F445575

General Info

Members Datasets Scaffolds Average Seq Length
445 298 442 307

Family's Representative Sequence

Representative Sequence 3300046462|Ga0495651_0194245|Ga0495651_0194245_187_1221
Length 338
Sequence MIPGRPRPLLPHPPTRFGDDPRNDFCEDGMLQRFTPLMGPTASGKTPLAMSLAGALPIEIVSVDSAQVYRDMDVGTAKPSPSDRRTVTHHLIDVIDPTETYSAARFRDDAMRVLEDIAARGRIPLLAGGTMLYFKALREGLSELPEANAEVRAAIDVEAAQRGWPRLHAELAEVDPVTAARLKPNDAQRIQRALEVFRLTGKPMSAMLARRKRAELPLRLIQIALAPSDRSFLHRRIEERFDAMLGAGLVEELRSLRERYALRSDLPSMRCVGYRQAWEFIEGKISRKELRERGVFATRQLAKRQLTWLRAMPDIAVFDCLAPGIAASVRTMIETELG

Samples

Sample ID Description Type Environment
1 2643221556 Massilia sp. Root1485 Isolate Unclassified
2 2643221684 Massilia sp. Root133 Isolate Unclassified
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
96 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
98 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
149 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
150 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
151 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
152 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
155 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
156 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
163 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
164 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
165 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
167 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
168 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
169 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
170 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
186 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
187 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
188 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
191 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
199 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
200 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
203 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
204 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
205 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
206 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
207 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
208 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
209 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
210 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
211 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
212 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
213 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
216 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
217 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
218 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
219 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
222 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
223 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
224 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
227 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
228 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
229 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
230 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
231 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
232 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
233 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
234 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
235 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
236 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
237 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
238 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
239 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
240 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
241 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
242 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
243 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
244 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
245 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
246 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
247 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
248 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
258 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
259 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
260 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
261 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
262 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
263 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
273 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
274 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
275 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
278 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
279 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
280 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
283 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
284 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
285 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
286 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
289 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
290 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
291 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
292 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
293 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
294 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
295 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
296 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
297 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
298 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.62
Nodule 0
Rhizoplane 2.7
Rhizosphere 88.31
Stem 0
Stem Tuber 0
Unclassified 3.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10000568 3300002067 Bacteria 12964
2 JGI25152J39213_1002192 3300002773 Bacteria 7628
3 JGI25153J46596_10005801 3300003215 Bacteria 6422
4 JGI25153J46596_10013271 3300003215 Bacteria 3491
5 Ga0055525_1000009 3300003759 Bacteria 596899
6 Ga0065165_1003696 3300005262 Bacteria 10385
7 Ga0070658_10067094 3300005327 Bacteria 2931
8 Ga0070690_100005727 3300005330 Bacteria 6996
9 Ga0070670_100004099 3300005331 Bacteria 12172
10 Ga0070670_100052271 3300005331 Bacteria 3509
11 Ga0070677_10011154 3300005333 Bacteria 3091
12 Ga0068869_100001687 3300005334 Bacteria 13186
13 Ga0070666_10010771 3300005335 Bacteria 5722
14 Ga0070680_100057952 3300005336 Bacteria 3167
15 Ga0068868_100014687 3300005338 Bacteria 5775
16 Ga0068868_100041243 3300005338 Bacteria 3596
17 Ga0068868_100076667 3300005338 Bacteria 2673
18 Ga0068868_100267933 3300005338 Bacteria 1442
19 Ga0070660_100020099 3300005339 Bacteria 4903
20 Ga0070660_100025385 3300005339 Bacteria 4405
21 Ga0070661_100232191 3300005344 Bacteria 1418
22 Ga0070692_10029853 3300005345 Bacteria 2722
23 Ga0070668_100001724 3300005347 Bacteria 15891
24 Ga0070668_100006006 3300005347 Bacteria 9008
25 Ga0070668_100023297 3300005347 Bacteria 4682
26 Ga0070669_100054685 3300005353 Bacteria 2924
27 Ga0070669_100056853 3300005353 Bacteria 2869
28 Ga0070675_100030670 3300005354 Bacteria 4342
29 Ga0070671_100030073 3300005355 Bacteria 4482
30 Ga0070673_100007140 3300005364 Bacteria 7336
31 Ga0070673_100081420 3300005364 Bacteria 2625
32 Ga0070673_100515581 3300005364 Bacteria 1083
33 Ga0070688_100000431 3300005365 Bacteria 21145
34 Ga0070659_100028232 3300005366 Bacteria 4331
35 Ga0070667_100165874 3300005367 Bacteria 1948
36 Ga0070667_100301693 3300005367 Bacteria 1442
37 Ga0070667_100392826 3300005367 Bacteria 1261
38 Ga0070709_10072749 3300005434 Bacteria 2223
39 Ga0070714_100005049 3300005435 Bacteria 10037
40 Ga0070713_100006539 3300005436 Bacteria 8092
41 Ga0070710_10043496 3300005437 Bacteria 2488
42 Ga0070711_100002587 3300005439 Bacteria 10362
43 Ga0070705_100094949 3300005440 Bacteria 1868
44 Ga0070705_100135174 3300005440 Bacteria 1614
45 Ga0070700_100003344 3300005441 Bacteria 8270
46 Ga0070708_100183580 3300005445 Bacteria 1956
47 Ga0070678_100007178 3300005456 Bacteria 6591
48 Ga0070662_100012057 3300005457 Bacteria 5723
49 Ga0068867_100011098 3300005459 Bacteria 6355
50 Ga0070685_10000733 3300005466 Bacteria 17900
51 Ga0070706_100136145 3300005467 Bacteria 2293
52 Ga0070707_100085889 3300005468 Bacteria 3042
53 Ga0070697_100089047 3300005536 Bacteria 2549
54 Ga0070672_100009535 3300005543 Bacteria 6699
55 Ga0070686_100366400 3300005544 Bacteria 1087
56 Ga0070693_100002818 3300005547 Bacteria 7999
57 Ga0070665_100155350 3300005548 Bacteria 2290
58 Ga0070665_100401486 3300005548 Bacteria 1379
59 Ga0068855_100042852 3300005563 Bacteria 5363
60 Ga0070664_100026983 3300005564 Bacteria 4770
61 Ga0068854_100090810 3300005578 Bacteria 2272
62 Ga0068854_100096959 3300005578 Bacteria 2204
63 Ga0068856_100247087 3300005614 Bacteria 1799
64 Ga0070702_100039908 3300005615 Bacteria 2623
65 Ga0070702_100192000 3300005615 Bacteria 1345
66 Ga0068852_100197615 3300005616 Bacteria 1901
67 Ga0068852_100208508 3300005616 Bacteria 1853
68 Ga0068859_100009305 3300005617 Bacteria 9921
69 Ga0068859_100014956 3300005617 Bacteria 7788
70 Ga0068859_100039814 3300005617 Bacteria 4716
71 Ga0068864_100002543 3300005618 Bacteria 15058
72 Ga0068864_100034778 3300005618 Bacteria 4287
73 Ga0068866_10004129 3300005718 Bacteria 5953
74 Ga0068861_100007634 3300005719 Bacteria 7423
75 Ga0068863_100029061 3300005841 Bacteria 5280
76 Ga0068858_100022130 3300005842 Bacteria 5936
77 Ga0068860_100005662 3300005843 Bacteria 12618
78 Ga0068860_100046646 3300005843 Bacteria 4131
79 Ga0068860_100176348 3300005843 Bacteria 2066
80 Ga0068860_100320399 3300005843 Bacteria 1521
81 Ga0068862_100004088 3300005844 Bacteria 12372
82 Ga0075365_10240582 3300006038 Bacteria 1271
83 Ga0075368_10011868 3300006042 Bacteria 3178
84 Ga0075363_100163959 3300006048 Bacteria 1259
85 Ga0070716_100047974 3300006173 Bacteria 2412
86 Ga0070712_100110710 3300006175 Bacteria 2048
87 Ga0075367_10097680 3300006178 Bacteria 1792
88 Ga0097621_100042699 3300006237 Bacteria 3653
89 Ga0097621_100123914 3300006237 Bacteria 2194
90 Ga0097621_100436576 3300006237 Bacteria 1177
91 Ga0068871_100020560 3300006358 Bacteria 5059
92 Ga0075434_100125911 3300006871 Bacteria 2579
93 Ga0068865_100139948 3300006881 Bacteria 1823
94 Ga0075436_100090845 3300006914 Bacteria 2123
95 Ga0075436_100151865 3300006914 Bacteria 1630
96 Ga0097620_100009304 3300006931 Bacteria 9921
97 Ga0097620_100014956 3300006931 Bacteria 7788
98 Ga0097620_100039815 3300006931 Bacteria 4716
99 Ga0075435_100093782 3300007076 Bacteria 2481
100 Ga0105240_10235107 3300009093 Bacteria 2127
101 Ga0105245_10014648 3300009098 Bacteria 6828
102 Ga0105245_10036386 3300009098 Bacteria 4373
103 Ga0105245_10051188 3300009098 Bacteria 3703
104 Ga0105245_10121511 3300009098 Bacteria 2441
105 Ga0114129_10144024 3300009147 Bacteria 3265
106 Ga0105243_10033767 3300009148 Bacteria 3957
107 Ga0105243_10140958 3300009148 Bacteria 2057
108 Ga0105241_10048941 3300009174 Bacteria 3218
109 Ga0105241_10060384 3300009174 Bacteria 2917
110 Ga0105242_10001139 3300009176 Bacteria 20958
111 Ga0105242_10007097 3300009176 Bacteria 8652
112 Ga0105242_10025535 3300009176 Bacteria 4676
113 Ga0105242_10149331 3300009176 Bacteria 2036
114 Ga0105248_10018791 3300009177 Bacteria 7644
115 Ga0105237_10085382 3300009545 Bacteria 3146
116 Ga0105237_10379572 3300009545 Bacteria 1418
117 Ga0105238_10046599 3300009551 Bacteria 4373
118 Ga0105239_10083175 3300010375 Bacteria 3524
119 Ga0105246_10108686 3300011119 Bacteria 2033
120 Ga0105246_10548574 3300011119 Bacteria 990
121 Ga0157373_10158427 3300013100 Bacteria 1593
122 Ga0157371_10194273 3300013102 Bacteria 1454
123 Ga0157370_10024725 3300013104 Bacteria 5947
124 Ga0157369_10079699 3300013105 Bacteria 3507
125 Ga0157374_10178099 3300013296 Bacteria 2076
126 Ga0157374_10273142 3300013296 Bacteria 1667
127 Ga0157378_10352257 3300013297 Bacteria 1438
128 Ga0163162_10656165 3300013306 Bacteria 1173
129 Ga0163162_10657222 3300013306 Bacteria 1172
130 Ga0163163_10027372 3300014325 Bacteria 5460
131 Ga0163163_10039309 3300014325 Bacteria 4617
132 Ga0157379_10009027 3300014968 Bacteria 8688
133 Ga0157379_10011876 3300014968 Bacteria 7609
134 Ga0157379_10089776 3300014968 Bacteria 2757
135 Ga0157379_10242338 3300014968 Bacteria 1635
136 Ga0157376_10104463 3300014969 Bacteria 2482
137 Ga0157376_10116818 3300014969 Bacteria 2358
138 Ga0209563_100015 3300025230 Bacteria 879901
139 Ga0207425_1002144 3300025245 Bacteria 7233
140 Ga0209148_1000310 3300025254 Bacteria 69517
141 Ga0209129_1000326 3300025258 Bacteria 41836
142 Ga0209564_1000057 3300025295 Bacteria 340400
143 Ga0209758_1000096 3300025297 Bacteria 231496
144 Ga0209758_1000174 3300025297 Bacteria 147347
145 Ga0209256_1018525 3300025299 Bacteria 2257
146 Ga0207697_10054538 3300025315 Bacteria 1656
147 Ga0207656_10091194 3300025321 Bacteria 1383
148 Ga0207682_10058829 3300025893 Bacteria 1605
149 Ga0207642_10049242 3300025899 Bacteria 1893
150 Ga0207680_10237185 3300025903 Bacteria 1255
151 Ga0207699_10342138 3300025906 Bacteria 1054
152 Ga0207643_10016501 3300025908 Bacteria 4029
153 Ga0207654_10002267 3300025911 Bacteria 9863
154 Ga0207654_10105248 3300025911 Bacteria 1746
155 Ga0207707_10036998 3300025912 Bacteria 4265
156 Ga0207693_10000913 3300025915 Bacteria 26504
157 Ga0207662_10050533 3300025918 Bacteria 2470
158 Ga0207657_10002519 3300025919 Bacteria 19811
159 Ga0207652_10270671 3300025921 Bacteria 1532
160 Ga0207681_10022623 3300025923 Bacteria 4012
161 Ga0207681_10047553 3300025923 Bacteria 2891
162 Ga0207650_10004376 3300025925 Bacteria 9649
163 Ga0207650_10005813 3300025925 Bacteria 8417
164 Ga0207687_10019002 3300025927 Bacteria 4547
165 Ga0207687_10150960 3300025927 Bacteria 1773
166 Ga0207664_10009147 3300025929 Bacteria 6942
167 Ga0207690_10041169 3300025932 Bacteria 3026
168 Ga0207706_10085964 3300025933 Bacteria 2764
169 Ga0207706_10253238 3300025933 Bacteria 1538
170 Ga0207686_10000911 3300025934 Bacteria 17729
171 Ga0207709_10093241 3300025935 Bacteria 1974
172 Ga0207670_10003139 3300025936 Bacteria 8741
173 Ga0207669_10404685 3300025937 Bacteria 1070
174 Ga0207665_10103448 3300025939 Bacteria 1992
175 Ga0207691_10002611 3300025940 Bacteria 17592
176 Ga0207711_10149847 3300025941 Bacteria 2104
177 Ga0207689_10000354 3300025942 Bacteria 42996
178 Ga0207689_10048509 3300025942 Bacteria 3503
179 Ga0207679_10108884 3300025945 Bacteria 2182
180 Ga0207667_10034972 3300025949 Bacteria 5392
181 Ga0207667_10048275 3300025949 Bacteria 4502
182 Ga0207667_10566401 3300025949 Bacteria 1148
183 Ga0207651_10000415 3300025960 Bacteria 18156
184 Ga0207668_10032352 3300025972 Bacteria 3455
185 Ga0207640_10072247 3300025981 Bacteria 2327
186 Ga0207658_10006494 3300025986 Bacteria 7984
187 Ga0207658_10078778 3300025986 Bacteria 2519
188 Ga0207677_10005226 3300026023 Bacteria 7025
189 Ga0207703_10010295 3300026035 Bacteria 7324
190 Ga0207703_10034431 3300026035 Bacteria 4019
191 Ga0207703_10099429 3300026035 Bacteria 2462
192 Ga0207639_10266459 3300026041 Bacteria 1501
193 Ga0207678_10020524 3300026067 Bacteria 5791
194 Ga0207708_10002841 3300026075 Bacteria 12741
195 Ga0207702_10404131 3300026078 Bacteria 1318
196 Ga0207641_10106292 3300026088 Bacteria 2480
197 Ga0207648_10004748 3300026089 Bacteria 13886
198 Ga0207648_10037205 3300026089 Bacteria 4286
199 Ga0207676_10000369 3300026095 Bacteria 38481
200 Ga0207676_10004458 3300026095 Bacteria 9902
201 Ga0207676_10220379 3300026095 Bacteria 1689
202 Ga0207674_10055515 3300026116 Bacteria 4026
203 Ga0207674_10424550 3300026116 Bacteria 1285
204 Ga0207675_100010505 3300026118 Bacteria 8675
205 Ga0207683_10005029 3300026121 Bacteria 11351
206 Ga0268266_10123807 3300028379 Bacteria 2304
207 Ga0268266_10325608 3300028379 Bacteria 1439
208 Ga0268264_10002307 3300028381 Bacteria 16875
209 Ga0268264_10005529 3300028381 Bacteria 10716
210 Ga0268264_10115992 3300028381 Bacteria 2353
211 Ga0307515_10006527 3300028794 Bacteria 23330
212 Ga0265324_10024405 3300029957 Bacteria 2147
213 Ga0265324_10084584 3300029957 Bacteria 1079
214 Ga0307511_10000061 3300030521 Bacteria 92175
215 Ga0265330_10001258 3300031235 Bacteria 14845
216 Ga0265332_10001479 3300031238 Bacteria 13111
217 Ga0265325_10016549 3300031241 Bacteria 4122
218 Ga0265329_10001661 3300031242 Bacteria 10655
219 Ga0265331_10010328 3300031250 Bacteria 5173
220 Ga0265327_10000781 3300031251 Bacteria 49095
221 Ga0265327_10025277 3300031251 Bacteria 3467
222 Ga0265327_10066717 3300031251 Bacteria 1815
223 Ga0265316_10003746 3300031344 Bacteria 15279
224 Ga0307408_100426675 3300031548 Bacteria 1145
225 Ga0316575_10000457 3300031665 Bacteria 11697
226 Ga0265314_10011936 3300031711 Bacteria 7131
227 Ga0265342_10024809 3300031712 Bacteria 3780
228 Ga0307507_10047262 3300033179 Bacteria 4207
229 Ga0307507_10129522 3300033179 Bacteria 1981
230 Ga0373926_0009133 3300035083 Bacteria 3309
231 Ga0373926_0031074 3300035083 Bacteria 1882
232 Ga0373934_0046462 3300035086 Bacteria 1717
233 Ga0373934_0056518 3300035086 Bacteria 1561
234 Ga0373923_0031143 3300035111 Bacteria 2148
235 Ga0373953_0097837 3300035117 Bacteria 1232
236 Ga0373954_0007163 3300035118 Bacteria 4870
237 Ga0373954_0015480 3300035118 Bacteria 3409
238 Ga0373956_0003405 3300035119 Bacteria 6408
239 Ga0373943_0018064 3300035170 Bacteria 3236
240 Ga0373943_0101658 3300035170 Bacteria 1504
241 Ga0373946_0017040 3300035171 Bacteria 2775
242 Ga0373946_0024204 3300035171 Bacteria 2377
243 Ga0373955_0112442 3300035172 Bacteria 1575
244 Ga0373924_0002871 3300035410 Bacteria 5840
245 Ga0373927_0066140 3300035695 Bacteria 2338
246 Ga0373947_0025242 3300035725 Bacteria 3465
247 Ga0373947_0051126 3300035725 Bacteria 2486
248 Ga0373947_0110895 3300035725 Bacteria 1733
249 Ga0373937_0036750 3300036401 Bacteria 4463
250 Ga0373937_0102067 3300036401 Bacteria 2663
251 Ga0373937_0261646 3300036401 Bacteria 1631
252 Ga0373925_0051539 3300037068 Bacteria 3072
253 Ga0395899_0000166 3300037312 Bacteria 101803
254 Ga0395899_0025122 3300037312 Bacteria 4498
255 Ga0395899_0031116 3300037312 Bacteria 4011
256 Ga0395899_0096284 3300037312 Bacteria 2140
257 Ga0395900_0000729 3300037418 Bacteria 43752
258 Ga0395900_0049776 3300037418 Bacteria 4317
259 Ga0395900_0573808 3300037418 Bacteria 1070
260 Ga0395900_0666113 3300037418 Bacteria 976
261 Ga0395898_0122985 3300037466 Bacteria 2486
262 Ga0395905_0033046 3300037471 Bacteria 4863
263 Ga0395905_0223438 3300037471 Bacteria 1762
264 Ga0395901_0000073 3300038443 Bacteria 139769
265 Ga0395901_0232474 3300038443 Bacteria 1924
266 Ga0439433_0020752 3300041999 Bacteria 1468
267 Ga0451577_0000002 3300042876 Bacteria 1731375
268 Ga0451577_0253487 3300042876 Bacteria 1593
269 Ga0451577_0292589 3300042876 Bacteria 1476
270 Ga0466972_0002219 3300044658 Bacteria 9537
271 Ga0453683_0000003 3300044673 Bacteria 942572
272 Ga0466965_0018917 3300044683 Bacteria 3305
273 Ga0466966_0001386 3300044684 Bacteria 15586
274 Ga0466966_0029002 3300044684 Bacteria 3602
275 Ga0466966_0121694 3300044684 Bacteria 1602
276 Ga0466966_0167626 3300044684 Bacteria 1335
277 Ga0466966_0278815 3300044684 Bacteria 1005
278 Ga0466964_0002849 3300044706 Bacteria 6238
279 Ga0453684_0000002 3300044712 Bacteria 1731375
280 Ga0466971_0007689 3300044719 Bacteria 4699
281 Ga0466968_0000936 3300044735 Bacteria 10278
282 Ga0466957_0000747 3300044842 Bacteria 16583
283 Ga0466957_0047434 3300044842 Bacteria 2610
284 Ga0466957_0178647 3300044842 Bacteria 1385
285 Ga0466959_0069000 3300045049 Bacteria 2561
286 Ga0466959_0228837 3300045049 Bacteria 1287
287 Ga0466959_0294283 3300045049 Bacteria 1112
288 Ga0451576_0000004 3300045051 Bacteria 1312238
289 Ga0451576_0000034 3300045051 Bacteria 390778
290 Ga0451576_0303990 3300045051 Bacteria 1669
291 Ga0495592_0053765 3300046454 Bacteria 2985
292 Ga0495592_0056634 3300046454 Bacteria 2896
293 Ga0495592_0134698 3300046454 Bacteria 1724
294 Ga0495590_0008759 3300046457 Bacteria 3849
295 Ga0495629_0160011 3300046459 Bacteria 1564
296 Ga0495641_0006411 3300046461 Bacteria 7632
297 Ga0495651_0024437 3300046462 Bacteria 4700
298 Ga0495651_0194245 3300046462 Bacteria 1426
299 Ga0495650_0038604 3300046471 Bacteria 2067
300 Ga0495580_0003026 3300046472 Bacteria 14402
301 Ga0495582_0011833 3300046473 Bacteria 4805
302 Ga0495605_0000085 3300046474 Bacteria 121011
303 Ga0495605_0030629 3300046474 Bacteria 2756
304 Ga0495639_0002491 3300046475 Bacteria 8035
305 Ga0495662_0011387 3300046476 Bacteria 4348
306 Ga0495662_0147153 3300046476 Bacteria 1160
307 Ga0495664_0009958 3300046477 Bacteria 5332
308 Ga0495584_0000282 3300046491 Bacteria 35813
309 Ga0495584_0006199 3300046491 Bacteria 6274
310 Ga0495585_0226017 3300046492 Bacteria 942
311 Ga0495607_0002397 3300046501 Bacteria 15287
312 Ga0495607_0040053 3300046501 Bacteria 2792
313 Ga0495606_0014670 3300046507 Bacteria 6094
314 Ga0495608_0028238 3300046511 Bacteria 3813
315 Ga0495616_0000145 3300046513 Bacteria 62415
316 Ga0495616_0079449 3300046513 Bacteria 1572
317 Ga0495616_0131370 3300046513 Bacteria 1147
318 Ga0495620_0062080 3300046515 Bacteria 1553
319 Ga0495628_0008572 3300046516 Bacteria 8758
320 Ga0495628_0024150 3300046516 Bacteria 4979
321 Ga0495628_0024189 3300046516 Bacteria 4973
322 Ga0495632_0000470 3300046519 Bacteria 38273
323 Ga0495643_0003742 3300046522 Bacteria 11008
324 Ga0495643_0120913 3300046522 Bacteria 1323
325 Ga0495648_0058658 3300046524 Bacteria 2300
326 Ga0495666_0023960 3300046526 Bacteria 3018
327 Ga0495642_0000542 3300046528 Bacteria 19018
328 Ga0495652_0030656 3300046529 Bacteria 4715
329 Ga0495652_0221679 3300046529 Bacteria 1421
330 Ga0495665_0005347 3300046531 Bacteria 6921
331 Ga0495665_0022049 3300046531 Bacteria 3425
332 Ga0495609_0000002 3300046538 Bacteria 739816
333 Ga0495609_0001955 3300046538 Bacteria 13102
334 Ga0495645_0014847 3300046543 Bacteria 5534
335 Ga0495645_0204145 3300046543 Bacteria 1338
336 Ga0495645_0230949 3300046543 Bacteria 1239
337 Ga0495667_0124524 3300046559 Bacteria 1663
338 Ga0495667_0213627 3300046559 Bacteria 1232
339 Ga0495635_0019557 3300046663 Bacteria 4719
340 Ga0495635_0184056 3300046663 Bacteria 1419
341 Ga0495661_0000271 3300046665 Bacteria 59543
342 Ga0495661_0002644 3300046665 Bacteria 13711
343 Ga0495661_0018495 3300046665 Bacteria 4582
344 Ga0495657_0010327 3300046675 Bacteria 7030
345 Ga0495599_0007211 3300046678 Bacteria 6735
346 Ga0495647_0000685 3300046681 Bacteria 10112
347 Ga0495613_0117024 3300046689 Bacteria 1916
348 Ga0495589_0000030 3300046794 Bacteria 170254
349 Ga0495589_0000146 3300046794 Bacteria 65628
350 Ga0495600_0016303 3300046809 Bacteria 4713
351 Ga0495600_0075079 3300046809 Bacteria 2208
352 Ga0495660_0000103 3300046810 Bacteria 91169
353 Ga0495660_0056868 3300046810 Bacteria 2112
354 Ga0495660_0101702 3300046810 Bacteria 1478
355 Ga0495581_0000555 3300047315 Bacteria 19346
356 Ga0495604_0015594 3300047317 Bacteria 6065
357 Ga0495604_0215696 3300047317 Bacteria 1324
358 Ga0495674_0001357 3300047319 Bacteria 23867
359 Ga0495672_0001342 3300047320 Bacteria 24428
360 Ga0495672_0006733 3300047320 Bacteria 8821
361 Ga0495676_0243933 3300047321 Bacteria 1229
362 Ga0495680_0042255 3300047322 Bacteria 3619
363 Ga0495683_0004712 3300047323 Bacteria 7666
364 Ga0495687_000047 3300047443 Bacteria 206452
365 Ga0495687_000112 3300047443 Bacteria 124725
366 Ga0495687_003286 3300047443 Bacteria 11899
367 Ga0495687_042571 3300047443 Bacteria 1983
368 Ga0495675_0010770 3300047444 Bacteria 5728
369 Ga0495677_0000044 3300047445 Bacteria 74340
370 Ga0495677_0007723 3300047445 Bacteria 4011
371 Ga0495673_0050096 3300047469 Bacteria 1835
372 Ga0495684_0047680 3300047471 Bacteria 3276
373 Ga0495602_0136825 3300048088 Bacteria 1945
374 Ga0495614_0043833 3300048089 Bacteria 1919
375 Ga0495626_0000006 3300048091 Bacteria 284977
376 Ga0495626_0000266 3300048091 Bacteria 59029
377 Ga0496101_0397073 3300048904 Bacteria 1086
378 Ga0496102_0021108 3300048905 Bacteria 5759
379 Ga0496102_0079055 3300048905 Bacteria 3028
380 Ga0496102_0277266 3300048905 Bacteria 1580
381 Ga0496103_0081093 3300048906 Bacteria 2041
382 Ga0496104_0160389 3300048907 Bacteria 2157
383 Ga0496106_0127287 3300048909 Bacteria 1995
384 Ga0496106_0157496 3300048909 Bacteria 1794
385 Ga0496112_0005199 3300048915 Bacteria 11194
386 Ga0496112_0006687 3300048915 Bacteria 10152
387 Ga0496114_0081186 3300048917 Bacteria 2739
388 Ga0496115_0253263 3300048918 Bacteria 1449
389 Ga0496117_0001922 3300048920 Bacteria 27744
390 Ga0496118_0013360 3300048921 Bacteria 7772
391 Ga0496122_0029075 3300048925 Bacteria 4672
392 Ga0496122_0051051 3300048925 Bacteria 3147
393 Ga0496123_0005152 3300048926 Bacteria 13304
394 Ga0496123_0182068 3300048926 Bacteria 1096
395 Ga0496124_0064462 3300048927 Bacteria 3058
396 Ga0496124_0225986 3300048927 Bacteria 1403
397 Ga0496126_0000890 3300048929 Bacteria 52336
398 Ga0501033_0027439 3300049570 Bacteria 4281
399 Ga0501036_0024205 3300049572 Bacteria 5118
400 Ga0501038_0060635 3300049574 Bacteria 3237
401 Ga0501039_0125483 3300049575 Bacteria 2013
402 Ga0501040_0003488 3300049576 Bacteria 10159
403 Ga0501041_0003464 3300049577 Bacteria 9086
404 Ga0501042_0020678 3300049578 Bacteria 4582
405 Ga0501047_0007731 3300049581 Bacteria 10122
406 Ga0501048_0050878 3300049582 Bacteria 2950
407 Ga0501069_0036979 3300049585 Bacteria 2693
408 Ga0501070_0004115 3300049586 Bacteria 12509
409 Ga0501071_0018915 3300049587 Bacteria 4778
410 Ga0501072_0056704 3300049588 Bacteria 3087
411 Ga0501072_0216362 3300049588 Bacteria 1527
412 Ga0501076_0005936 3300049592 Bacteria 8818
413 Ga0501079_0025506 3300049741 Bacteria 4533
414 Ga0501079_0032701 3300049741 Bacteria 4000
415 Ga0501080_0010812 3300049742 Bacteria 8350
416 Ga0501080_0045811 3300049742 Bacteria 4072
417 Ga0501080_0173264 3300049742 Bacteria 1989
418 Ga0501080_0309522 3300049742 Bacteria 1432
419 Ga0501081_0025580 3300049743 Bacteria 3972
420 Ga0501081_0027852 3300049743 Bacteria 3810
421 Ga0501083_0033337 3300049744 Bacteria 3527
422 Ga0501035_0003001 3300049822 Bacteria 16204
423 Ga0501045_0003802 3300049824 Bacteria 10381
424 nmdc:mga03n38_17819_c1 3300050490 Bacteria 2789
425 nmdc:mga04h51_20283_c1 3300050495 Bacteria 1982
426 nmdc:mga07m45_83139_c1 3300050496 Bacteria 1829
427 nmdc:mga05p37_200981_c1 3300050507 Bacteria 2414
428 nmdc:mga08x19_80413_c1 3300050514 Bacteria 2139
429 Ga0495601_0016966 3300053077 Bacteria 4418
430 Ga0495595_0050833 3300053084 Bacteria 1920
431 Ga0495595_0064379 3300053084 Bacteria 1723
432 Ga0500646_0001385 3300053090 Bacteria 6434
433 Ga0500651_0192342 3300053093 Bacteria 1207
434 Ga0500604_0022516 3300053151 Bacteria 1789
435 Ga0500619_000027 3300053154 Bacteria 48298
436 Ga0500637_0064469 3300053178 Bacteria 2102
437 Ga0501084_0008780 3300054114 Bacteria 8359
438 Ga0501084_0118497 3300054114 Bacteria 2225
439 Ga0501082_0008515 3300060353 Bacteria 8845
440 Ga0501082_0028790 3300060353 Bacteria 4785
441 Ga0530510_0002843 3300061734 Bacteria 11910
442 Ga0530510_0067958 3300061734 Bacteria 2586

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047317 Ga0495604_0215696 Ga0495604_0215696_23_826 251
2 3300049742 Ga0501080_0173264 Ga0501080_0173264_954_1784 264
3 3300037418 Ga0395900_0666113 Ga0395900_0666113_20_835 267
4 3300046492 Ga0495585_0226017 Ga0495585_0226017_117_932 267
5 3300010375 Ga0105239_10083175 Ga0105239_100831752 278
6 3300049575 Ga0501039_0125483 Ga0501039_0125483_1057_1962 287
7 3300005441 Ga0070700_100003344 Ga0070700_10000334410 289
8 3300009148 Ga0105243_10033767 Ga0105243_100337673 289
9 3300009176 Ga0105242_10149331 Ga0105242_101493313 289
10 3300026075 Ga0207708_10002841 Ga0207708_1000284114 289
11 3300031251 Ga0265327_10000781 Ga0265327_1000078121 289
12 3300005330 Ga0070690_100005727 Ga0070690_1000057275 290
13 3300005331 Ga0070670_100052271 Ga0070670_1000522713 290
14 3300005335 Ga0070666_10010771 Ga0070666_100107713 290
15 3300005338 Ga0068868_100076667 Ga0068868_1000766672 290
16 3300005338 Ga0068868_100267933 Ga0068868_1002679332 290
17 3300005355 Ga0070671_100030073 Ga0070671_1000300732 290
18 3300005364 Ga0070673_100081420 Ga0070673_1000814202 290
19 3300005365 Ga0070688_100000431 Ga0070688_10000043112 290
20 3300005367 Ga0070667_100301693 Ga0070667_1003016931 290
21 3300005367 Ga0070667_100392826 Ga0070667_1003928262 290
22 3300005437 Ga0070710_10043496 Ga0070710_100434961 290
23 3300005439 Ga0070711_100002587 Ga0070711_1000025879 290
24 3300005456 Ga0070678_100007178 Ga0070678_1000071782 290
25 3300005457 Ga0070662_100012057 Ga0070662_1000120572 290
26 3300005466 Ga0070685_10000733 Ga0070685_1000073310 290
27 3300005544 Ga0070686_100366400 Ga0070686_1003664001 290
28 3300005547 Ga0070693_100002818 Ga0070693_1000028186 290
29 3300005578 Ga0068854_100096959 Ga0068854_1000969592 290
30 3300005615 Ga0070702_100039908 Ga0070702_1000399081 290
31 3300005618 Ga0068864_100034778 Ga0068864_1000347783 290
32 3300005718 Ga0068866_10004129 Ga0068866_100041292 290
33 3300005841 Ga0068863_100029061 Ga0068863_1000290615 290
34 3300005843 Ga0068860_100046646 Ga0068860_1000466463 290
35 3300005843 Ga0068860_100320399 Ga0068860_1003203992 290
36 3300006173 Ga0070716_100047974 Ga0070716_1000479742 290
37 3300006237 Ga0097621_100042699 Ga0097621_1000426992 290
38 3300006237 Ga0097621_100436576 Ga0097621_1004365761 290
39 3300006358 Ga0068871_100020560 Ga0068871_1000205602 290
40 3300006871 Ga0075434_100125911 Ga0075434_1001259112 290
41 3300006881 Ga0068865_100139948 Ga0068865_1001399482 290
42 3300009098 Ga0105245_10014648 Ga0105245_100146486 290
43 3300009176 Ga0105242_10025535 Ga0105242_100255355 290
44 3300011119 Ga0105246_10108686 Ga0105246_101086862 290
45 3300013296 Ga0157374_10178099 Ga0157374_101780992 290
46 3300013297 Ga0157378_10352257 Ga0157378_103522572 290
47 3300013306 Ga0163162_10656165 Ga0163162_106561651 290
48 3300013306 Ga0163162_10657222 Ga0163162_106572221 290
49 3300014325 Ga0163163_10039309 Ga0163163_100393092 290
50 3300014968 Ga0157379_10009027 Ga0157379_100090277 290
51 3300014969 Ga0157376_10104463 Ga0157376_101044632 290
52 3300014969 Ga0157376_10116818 Ga0157376_101168182 290
53 3300025899 Ga0207642_10049242 Ga0207642_100492422 290
54 3300025903 Ga0207680_10237185 Ga0207680_102371852 290
55 3300025915 Ga0207693_10000913 Ga0207693_100009137 290
56 3300025918 Ga0207662_10050533 Ga0207662_100505332 290
57 3300025925 Ga0207650_10004376 Ga0207650_100043762 290
58 3300025927 Ga0207687_10019002 Ga0207687_100190022 290
59 3300025933 Ga0207706_10085964 Ga0207706_100859642 290
60 3300025934 Ga0207686_10000911 Ga0207686_1000091111 290
61 3300025936 Ga0207670_10003139 Ga0207670_100031392 290
62 3300025939 Ga0207665_10103448 Ga0207665_101034482 290
63 3300025941 Ga0207711_10149847 Ga0207711_101498471 290
64 3300025942 Ga0207689_10048509 Ga0207689_100485093 290
65 3300025960 Ga0207651_10000415 Ga0207651_100004155 290
66 3300025981 Ga0207640_10072247 Ga0207640_100722472 290
67 3300026035 Ga0207703_10099429 Ga0207703_100994292 290
68 3300026088 Ga0207641_10106292 Ga0207641_101062922 290
69 3300026089 Ga0207648_10037205 Ga0207648_100372054 290
70 3300026095 Ga0207676_10000369 Ga0207676_1000036934 290
71 3300026121 Ga0207683_10005029 Ga0207683_100050297 290
72 3300035083 Ga0373926_0009133 Ga0373926_0009133_2103_3029 290
73 3300035083 Ga0373926_0031074 Ga0373926_0031074_934_1860 290
74 3300035119 Ga0373956_0003405 Ga0373956_0003405_3819_4745 290
75 3300035170 Ga0373943_0018064 Ga0373943_0018064_335_1261 290
76 3300035170 Ga0373943_0101658 Ga0373943_0101658_374_1300 290
77 3300035171 Ga0373946_0017040 Ga0373946_0017040_768_1694 290
78 3300035725 Ga0373947_0025242 Ga0373947_0025242_1161_2087 290
79 3300035725 Ga0373947_0110895 Ga0373947_0110895_431_1357 290
80 3300046476 Ga0495662_0147153 Ga0495662_0147153_155_1081 290
81 3300046531 Ga0495665_0022049 Ga0495665_0022049_1165_2091 290
82 3300046543 Ga0495645_0230949 Ga0495645_0230949_113_1039 290
83 3300046663 Ga0495635_0019557 Ga0495635_0019557_3226_4152 290
84 3300046809 Ga0495600_0075079 Ga0495600_0075079_363_1289 290
85 3300047315 Ga0495581_0000555 Ga0495581_0000555_16537_17463 290
86 3300047322 Ga0495680_0042255 Ga0495680_0042255_1779_2705 290
87 3300048907 Ga0496104_0160389 Ga0496104_0160389_577_1503 290
88 3300048915 Ga0496112_0006687 Ga0496112_0006687_843_1769 290
89 3300048917 Ga0496114_0081186 Ga0496114_0081186_363_1289 290
90 3300048918 Ga0496115_0253263 Ga0496115_0253263_86_1012 290
91 3300053084 Ga0495595_0064379 Ga0495595_0064379_559_1485 290
92 3300005338 Ga0068868_100041243 Ga0068868_1000412432 291
93 3300005339 Ga0070660_100020099 Ga0070660_1000200992 291
94 3300006914 Ga0075436_100151865 Ga0075436_1001518652 291
95 3300009545 Ga0105237_10379572 Ga0105237_103795721 291
96 3300009551 Ga0105238_10046599 Ga0105238_100465994 291
97 3300013105 Ga0157369_10079699 Ga0157369_100796992 291
98 3300025919 Ga0207657_10002519 Ga0207657_100025192 291
99 3300035086 Ga0373934_0056518 Ga0373934_0056518_565_1491 291
100 3300036401 Ga0373937_0036750 Ga0373937_0036750_48_974 291
101 3300048088 Ga0495602_0136825 Ga0495602_0136825_53_979 291
102 3300049570 Ga0501033_0027439 Ga0501033_0027439_1640_2569 291
103 3300049572 Ga0501036_0024205 Ga0501036_0024205_2684_3613 291
104 3300049574 Ga0501038_0060635 Ga0501038_0060635_587_1516 291
105 3300049576 Ga0501040_0003488 Ga0501040_0003488_5179_6108 291
106 3300049577 Ga0501041_0003464 Ga0501041_0003464_2641_3570 291
107 3300049578 Ga0501042_0020678 Ga0501042_0020678_1678_2607 291
108 3300049582 Ga0501048_0050878 Ga0501048_0050878_520_1449 291
109 3300049587 Ga0501071_0018915 Ga0501071_0018915_3740_4669 291
110 3300049588 Ga0501072_0056704 Ga0501072_0056704_649_1578 291
111 3300049592 Ga0501076_0005936 Ga0501076_0005936_1964_2893 291
112 3300049741 Ga0501079_0025506 Ga0501079_0025506_1493_2422 291
113 3300049743 Ga0501081_0027852 Ga0501081_0027852_1404_2333 291
114 3300049824 Ga0501045_0003802 Ga0501045_0003802_6179_7108 291
115 3300054114 Ga0501084_0008780 Ga0501084_0008780_3931_4860 291
116 3300060353 Ga0501082_0008515 Ga0501082_0008515_5636_6565 291
117 3300061734 Ga0530510_0002843 Ga0530510_0002843_9443_10372 291
118 3300005336 Ga0070680_100057952 Ga0070680_1000579523 293
119 3300005440 Ga0070705_100094949 Ga0070705_1000949492 293
120 3300005445 Ga0070708_100183580 Ga0070708_1001835802 293
121 3300005468 Ga0070707_100085889 Ga0070707_1000858892 293
122 3300005536 Ga0070697_100089047 Ga0070697_1000890472 293
123 3300005615 Ga0070702_100192000 Ga0070702_1001920002 293
124 3300011119 Ga0105246_10548574 Ga0105246_105485741 293
125 3300025911 Ga0207654_10105248 Ga0207654_101052481 293
126 3300025912 Ga0207707_10036998 Ga0207707_100369981 293
127 3300025921 Ga0207652_10270671 Ga0207652_102706712 293
128 3300025933 Ga0207706_10253238 Ga0207706_102532382 293
129 3300026067 Ga0207678_10020524 Ga0207678_100205245 293
130 3300026116 Ga0207674_10055515 Ga0207674_100555154 293
131 3300048905 Ga0496102_0079055 Ga0496102_0079055_1841_2767 293
132 3300048909 Ga0496106_0127287 Ga0496106_0127287_121_1047 293
133 3300049581 Ga0501047_0007731 Ga0501047_0007731_7313_8272 293
134 3300049585 Ga0501069_0036979 Ga0501069_0036979_887_1846 293
135 3300049586 Ga0501070_0004115 Ga0501070_0004115_9735_10694 293
136 3300049588 Ga0501072_0216362 Ga0501072_0216362_148_1107 293
137 3300049741 Ga0501079_0032701 Ga0501079_0032701_2942_3901 293
138 3300049742 Ga0501080_0010812 Ga0501080_0010812_3272_4231 293
139 3300049742 Ga0501080_0045811 Ga0501080_0045811_648_1604 293
140 3300049744 Ga0501083_0033337 Ga0501083_0033337_717_1676 293
141 3300054114 Ga0501084_0118497 Ga0501084_0118497_451_1410 293
142 3300060353 Ga0501082_0028790 Ga0501082_0028790_741_1700 293
143 3300005344 Ga0070661_100232191 Ga0070661_1002321912 294
144 3300013100 Ga0157373_10158427 Ga0157373_101584272 294
145 3300005617 Ga0068859_100014956 Ga0068859_1000149566 295
146 3300005617 Ga0068859_100039814 Ga0068859_1000398144 295
147 3300006237 Ga0097621_100123914 Ga0097621_1001239142 295
148 3300006931 Ga0097620_100014956 Ga0097620_1000149565 295
149 3300006931 Ga0097620_100039815 Ga0097620_1000398154 295
150 3300009098 Ga0105245_10051188 Ga0105245_100511884 295
151 3300009176 Ga0105242_10007097 Ga0105242_100070973 295
152 3300025927 Ga0207687_10150960 Ga0207687_101509602 295
153 3300026035 Ga0207703_10034431 Ga0207703_100344314 295
154 3300028381 Ga0268264_10005529 Ga0268264_100055296 295
155 3300005434 Ga0070709_10072749 Ga0070709_100727492 296
156 3300005435 Ga0070714_100005049 Ga0070714_1000050497 296
157 3300005436 Ga0070713_100006539 Ga0070713_1000065396 296
158 3300006175 Ga0070712_100110710 Ga0070712_1001107102 296
159 3300025906 Ga0207699_10342138 Ga0207699_103421381 296
160 3300025929 Ga0207664_10009147 Ga0207664_100091472 296
161 3300007076 Ga0075435_100093782 Ga0075435_1000937822 297
162 3300009147 Ga0114129_10144024 Ga0114129_101440242 297
163 3300050496 nmdc:mga07m45_83139_c1 nmdc:mga07m45_83139_c1_487_1443 297
164 3300050507 nmdc:mga05p37_200981_c1 nmdc:mga05p37_200981_c1_897_1847 297
165 iso_pu_bacteria 2643221556 2643797843 297
166 iso_pu_bacteria 2643221684 2644473023 297
167 3300014968 Ga0157379_10242338 Ga0157379_102423382 298
168 3300005347 Ga0070668_100006006 Ga0070668_1000060062 299
169 3300005353 Ga0070669_100056853 Ga0070669_1000568532 299
170 3300005354 Ga0070675_100030670 Ga0070675_1000306702 299
171 3300005367 Ga0070667_100165874 Ga0070667_1001658742 299
172 3300005548 Ga0070665_100155350 Ga0070665_1001553502 299
173 3300013296 Ga0157374_10273142 Ga0157374_102731422 299
174 3300025923 Ga0207681_10022623 Ga0207681_100226232 299
175 3300025937 Ga0207669_10404685 Ga0207669_104046852 299
176 3300025972 Ga0207668_10032352 Ga0207668_100323522 299
177 3300025986 Ga0207658_10078778 Ga0207658_100787782 299
178 3300026095 Ga0207676_10220379 Ga0207676_102203792 299
179 3300028379 Ga0268266_10123807 Ga0268266_101238072 299
180 3300031251 Ga0265327_10066717 Ga0265327_100667172 299
181 3300049742 Ga0501080_0309522 Ga0501080_0309522_260_1189 299
182 3300049743 Ga0501081_0025580 Ga0501081_0025580_878_1807 299
183 3300061734 Ga0530510_0067958 Ga0530510_0067958_527_1456 299
184 3300005262 Ga0065165_1003696 Ga0065165_10036966 300
185 3300005331 Ga0070670_100004099 Ga0070670_1000040998 300
186 3300005333 Ga0070677_10011154 Ga0070677_100111542 300
187 3300005334 Ga0068869_100001687 Ga0068869_1000016879 300
188 3300005338 Ga0068868_100014687 Ga0068868_1000146872 300
189 3300005347 Ga0070668_100001724 Ga0070668_10000172410 300
190 3300005347 Ga0070668_100023297 Ga0070668_1000232974 300
191 3300005353 Ga0070669_100054685 Ga0070669_1000546852 300
192 3300005364 Ga0070673_100007140 Ga0070673_1000071402 300
193 3300005440 Ga0070705_100135174 Ga0070705_1001351742 300
194 3300005459 Ga0068867_100011098 Ga0068867_1000110985 300
195 3300005543 Ga0070672_100009535 Ga0070672_1000095352 300
196 3300005578 Ga0068854_100090810 Ga0068854_1000908102 300
197 3300005616 Ga0068852_100197615 Ga0068852_1001976151 300
198 3300005617 Ga0068859_100009305 Ga0068859_1000093054 300
199 3300005618 Ga0068864_100002543 Ga0068864_1000025439 300
200 3300005719 Ga0068861_100007634 Ga0068861_1000076344 300
201 3300005842 Ga0068858_100022130 Ga0068858_1000221304 300
202 3300005843 Ga0068860_100005662 Ga0068860_1000056628 300
203 3300005844 Ga0068862_100004088 Ga0068862_10000408812 300
204 3300006931 Ga0097620_100009304 Ga0097620_1000093047 300
205 3300009098 Ga0105245_10036386 Ga0105245_100363862 300
206 3300009177 Ga0105248_10018791 Ga0105248_100187914 300
207 3300014325 Ga0163163_10027372 Ga0163163_100273722 300
208 3300014968 Ga0157379_10011876 Ga0157379_100118763 300
209 3300025315 Ga0207697_10054538 Ga0207697_100545382 300
210 3300025321 Ga0207656_10091194 Ga0207656_100911942 300
211 3300025908 Ga0207643_10016501 Ga0207643_100165012 300
212 3300025923 Ga0207681_10047553 Ga0207681_100475532 300
213 3300025925 Ga0207650_10005813 Ga0207650_100058133 300
214 3300025940 Ga0207691_10002611 Ga0207691_1000261110 300
215 3300025942 Ga0207689_10000354 Ga0207689_100003548 300
216 3300025945 Ga0207679_10108884 Ga0207679_101088842 300
217 3300026023 Ga0207677_10005226 Ga0207677_100052265 300
218 3300026035 Ga0207703_10010295 Ga0207703_100102955 300
219 3300026041 Ga0207639_10266459 Ga0207639_102664592 300
220 3300026089 Ga0207648_10004748 Ga0207648_1000474811 300
221 3300026095 Ga0207676_10004458 Ga0207676_100044586 300
222 3300026118 Ga0207675_100010505 Ga0207675_1000105057 300
223 3300028381 Ga0268264_10002307 Ga0268264_100023077 300
224 3300046454 Ga0495592_0056634 Ga0495592_0056634_1887_2792 300
225 3300046516 Ga0495628_0024189 Ga0495628_0024189_3881_4786 300
226 3300048905 Ga0496102_0021108 Ga0496102_0021108_587_1492 300
227 3300003215 JGI25153J46596_10013271 JGI25153J46596_100132713 301
228 3300006914 Ga0075436_100090845 Ga0075436_1000908452 301
229 3300025297 Ga0209758_1000096 Ga0209758_10000967 301
230 3300035118 Ga0373954_0015480 Ga0373954_0015480_577_1485 301
231 3300035695 Ga0373927_0066140 Ga0373927_0066140_159_1070 301
232 3300042876 Ga0451577_0253487 Ga0451577_0253487_127_1035 301
233 3300046454 Ga0495592_0134698 Ga0495592_0134698_93_1013 301
234 3300046516 Ga0495628_0008572 Ga0495628_0008572_7248_8168 301
235 3300046529 Ga0495652_0221679 Ga0495652_0221679_399_1319 301
236 3300046543 Ga0495645_0014847 Ga0495645_0014847_3063_3983 301
237 3300046678 Ga0495599_0007211 Ga0495599_0007211_4235_5155 301
238 3300053093 Ga0500651_0192342 Ga0500651_0192342_155_1084 301
239 3300002773 JGI25152J39213_1002192 JGI25152J39213_10021924 302
240 3300003215 JGI25153J46596_10005801 JGI25153J46596_100058012 302
241 3300025245 Ga0207425_1002144 Ga0207425_10021442 302
242 3300025258 Ga0209129_1000326 Ga0209129_10003267 302
243 3300025295 Ga0209564_1000057 Ga0209564_1000057271 302
244 3300025297 Ga0209758_1000174 Ga0209758_10001747 302
245 3300025299 Ga0209256_1018525 Ga0209256_10185252 302
246 3300031251 Ga0265327_10025277 Ga0265327_100252772 302
247 3300036401 Ga0373937_0102067 Ga0373937_0102067_628_1545 302
248 3300042876 Ga0451577_0292589 Ga0451577_0292589_380_1294 302
249 3300045051 Ga0451576_0000034 Ga0451576_0000034_60341_61255 302
250 3300005345 Ga0070692_10029853 Ga0070692_100298532 304
251 3300005564 Ga0070664_100026983 Ga0070664_1000269832 304
252 3300005616 Ga0068852_100208508 Ga0068852_1002085082 304
253 3300009098 Ga0105245_10121511 Ga0105245_101215112 304
254 3300009174 Ga0105241_10060384 Ga0105241_100603842 304
255 3300013104 Ga0157370_10024725 Ga0157370_100247252 304
256 3300025932 Ga0207690_10041169 Ga0207690_100411692 304
257 3300028794 Ga0307515_10006527 Ga0307515_1000652714 304
258 3300006038 Ga0075365_10240582 Ga0075365_102405822 305
259 3300006042 Ga0075368_10011868 Ga0075368_100118683 305
260 3300006048 Ga0075363_100163959 Ga0075363_1001639592 305
261 3300006178 Ga0075367_10097680 Ga0075367_100976802 305
262 3300009176 Ga0105242_10001139 Ga0105242_1000113920 305
263 3300014968 Ga0157379_10089776 Ga0157379_100897762 305
264 3300031548 Ga0307408_100426675 Ga0307408_1004266752 305
265 3300050490 nmdc:mga03n38_17819_c1 nmdc:mga03n38_17819_c1_1271_2197 305
266 3300050495 nmdc:mga04h51_20283_c1 nmdc:mga04h51_20283_c1_185_1111 305
267 3300025893 Ga0207682_10058829 Ga0207682_100588292 306
268 3300031235 Ga0265330_10001258 Ga0265330_100012588 306
269 3300031238 Ga0265332_10001479 Ga0265332_100014793 306
270 3300031241 Ga0265325_10016549 Ga0265325_100165492 306
271 3300031242 Ga0265329_10001661 Ga0265329_100016618 306
272 3300031250 Ga0265331_10010328 Ga0265331_100103282 306
273 3300031344 Ga0265316_10003746 Ga0265316_100037465 306
274 3300031711 Ga0265314_10011936 Ga0265314_100119362 306
275 3300031712 Ga0265342_10024809 Ga0265342_100248092 306
276 3300046462 Ga0495651_0194245 Ga0495651_0194245_187_1221 307
277 iso_pu_bacteria 8047673197 8047677845 307
278 3300005548 Ga0070665_100401486 Ga0070665_1004014862 308
279 3300005563 Ga0068855_100042852 Ga0068855_1000428523 308
280 3300005843 Ga0068860_100176348 Ga0068860_1001763482 308
281 3300025949 Ga0207667_10034972 Ga0207667_100349724 308
282 3300025986 Ga0207658_10006494 Ga0207658_100064947 308
283 3300028379 Ga0268266_10325608 Ga0268266_103256082 308
284 3300028381 Ga0268264_10115992 Ga0268264_101159922 308
285 3300045051 Ga0451576_0303990 Ga0451576_0303990_568_1506 308
286 3300050514 nmdc:mga08x19_80413_c1 nmdc:mga08x19_80413_c1_11_949 308
287 3300053154 Ga0500619_000027 Ga0500619_000027_41346_42326 308
288 3300005467 Ga0070706_100136145 Ga0070706_1001361452 309
289 3300042876 Ga0451577_0000002 Ga0451577_0000002_48259_49200 309
290 3300044673 Ga0453683_0000003 Ga0453683_0000003_48259_49200 309
291 3300044712 Ga0453684_0000002 Ga0453684_0000002_1682176_1683117 309
292 3300045051 Ga0451576_0000004 Ga0451576_0000004_1308816_1309757 309
293 3300046471 Ga0495650_0038604 Ga0495650_0038604_149_1102 309
294 3300046474 Ga0495605_0030629 Ga0495605_0030629_1520_2467 309
295 3300046491 Ga0495584_0006199 Ga0495584_0006199_4506_5453 309
296 3300046501 Ga0495607_0002397 Ga0495607_0002397_9257_10204 309
297 3300046513 Ga0495616_0000145 Ga0495616_0000145_17910_18857 309
298 3300046538 Ga0495609_0000002 Ga0495609_0000002_88619_89566 309
299 3300046665 Ga0495661_0000271 Ga0495661_0000271_33916_34863 309
300 3300046794 Ga0495589_0000030 Ga0495589_0000030_129224_130171 309
301 3300047443 Ga0495687_000047 Ga0495687_000047_129226_130173 309
302 3300047445 Ga0495677_0000044 Ga0495677_0000044_39478_40425 309
303 3300048091 Ga0495626_0000266 Ga0495626_0000266_33916_34863 309
304 3300030521 Ga0307511_10000061 Ga0307511_1000006157 310
305 3300033179 Ga0307507_10047262 Ga0307507_100472624 310
306 3300033179 Ga0307507_10129522 Ga0307507_101295222 310
307 3300035086 Ga0373934_0046462 Ga0373934_0046462_165_1142 310
308 3300035111 Ga0373923_0031143 Ga0373923_0031143_211_1188 310
309 3300035117 Ga0373953_0097837 Ga0373953_0097837_37_1014 310
310 3300035118 Ga0373954_0007163 Ga0373954_0007163_2087_3064 310
311 3300035171 Ga0373946_0024204 Ga0373946_0024204_797_1774 310
312 3300035172 Ga0373955_0112442 Ga0373955_0112442_212_1189 310
313 3300035410 Ga0373924_0002871 Ga0373924_0002871_344_1321 310
314 3300035725 Ga0373947_0051126 Ga0373947_0051126_1465_2442 310
315 3300036401 Ga0373937_0261646 Ga0373937_0261646_351_1328 310
316 3300037068 Ga0373925_0051539 Ga0373925_0051539_1186_2163 310
317 3300041999 Ga0439433_0020752 Ga0439433_0020752_202_1155 310
318 3300046454 Ga0495592_0053765 Ga0495592_0053765_672_1649 310
319 3300046459 Ga0495629_0160011 Ga0495629_0160011_219_1196 310
320 3300046461 Ga0495641_0006411 Ga0495641_0006411_3039_4016 310
321 3300046462 Ga0495651_0024437 Ga0495651_0024437_605_1582 310
322 3300046472 Ga0495580_0003026 Ga0495580_0003026_398_1375 310
323 3300046473 Ga0495582_0011833 Ga0495582_0011833_3304_4281 310
324 3300046475 Ga0495639_0002491 Ga0495639_0002491_1665_2642 310
325 3300046476 Ga0495662_0011387 Ga0495662_0011387_504_1481 310
326 3300046477 Ga0495664_0009958 Ga0495664_0009958_1063_2040 310
327 3300046511 Ga0495608_0028238 Ga0495608_0028238_783_1760 310
328 3300046516 Ga0495628_0024150 Ga0495628_0024150_2293_3270 310
329 3300046526 Ga0495666_0023960 Ga0495666_0023960_1565_2542 310
330 3300046529 Ga0495652_0030656 Ga0495652_0030656_3234_4211 310
331 3300046531 Ga0495665_0005347 Ga0495665_0005347_4059_5036 310
332 3300046559 Ga0495667_0124524 Ga0495667_0124524_477_1454 310
333 3300046559 Ga0495667_0213627 Ga0495667_0213627_219_1196 310
334 3300046663 Ga0495635_0184056 Ga0495635_0184056_71_1048 310
335 3300046675 Ga0495657_0010327 Ga0495657_0010327_3979_4956 310
336 3300046681 Ga0495647_0000685 Ga0495647_0000685_1366_2343 310
337 3300046689 Ga0495613_0117024 Ga0495613_0117024_98_1075 310
338 3300046809 Ga0495600_0016303 Ga0495600_0016303_605_1582 310
339 3300047317 Ga0495604_0015594 Ga0495604_0015594_3093_4070 310
340 3300047319 Ga0495674_0001357 Ga0495674_0001357_3635_4612 310
341 3300047444 Ga0495675_0010770 Ga0495675_0010770_1296_2273 310
342 3300047471 Ga0495684_0047680 Ga0495684_0047680_1368_2345 310
343 3300048089 Ga0495614_0043833 Ga0495614_0043833_156_1133 310
344 3300053077 Ga0495601_0016966 Ga0495601_0016966_435_1412 310
345 3300053084 Ga0495595_0050833 Ga0495595_0050833_303_1280 310
346 3300053090 Ga0500646_0001385 Ga0500646_0001385_5060_6004 310
347 3300053151 Ga0500604_0022516 Ga0500604_0022516_524_1468 310
348 3300053178 Ga0500637_0064469 Ga0500637_0064469_1088_2032 310
349 3300003759 Ga0055525_1000009 Ga0055525_1000009262 311
350 3300005327 Ga0070658_10067094 Ga0070658_100670945 311
351 3300005339 Ga0070660_100025385 Ga0070660_1000253852 311
352 3300005364 Ga0070673_100515581 Ga0070673_1005155811 311
353 3300005366 Ga0070659_100028232 Ga0070659_1000282322 311
354 3300005614 Ga0068856_100247087 Ga0068856_1002470874 311
355 3300009148 Ga0105243_10140958 Ga0105243_101409582 311
356 3300009174 Ga0105241_10048941 Ga0105241_100489413 311
357 3300009545 Ga0105237_10085382 Ga0105237_100853825 311
358 3300013102 Ga0157371_10194273 Ga0157371_101942734 311
359 3300025230 Ga0209563_100015 Ga0209563_100015376 311
360 3300025254 Ga0209148_1000310 Ga0209148_100031050 311
361 3300025911 Ga0207654_10002267 Ga0207654_100022679 311
362 3300025935 Ga0207709_10093241 Ga0207709_100932412 311
363 3300025949 Ga0207667_10048275 Ga0207667_100482753 311
364 3300025949 Ga0207667_10566401 Ga0207667_105664011 311
365 3300026078 Ga0207702_10404131 Ga0207702_104041312 311
366 3300026116 Ga0207674_10424550 Ga0207674_104245502 311
367 3300029957 Ga0265324_10024405 Ga0265324_100244052 311
368 3300029957 Ga0265324_10084584 Ga0265324_100845841 311
369 3300031665 Ga0316575_10000457 Ga0316575_100004578 311
370 3300037312 Ga0395899_0025122 Ga0395899_0025122_1833_2786 311
371 3300037312 Ga0395899_0031116 Ga0395899_0031116_793_1746 311
372 3300037312 Ga0395899_0096284 Ga0395899_0096284_327_1280 311
373 3300037418 Ga0395900_0000729 Ga0395900_0000729_19298_20251 311
374 3300037418 Ga0395900_0049776 Ga0395900_0049776_2730_3683 311
375 3300037418 Ga0395900_0573808 Ga0395900_0573808_42_995 311
376 3300037466 Ga0395898_0122985 Ga0395898_0122985_1274_2227 311
377 3300037471 Ga0395905_0033046 Ga0395905_0033046_2796_3749 311
378 3300037471 Ga0395905_0223438 Ga0395905_0223438_219_1172 311
379 3300038443 Ga0395901_0000073 Ga0395901_0000073_138336_139289 311
380 3300038443 Ga0395901_0232474 Ga0395901_0232474_505_1458 311
381 3300044658 Ga0466972_0002219 Ga0466972_0002219_3314_4267 311
382 3300044683 Ga0466965_0018917 Ga0466965_0018917_1590_2543 311
383 3300044684 Ga0466966_0029002 Ga0466966_0029002_2614_3567 311
384 3300044684 Ga0466966_0121694 Ga0466966_0121694_504_1466 311
385 3300044684 Ga0466966_0167626 Ga0466966_0167626_201_1154 311
386 3300044684 Ga0466966_0278815 Ga0466966_0278815_17_970 311
387 3300044706 Ga0466964_0002849 Ga0466964_0002849_2044_2997 311
388 3300044719 Ga0466971_0007689 Ga0466971_0007689_23_976 311
389 3300044735 Ga0466968_0000936 Ga0466968_0000936_2056_3009 311
390 3300044842 Ga0466957_0000747 Ga0466957_0000747_226_1179 311
391 3300044842 Ga0466957_0178647 Ga0466957_0178647_331_1284 311
392 3300045049 Ga0466959_0069000 Ga0466959_0069000_1466_2419 311
393 3300045049 Ga0466959_0294283 Ga0466959_0294283_124_1077 311
394 3300046474 Ga0495605_0000085 Ga0495605_0000085_87619_88572 311
395 3300046491 Ga0495584_0000282 Ga0495584_0000282_8841_9794 311
396 3300046501 Ga0495607_0040053 Ga0495607_0040053_1488_2441 311
397 3300046507 Ga0495606_0014670 Ga0495606_0014670_4993_5946 311
398 3300046513 Ga0495616_0079449 Ga0495616_0079449_212_1165 311
399 3300046513 Ga0495616_0131370 Ga0495616_0131370_27_980 311
400 3300046522 Ga0495643_0003742 Ga0495643_0003742_4470_5423 311
401 3300046522 Ga0495643_0120913 Ga0495643_0120913_256_1209 311
402 3300046524 Ga0495648_0058658 Ga0495648_0058658_1098_2060 311
403 3300046528 Ga0495642_0000542 Ga0495642_0000542_11233_12186 311
404 3300046538 Ga0495609_0001955 Ga0495609_0001955_4464_5423 311
405 3300046543 Ga0495645_0204145 Ga0495645_0204145_223_1176 311
406 3300046665 Ga0495661_0002644 Ga0495661_0002644_2618_3580 311
407 3300046665 Ga0495661_0018495 Ga0495661_0018495_272_1225 311
408 3300046794 Ga0495589_0000146 Ga0495589_0000146_43254_44207 311
409 3300046810 Ga0495660_0000103 Ga0495660_0000103_2031_2984 311
410 3300046810 Ga0495660_0056868 Ga0495660_0056868_793_1785 311
411 3300046810 Ga0495660_0101702 Ga0495660_0101702_175_1128 311
412 3300047320 Ga0495672_0006733 Ga0495672_0006733_2134_3087 311
413 3300047321 Ga0495676_0243933 Ga0495676_0243933_140_1099 311
414 3300047323 Ga0495683_0004712 Ga0495683_0004712_6483_7436 311
415 3300047443 Ga0495687_000112 Ga0495687_000112_18389_19342 311
416 3300047443 Ga0495687_003286 Ga0495687_003286_9380_10333 311
417 3300047443 Ga0495687_042571 Ga0495687_042571_814_1776 311
418 3300047445 Ga0495677_0007723 Ga0495677_0007723_1537_2490 311
419 3300048091 Ga0495626_0000006 Ga0495626_0000006_237363_238316 311
420 3300048904 Ga0496101_0397073 Ga0496101_0397073_94_1047 311
421 3300048905 Ga0496102_0277266 Ga0496102_0277266_264_1217 311
422 3300048906 Ga0496103_0081093 Ga0496103_0081093_123_1076 311
423 3300048909 Ga0496106_0157496 Ga0496106_0157496_199_1152 311
424 3300048925 Ga0496122_0029075 Ga0496122_0029075_3521_4474 311
425 3300048926 Ga0496123_0005152 Ga0496123_0005152_10735_11688 311
426 3300048926 Ga0496123_0182068 Ga0496123_0182068_76_1029 311
427 3300048927 Ga0496124_0064462 Ga0496124_0064462_332_1285 311
428 3300048927 Ga0496124_0225986 Ga0496124_0225986_275_1228 311
429 3300049822 Ga0501035_0003001 Ga0501035_0003001_397_1350 311
430 3300037312 Ga0395899_0000166 Ga0395899_0000166_33952_34923 312
431 3300044684 Ga0466966_0001386 Ga0466966_0001386_10089_11093 312
432 3300044842 Ga0466957_0047434 Ga0466957_0047434_410_1378 312
433 3300045049 Ga0466959_0228837 Ga0466959_0228837_172_1176 312
434 3300046519 Ga0495632_0000470 Ga0495632_0000470_18166_19137 312
435 3300047320 Ga0495672_0001342 Ga0495672_0001342_20419_21369 313
436 3300002067 JGI24735J21928_10000568 JGI24735J21928_1000056811 315
437 3300009093 Ga0105240_10235107 Ga0105240_102351072 315
438 3300046457 Ga0495590_0008759 Ga0495590_0008759_69_1016 315
439 3300046515 Ga0495620_0062080 Ga0495620_0062080_420_1367 315
440 3300047469 Ga0495673_0050096 Ga0495673_0050096_732_1679 315
441 3300048915 Ga0496112_0005199 Ga0496112_0005199_459_1406 315
442 3300048920 Ga0496117_0001922 Ga0496117_0001922_10786_11745 315
443 3300048921 Ga0496118_0013360 Ga0496118_0013360_3492_4451 315
444 3300048925 Ga0496122_0051051 Ga0496122_0051051_48_995 315
445 3300048929 Ga0496126_0000890 Ga0496126_0000890_40760_41719 315

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01715

IPPT

IPP transferase

67

312

0.98

PF01745

IPT

Isopentenyl transferase

33

135

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zm5-assembly1.cif.gz_A crystal structure of trna modification enzyme miaa in the complex with trna(phe) 0.9404 6 312
3crr-assembly1.cif.gz_A structure of trna dimethylallyltransferase: rna modification through a channel 0.9393 5 312
2zm5-assembly1.cif.gz_A crystal structure of trna modification enzyme miaa in the complex with trna(phe) 0.9228 6 312
2qgn-assembly1.cif.gz_A crystal structure of trna isopentenylpyrophosphate transferase (bh2366) from bacillus halodurans, northeast structural genomics consortium target bhr41. 0.9167 6 314
3crr-assembly1.cif.gz_A structure of trna dimethylallyltransferase: rna modification through a channel 0.9161 5 312
ID Description Score Start End Superfamily
3crrA02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain 0.9916 206 288 1.10.287.890
af_P16384_121_194_1.10.20.140 Mainly Alpha;Orthogonal Bundle;Histone, subunit A; 0.9913 118 184 1.10.20.140
3crrA02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain 0.9684 206 288 1.10.287.890
3crrA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9614 5 115 3.40.50.300
3d3qB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9437 6 111 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1H7PR91-F1-model_v4 tRNA dimethylallyltransferase (EC 2.5.1.75) (Dimethylallyl diphosphate:tRNA dimethylallyltransferase) (DMAPP:tRNA dimethylallyltransferase) (DMATase) (Isopentenyl-diphosphate:tRNA isopentenyltransferase) (IPP transferase) (IPPT) (IPTase) 0.9831 2 315 GO:0005524
GO:0006400
GO:0052381
AF-A0A1H7PR91-F1-model_v4 tRNA dimethylallyltransferase (EC 2.5.1.75) (Dimethylallyl diphosphate:tRNA dimethylallyltransferase) (DMAPP:tRNA dimethylallyltransferase) (DMATase) (Isopentenyl-diphosphate:tRNA isopentenyltransferase) (IPP transferase) (IPPT) (IPTase) 0.977 2 315 GO:0005524
GO:0006400
GO:0052381
AF-I5D1Q2-F1-model_v4 deleted 0.9739 1 313
AF-A0A661HA01-F1-model_v4 tRNA (Adenosine(37)-N6)-dimethylallyltransferase MiaA 0.972 197 295 GO:0005524
GO:0006400
GO:0052381
AF-A0A2S4M184-F1-model_v4 tRNA dimethylallyltransferase (EC 2.5.1.75) (Dimethylallyl diphosphate:tRNA dimethylallyltransferase) (DMAPP:tRNA dimethylallyltransferase) (DMATase) (Isopentenyl-diphosphate:tRNA isopentenyltransferase) (IPP transferase) (IPPT) (IPTase) 0.9711 1 314 GO:0005524
GO:0006400
GO:0052381

Feature Viewer

pLDDT pTM Quality
91.76 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map