 2053
392 Ga0501035_0207508 3300049822 Bacteria 1678
393 Ga0501045_0007594 3300049824 Bacteria 7537
394 Ga0501045_0019748 3300049824 Bacteria 4808
395 Ga0501045_0258784 3300049824 Bacteria 1295
396 Ga0501045_0313931 3300049824 Bacteria 1166
397 nmdc:mga03683_70140_c1 3300050489 Bacteria 1497
398 nmdc:mga03n38_199220_c1 3300050490 Bacteria 1036
399 nmdc:mga03n38_24486_c1 3300050490 Bacteria 2469
400 nmdc:mga00v17_139995_c1 3300050491 Bacteria 1551
401 nmdc:mga00v17_231095_c1 3300050491 Bacteria 1198
402 nmdc:mga00v17_30343_c1 3300050491 Bacteria 3181
403 nmdc:mga00v17_339262_c1 3300050491 Bacteria 977
404 nmdc:mga00v17_340008_c1 3300050491 Bacteria 976
405 nmdc:mga00v17_441938_c1 3300050491 Bacteria 845
406 nmdc:mga00v17_6559_c1 3300050491 Bacteria 6177
407 nmdc:mga0yw44_206961_c1 3300050492 Bacteria 1297
408 nmdc:mga0yw44_249646_c1 3300050492 Bacteria 1181
409 nmdc:mga0yw44_31523_c1 3300050492 Bacteria 3084
410 nmdc:mga0k408_324142_c1 3300050493 Bacteria 919
411 nmdc:mga0k408_404122_c1 3300050493 Bacteria 813
412 nmdc:mga06z11_105155_c1 3300050494 Bacteria 1555
413 nmdc:mga06z11_180065_c1 3300050494 Bacteria 1218
414 nmdc:mga06z11_516688_c1 3300050494 Bacteria 724
415 nmdc:mga06z11_889220_c1 3300050494 Bacteria 543
416 nmdc:mga04h51_49334_c1 3300050495 Bacteria 1406
417 nmdc:mga04h51_50466_c1 3300050495 Bacteria 1394
418 nmdc:mga04h51_53787_c1 3300050495 Bacteria 1359
419 nmdc:mga07m45_287711_c1 3300050496 Bacteria 956
420 nmdc:mga07m45_54228_c1 3300050496 Bacteria 2266
421 nmdc:mga07m45_73441_c1 3300050496 Bacteria 1947
422 nmdc:mga08y16_361682_c1 3300050511 Bacteria 1490
423 nmdc:mga0n895_1565085_c1 3300050512 Bacteria 624
424 nmdc:mga0n895_828061_c1 3300050512 Bacteria 914
425 nmdc:mga0rr50_1522963_c1 3300050513 Bacteria 565
426 nmdc:mga0sz30_66469_c1 3300050516 Bacteria 1547
427 Ga0495655_0279436 3300053083 Bacteria 569
428 Ga0500556_0347354 3300053104 Bacteria 575
429 Ga0500616_0000684 3300053153 Bacteria 39734
430 Ga0501084_0024371 3300054114 Bacteria 5047
431 Ga0501084_0084645 3300054114 Bacteria 2662
432 Ga0587077_249808 3300059493 Bacteria 512
433 Ga0587089_064391 3300059509 Bacteria 612
434 Ga0587091_045138 3300059511 Bacteria 884
435 Ga0587117_128310 3300059627 Bacteria 508
436 Ga0587128_056980 3300059630 Bacteria 728
437 Ga0587075_084603 3300059644 Bacteria 610
438 Ga0587075_139688 3300059644 Bacteria 516
439 Ga0587114_065686 3300059655 Bacteria 646
440 Ga0501082_0249081 3300060353 Bacteria 1546
441 Ga0501082_1165669 3300060353 Bacteria 673
442 Ga0530510_0034519 3300061734 Bacteria 3644
443 Ga0530510_0097109 3300061734 Bacteria 2154
444 Ga0530510_0443395 3300061734 Bacteria 981
445 Ga0530510_0950205 3300061734 Bacteria 657
446 Ga0501032_0349748
447 Ga0058859_11813066
448 Ga0058860_12165146
449 Ga0058860_12203220
450 Ga0065704_10129882
451 Ga0070676_10528001
452 Ga0070690_100097380
453 Ga0070677_10105095
454 Ga0068869_100320071
455 Ga0070666_10434632
456 Ga0070682_100892744
457 Ga0068868_100682212
458 Ga0070689_100222554
459 Ga0070687_100181664
460 Ga0070692_10518329
461 Ga0070668_100473455
462 Ga0070668_100711221
463 Ga0070669_100242337
464 Ga0070675_101031092
465 Ga0070671_100028294
466 Ga0070671_100427675
467 Ga0070671_101660771
468 Ga0070674_100079935
469 Ga0070673_100094082
470 Ga0070688_100492216
471 Ga0070688_100528461
472 Ga0070659_100329858
473 Ga0070667_100441363
474 Ga0070701_10320746
475 Ga0070700_100096477
476 Ga0070700_100658245
477 Ga0070662_100105587
478 Ga0068867_100114701
479 Ga0068867_100403947
480 Ga0070685_10182669
481 Ga0070685_10394784
482 Ga0070697_101208811
483 Ga0068853_101627446
484 Ga0070672_100434614
485 Ga0070672_100469334
486 Ga0070672_100869099
487 Ga0070686_100087786
488 Ga0070665_100732744
489 Ga0070665_101359425
490 Ga0070664_100582670
491 Ga0070664_100636501
492 Ga0070664_100762294
493 Ga0070702_100294581
494 Ga0068852_100403901
495 Ga0068852_102151529
496 Ga0068859_100174301
497 Ga0068859_101638515
498 Ga0068864_100977727
499 Ga0068864_102718010
500 Ga0068866_10048925
501 Ga0068861_100039785
502 Ga0068861_100095778
503 Ga0068861_100224811
504 Ga0068863_100855304
505 Ga0068858_100351629
506 Ga0068858_100674718
507 Ga0068860_100033890
508 Ga0068860_100060244
509 Ga0068860_100948246
510 Ga0068862_100028598
511 Ga0081455_10239482
512 Ga0075365_10172406
513 Ga0075365_10193054
514 Ga0075365_10378006
515 Ga0075365_10416547
516 Ga0075368_10124889
517 Ga0075368_10289912
518 Ga0075363_100248274
519 Ga0075363_100250654
520 Ga0075363_100338305
521 Ga0075363_100469863
522 Ga0075363_100620720
523 Ga0075364_10062816
524 Ga0075364_10150531
525 Ga0075364_10209281
526 Ga0075364_10342771
527 Ga0075364_10688809
528 Ga0075364_11130462
529 Ga0075362_10104709
530 Ga0075362_10153776
531 Ga0075362_10217367
532 Ga0075362_10267464
533 Ga0075367_10016920
534 Ga0075367_10255906
535 Ga0075367_10336155
536 Ga0075369_10039187
537 Ga0075366_10202532
538 Ga0075366_10258399
539 Ga0075366_10362179
540 Ga0097621_100201359
541 Ga0097621_101923543
542 Ga0075370_10139565
543 Ga0068871_100191063
544 Ga0068865_100199709
545 Ga0097620_100174305
546 Ga0097620_101638621
547 Ga0105251_10104817
548 Ga0105240_11086788
549 Ga0111539_10470892
550 Ga0105245_10073414
551 Ga0105245_10282134
552 Ga0105245_10677534
553 Ga0105247_10134555
554 Ga0114129_11987487
555 Ga0114129_12600213
556 Ga0105243_10012373
557 Ga0105243_10119176
558 Ga0105243_10163629
559 Ga0105243_12541842
560 Ga0105241_11109809
561 Ga0105242_10150698
562 Ga0105242_11049902
563 Ga0105248_10125132
564 Ga0105248_10841786
565 Ga0105248_11084326
566 Ga0105248_11378284
567 Ga0105248_12937135
568 Ga0105237_10756728
569 Ga0105238_10460063
570 Ga0105238_10612878
571 Ga0105249_10253526
572 Ga0105249_10317647
573 Ga0105249_10753972
574 Ga0105239_11371610
575 Ga0105239_12283453
576 Ga0105246_10067851
577 Ga0105246_10990189
578 Ga0157328_1029727
579 Ga0157320_1029555
580 Ga0157322_1006719
581 Ga0157371_10864304
582 Ga0157378_10016625
583 Ga0157378_10225630
584 Ga0157378_10315177
585 Ga0163162_10135587
586 Ga0163162_12915687
587 Ga0163162_13356655
588 Ga0157375_10088359
589 Ga0157375_10242629
590 Ga0157375_10494567
591 Ga0157375_11969293
592 Ga0163163_10083479
593 Ga0163163_10567949
594 Ga0157380_11625280
595 Ga0157380_11861743
596 Ga0157380_12115979
597 Ga0157377_10681844
598 Ga0157377_11390919
599 Ga0157379_10009858
600 Ga0157379_10054304
601 Ga0157379_10603154
602 Ga0157379_10798774
603 Ga0157376_10561839
604 Ga0163161_10077989
605 Ga0163161_10244901
606 Ga0163161_11710735
607 Ga0206353_11904902
608 Ga0207666_1005241
609 Ga0207697_10043711
610 Ga0207682_10095636
611 Ga0207642_10176593
612 Ga0207710_10060005
613 Ga0207647_10228624
614 Ga0207645_10076564
615 Ga0207662_10082526
616 Ga0207659_10293174
617 Ga0207659_10353752
618 Ga0207659_10912725
619 Ga0207687_10677625
620 Ga0207644_10096685
621 Ga0207644_11710965
622 Ga0207690_10463914
623 Ga0207706_10042117
624 Ga0207706_11456838
625 Ga0207709_10118122
626 Ga0207670_10095512
627 Ga0207670_10945374
628 Ga0207669_10215410
629 Ga0207691_10191039
630 Ga0207691_10327091
631 Ga0207711_10483817
632 Ga0207711_11498636
633 Ga0207711_11904089
634 Ga0207689_10065509
635 Ga0207679_10323796
636 Ga0207651_10761097
637 Ga0207651_10951307
638 Ga0207712_10518705
639 Ga0207668_10778134
640 Ga0207668_11504760
641 Ga0207658_10801389
642 Ga0207677_10121910
643 Ga0207703_11611213
644 Ga0207708_10007170
645 Ga0207641_10164547
646 Ga0207641_11161023
647 Ga0207648_10028722
648 Ga0207648_10200081
649 Ga0207648_10843104
650 Ga0207676_10660976
651 Ga0207675_100012667
652 Ga0207675_100032859
653 Ga0207675_100274991
654 Ga0207683_10743092
655 Ga0207698_10498501
656 Ga0209813_10044844
657 Ga0209813_10071657
658 Ga0209813_10298646
659 Ga0207428_10701356
660 Ga0268266_10591245
661 Ga0268266_12031320
662 Ga0268265_10120242
663 Ga0268264_10010255
664 Ga0268264_10026460
665 Ga0316576_10001784
666 Ga0316576_10017349
667 Ga0316576_10040475
668 Ga0316576_10131773
669 Ga0316578_10004385
670 Ga0316578_10151710
671 Ga0316578_10911904
672 Ga0316577_10026940
673 Ga0316577_10501733
674 Ga0307409_100675007
675 Ga0307409_100909655
676 Ga0307415_101648188
677 Ga0316583_10071224
678 Ga0316585_10089146
679 Ga0316580_10002228
680 Ga0316580_10071795
681 Ga0316592_1041446
682 Ga0373950_0125927
683 Ga0373958_0117850
684 Ga0373928_0267890
685 Ga0373940_0272613
686 Ga0373960_0344554
687 Ga0373943_0376148
688 Ga0373961_0113376
689 Ga0316574_0024614
690 Ga0316574_0042712
691 Ga0316574_0044950
692 Ga0316574_0046861
693 Ga0316574_0092351
694 Ga0316574_0110191
695 Ga0316574_0594282
696 Ga0373924_0384004
697 Ga0373931_0462098
698 Ga0316582_0126241
699 Ga0316582_0194686
700 Ga0316584_0004529
701 Ga0316584_0008267
702 Ga0400483_091223
703 Ga0400483_103120
704 Ga0400483_163497
705 Ga0400483_253115
706 Ga0436365_1781797
707 Ga0451791_0018971
708 Ga0451797_1367574
709 Ga0451798_0726180
710 Ga0451807_1458850
711 Ga0451837_0071793
712 Ga0451841_0966991
713 Ga0451847_0268285
714 Ga0451849_0408945
715 Ga0451851_1157988
716 Ga0451843_1071674
717 Ga0451853_2141878
718 Ga0451853_2336912
719 Ga0450902_029147
720 Ga0439446_0213055
721 Ga0451577_0001220
722 Ga0453684_0007124
723 Ga0466957_0521813
724 Ga0466958_1079418
725 Ga0466967_0358839
726 Ga0495592_0629268
727 Ga0495629_0229837
728 Ga0495641_0037524
729 Ga0495639_0176528
730 Ga0495630_1039667
731 Ga0495599_0513448
732 Ga0495674_0271953
733 Ga0495676_0364591
734 Ga0495684_0870675
735 Ga0496100_0029549
736 Ga0496101_0006431
737 Ga0496101_0175579
738 Ga0496102_0027097
739 Ga0496102_0634909
740 Ga0496102_1382803
741 Ga0496103_0147053
742 Ga0496104_0042558
743 Ga0496104_0054609
744 Ga0496104_0973681
745 Ga0496105_0021050
746 Ga0496105_0051775
747 Ga0496107_0724361
748 Ga0496108_0007069
749 Ga0496108_0165110
750 Ga0496108_0193765
751 Ga0496108_0566010
752 Ga0496108_1695065
753 Ga0496109_0170726
754 Ga0496110_0020023
755 Ga0496110_0061279
756 Ga0496110_0174236
757 Ga0496110_0235494
758 Ga0496110_0405525
759 Ga0496110_0574717
760 Ga0496110_0882487
761 Ga0496111_0006414
762 Ga0496111_0040447
763 Ga0496111_0200116
764 Ga0496113_0102025
765 Ga0496114_0000919
766 Ga0496114_0008898
767 Ga0496114_0076162
768 Ga0496114_0119048
769 Ga0496114_0626591
770 Ga0496115_0328146
771 Ga0496126_0830216
772 Ga0501310_037179
773 Ga0501318_063479
774 Ga0501031_0033330
775 Ga0501031_0207563
776 Ga0501031_0334460
777 Ga0501032_0239614
778 Ga0501033_0461059
779 Ga0501034_0044431
780 Ga0501034_0052529
781 Ga0501034_0126966
782 Ga0501034_0182664
783 Ga0501036_0039133
784 Ga0501036_0039715
785 Ga0501036_0224074
786 Ga0501038_0062199
787 Ga0501039_0168553
788 Ga0501039_0194283
789 Ga0501040_0083440
790 Ga0501040_0142272
791 Ga0501040_0171721
792 Ga0501040_1228727
793 Ga0501041_0009661
794 Ga0501041_0018060
795 Ga0501041_0020532
796 Ga0501041_0251744
797 Ga0501042_0008427
798 Ga0501042_0111350
799 Ga0501042_0865651
800 Ga0501043_0333722
801 Ga0501046_0230725
802 Ga0501046_0316239
803 Ga0501046_0776708
804 Ga0501046_0937583
805 Ga0501047_0430117
806 Ga0501048_0115375
807 Ga0501048_0732185
808 Ga0501048_1062327
809 Ga0501068_0138514
810 Ga0501068_0262549
811 Ga0501069_0261620
812 Ga0501071_0009766
813 Ga0501071_0017745
814 Ga0501071_0409593
815 Ga0501071_1078108
816 Ga0501072_0198847
817 Ga0501074_0174840
818 Ga0501074_0385458
819 Ga0501074_0953686
820 Ga0501074_1240419
821 Ga0501075_0061935
822 Ga0501075_0080120
823 Ga0501075_0190270
824 Ga0501075_0350177
825 Ga0501076_0028680
826 Ga0501076_0247926
827 Ga0501077_0431588
828 Ga0501079_0026593
829 Ga0501079_0079163
830 Ga0501079_0244224
831 Ga0501080_0973987
832 Ga0501081_0330099
833 Ga0501081_0568700
834 Ga0501081_0603410
835 Ga0501081_1045304
836 Ga0501035_0146225
837 Ga0501035_0207508
838 Ga0501045_0007594
839 Ga0501045_0019748
840 Ga0501045_0258784
841 Ga0501045_0313931
842 nmdc:mga03683_70140_c1
843 nmdc:mga03n38_199220_c1
844 nmdc:mga03n38_24486_c1
845 nmdc:mga00v17_139995_c1
846 nmdc:mga00v17_231095_c1
847 nmdc:mga00v17_30343_c1
848 nmdc:mga00v17_339262_c1
849 nmdc:mga00v17_340008_c1
850 nmdc:mga00v17_441938_c1
851 nmdc:mga00v17_6559_c1
852 nmdc:mga0yw44_206961_c1
853 nmdc:mga0yw44_249646_c1
854 nmdc:mga0yw44_31523_c1
855 nmdc:mga0k408_324142_c1
856 nmdc:mga0k408_404122_c1
857 nmdc:mga06z11_105155_c1
858 nmdc:mga06z11_180065_c1
859 nmdc:mga06z11_516688_c1
860 nmdc:mga06z11_889220_c1
861 nmdc:mga04h51_49334_c1
862 nmdc:mga04h51_50466_c1
863 nmdc:mga04h51_53787_c1
864 nmdc:mga07m45_287711_c1
865 nmdc:mga07m45_54228_c1
866 nmdc:mga07m45_73441_c1
867 nmdc:mga08y16_361682_c1
868 nmdc:mga0n895_1565085_c1
869 nmdc:mga0n895_828061_c1
870 nmdc:mga0rr50_1522963_c1
871 nmdc:mga0sz30_66469_c1
872 Ga0495655_0279436
873 Ga0500556_0347354
874 Ga0500616_0000684
875 Ga0501084_0024371
876 Ga0501084_0084645
877 Ga0587077_249808
878 Ga0587089_064391
879 Ga0587091_045138
880 Ga0587117_128310
881 Ga0587128_056980
882 Ga0587075_084603
883 Ga0587075_139688
884 Ga0587114_065686
885 Ga0501082_0249081
886 Ga0501082_1165669
887 Ga0530510_0034519
888 Ga0530510_0097109
889 Ga0530510_0443395
890 Ga0530510_0950205

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map