F445556

General Info

Members Datasets Scaffolds Average Seq Length
445 237 890 186

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0027005|Ga0451577_0027005_603_1208
Length 201
Sequence MSKYPFVPPTNEEVAMVSLVSLWLPILLSAVIVFVASSILHMVLPIHRSDYRRLPSEDEVMGALRKFGIPPGDYLVPCAGSPKEMNTPAFLDKMTKGPVAFMTVMRSGRTSMAGPLVQWFVYCLVVTIFAGYITGRALGPGAHYLAVFRFAGCTAFIGYALALWQNTIWFKRDWTITLKSTVDGLIYGLLTAGTFGWLWPR

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
155 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
159 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
160 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
161 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
163 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
164 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
165 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
176 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
177 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
183 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
195 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
196 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
197 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
221 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
225 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
233 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
234 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.62
Rhizosphere 94.38
Stem 0
Stem Tuber 0
Unclassified 27.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0027005 3300042876 Bacteria 5197
2 JGI26141J51220_1007640 3300003503 Unclassified 692
3 Ga0070658_10039192 3300005327 Unclassified 3822
4 Ga0070658_10601266 3300005327 Unclassified 953
5 Ga0070676_10607419 3300005328 Unclassified 789
6 Ga0070683_100045795 3300005329 Bacteria 4038
7 Ga0070683_100229413 3300005329 Bacteria 1765
8 Ga0070670_101056437 3300005331 Unclassified 740
9 Ga0070666_10105031 3300005335 Bacteria 1950
10 Ga0068868_100007826 3300005338 Bacteria 7629
11 Ga0068868_100022193 3300005338 Bacteria 4789
12 Ga0068868_100069692 3300005338 Bacteria 2803
13 Ga0068868_100125713 3300005338 Unclassified 2095
14 Ga0070689_100037152 3300005340 Bacteria 3725
15 Ga0070661_100237849 3300005344 Unclassified 1401
16 Ga0070669_100380962 3300005353 Bacteria 1150
17 Ga0070675_100262678 3300005354 Unclassified 1513
18 Ga0070671_100053041 3300005355 Bacteria 3371
19 Ga0070671_100139561 3300005355 Unclassified 2045
20 Ga0070673_100102843 3300005364 Unclassified 2356
21 Ga0070659_100914152 3300005366 Unclassified 767
22 Ga0070667_100156085 3300005367 Bacteria 2007
23 Ga0070709_10214262 3300005434 Unclassified 1370
24 Ga0070709_11068523 3300005434 Unclassified 644
25 Ga0070714_100172551 3300005435 Bacteria 1963
26 Ga0070714_101119919 3300005435 Unclassified 767
27 Ga0070713_100044246 3300005436 Bacteria 3644
28 Ga0070713_100049184 3300005436 Bacteria 3477
29 Ga0070713_100754084 3300005436 Bacteria 931
30 Ga0070713_101042263 3300005436 Unclassified 790
31 Ga0070713_101591437 3300005436 Unclassified 634
32 Ga0070710_10060508 3300005437 Bacteria 2155
33 Ga0070710_10312396 3300005437 Bacteria 1029
34 Ga0070710_10665862 3300005437 Unclassified 731
35 Ga0070705_100723339 3300005440 Bacteria 784
36 Ga0070708_100005085 3300005445 Bacteria 10409
37 Ga0070708_100083874 3300005445 Bacteria 2890
38 Ga0070678_100250429 3300005456 Unclassified 1485
39 Ga0070681_10002572 3300005458 Bacteria 16633
40 Ga0068867_100217395 3300005459 Unclassified 1538
41 Ga0070706_100233893 3300005467 Archaea 1715
42 Ga0070707_100000016 3300005468 Bacteria 141729
43 Ga0070707_100000843 3300005468 Bacteria 30372
44 Ga0070707_100106918 3300005468 Unclassified 2714
45 Ga0070707_100199314 3300005468 Bacteria 1951
46 Ga0070707_100854566 3300005468 Unclassified 874
47 Ga0070707_101019659 3300005468 Bacteria 793
48 Ga0070698_100365407 3300005471 Unclassified 1375
49 Ga0070699_100182687 3300005518 Bacteria 1862
50 Ga0070679_100001599 3300005530 Bacteria 20322
51 Ga0070679_100144413 3300005530 Unclassified 2358
52 Ga0070684_100135256 3300005535 Unclassified 2226
53 Ga0070684_100392997 3300005535 Bacteria 1278
54 Ga0070684_100617944 3300005535 Bacteria 1008
55 Ga0070697_100039385 3300005536 Bacteria 3821
56 Ga0070697_100042291 3300005536 Bacteria 3687
57 Ga0070697_100313004 3300005536 Bacteria 1351
58 Ga0070697_100319818 3300005536 Bacteria 1336
59 Ga0070697_100438814 3300005536 Bacteria 1136
60 Ga0070697_100499675 3300005536 Unclassified 1063
61 Ga0070697_100878275 3300005536 Bacteria 795
62 Ga0068853_100290139 3300005539 Unclassified 1510
63 Ga0070672_100417274 3300005543 Bacteria 1152
64 Ga0070686_100564164 3300005544 Bacteria 892
65 Ga0070695_100008259 3300005545 Bacteria 6177
66 Ga0070695_100132916 3300005545 Unclassified 1717
67 Ga0070696_100000486 3300005546 Bacteria 24961
68 Ga0070696_100190418 3300005546 Bacteria 1526
69 Ga0070696_100456806 3300005546 Bacteria 1009
70 Ga0070696_100726809 3300005546 Unclassified 811
71 Ga0070693_100057868 3300005547 Bacteria 2242
72 Ga0070693_100707257 3300005547 Unclassified 738
73 Ga0070665_100090603 3300005548 Bacteria 3064
74 Ga0070665_100208076 3300005548 Unclassified 1957
75 Ga0070704_100050078 3300005549 Bacteria 2934
76 Ga0068855_100000543 3300005563 Bacteria 46206
77 Ga0068855_100000926 3300005563 Bacteria 36477
78 Ga0068855_100110839 3300005563 Bacteria 3150
79 Ga0068855_100219148 3300005563 Unclassified 2135
80 Ga0070664_100134015 3300005564 Bacteria 2177
81 Ga0070664_100183428 3300005564 Bacteria 1861
82 Ga0070664_100530360 3300005564 Unclassified 1087
83 Ga0068857_100001937 3300005577 Bacteria 16693
84 Ga0068857_100209843 3300005577 Bacteria 1777
85 Ga0068857_100606503 3300005577 Bacteria 1035
86 Ga0068854_100026383 3300005578 Unclassified 3993
87 Ga0068854_100149065 3300005578 Bacteria 1802
88 Ga0068856_100002725 3300005614 Bacteria 18085
89 Ga0068856_100008413 3300005614 Bacteria 10049
90 Ga0068856_100055104 3300005614 Bacteria 3924
91 Ga0068856_100103752 3300005614 Bacteria 2837
92 Ga0068852_100021196 3300005616 Bacteria 5182
93 Ga0068852_100186887 3300005616 Unclassified 1952
94 Ga0068852_100583155 3300005616 Bacteria 1121
95 Ga0068859_100221768 3300005617 Bacteria 1978
96 Ga0068859_101039213 3300005617 Unclassified 900
97 Ga0068864_100001736 3300005618 Bacteria 17918
98 Ga0068861_101021182 3300005719 Unclassified 790
99 Ga0068861_101518526 3300005719 Bacteria 658
100 Ga0068851_10122572 3300005834 Bacteria 1398
101 Ga0068870_10337995 3300005840 Unclassified 962
102 Ga0068863_100011258 3300005841 Bacteria 8664
103 Ga0068863_100083036 3300005841 Bacteria 3036
104 Ga0068863_100481580 3300005841 Unclassified 1220
105 Ga0068858_100017994 3300005842 Bacteria 6619
106 Ga0068858_100128034 3300005842 Bacteria 2379
107 Ga0068858_100364107 3300005842 Unclassified 1386
108 Ga0068860_100073880 3300005843 Bacteria 3241
109 Ga0068860_100618113 3300005843 Unclassified 1090
110 Ga0068862_100447416 3300005844 Bacteria 1217
111 Ga0068862_100924726 3300005844 Bacteria 859
112 Ga0081539_10000953 3300005985 Bacteria 54252
113 Ga0070715_10180547 3300006163 Bacteria 1058
114 Ga0070715_10356280 3300006163 Bacteria 801
115 Ga0070716_100349976 3300006173 Bacteria 1045
116 Ga0070712_100010954 3300006175 Bacteria 5737
117 Ga0097621_100000752 3300006237 Bacteria 22728
118 Ga0097621_100003538 3300006237 Bacteria 10782
119 Ga0097621_100045303 3300006237 Bacteria 3552
120 Ga0068871_100000148 3300006358 Bacteria 46058
121 Ga0068871_100002237 3300006358 Bacteria 13145
122 Ga0068871_100005659 3300006358 Bacteria 8767
123 Ga0068871_100030797 3300006358 Bacteria 4228
124 Ga0068871_100098320 3300006358 Bacteria 2448
125 Ga0068871_100812302 3300006358 Unclassified 863
126 Ga0075428_100023222 3300006844 Bacteria 6860
127 Ga0075428_100066235 3300006844 Bacteria 3955
128 Ga0075428_101950473 3300006844 Bacteria 609
129 Ga0075431_100071019 3300006847 Unclassified 3592
130 Ga0075433_10327641 3300006852 Bacteria 1354
131 Ga0075433_10400241 3300006852 Bacteria 1211
132 Ga0075434_100047049 3300006871 Unclassified 4281
133 Ga0075434_100552241 3300006871 Unclassified 1171
134 Ga0068865_100005520 3300006881 Bacteria 7676
135 Ga0068865_100135447 3300006881 Bacteria 1850
136 Ga0075436_100183357 3300006914 Bacteria 1480
137 Ga0097620_100221777 3300006931 Bacteria 1978
138 Ga0097620_101038855 3300006931 Unclassified 900
139 Ga0075435_100084356 3300007076 Unclassified 2614
140 Ga0075435_100979276 3300007076 Unclassified 738
141 Ga0099794_10020476 3300007265 Bacteria 2995
142 Ga0099795_10012348 3300007788 Bacteria 2587
143 Ga0099795_10103602 3300007788 Unclassified 1119
144 Ga0105240_10012442 3300009093 Bacteria 11746
145 Ga0105240_10090677 3300009093 Unclassified 3735
146 Ga0105240_10561095 3300009093 Bacteria 1262
147 Ga0105240_10673215 3300009093 Bacteria 1132
148 Ga0111539_10032434 3300009094 Bacteria 6342
149 Ga0111539_10135627 3300009094 Bacteria 2882
150 Ga0105245_10054605 3300009098 Bacteria 3587
151 Ga0105247_10064371 3300009101 Bacteria 2278
152 Ga0114129_11134532 3300009147 Bacteria 977
153 Ga0105243_10693791 3300009148 Unclassified 991
154 Ga0105241_10001985 3300009174 Bacteria 15492
155 Ga0105241_10031402 3300009174 Bacteria 3977
156 Ga0105241_10096234 3300009174 Unclassified 2345
157 Ga0105242_10144750 3300009176 Unclassified 2066
158 Ga0105242_10278467 3300009176 Bacteria 1518
159 Ga0105248_10003911 3300009177 Bacteria 16473
160 Ga0105248_10021290 3300009177 Bacteria 7186
161 Ga0105248_10150586 3300009177 Bacteria 2625
162 Ga0105248_11502587 3300009177 Unclassified 763
163 Ga0105237_10371638 3300009545 Bacteria 1434
164 Ga0105238_10000353 3300009551 Bacteria 49335
165 Ga0105238_10043822 3300009551 Bacteria 4526
166 Ga0105238_10640774 3300009551 Unclassified 1072
167 Ga0099796_10010108 3300010159 Unclassified 2582
168 Ga0105239_10178254 3300010375 Unclassified 2377
169 Ga0105239_10646219 3300010375 Bacteria 1208
170 Ga0105239_10822991 3300010375 Bacteria 1064
171 Ga0105239_10958213 3300010375 Bacteria 983
172 Ga0157373_10001041 3300013100 Bacteria 21375
173 Ga0157371_10137679 3300013102 Unclassified 1739
174 Ga0157370_10036871 3300013104 Bacteria 4743
175 Ga0157370_10051398 3300013104 Bacteria 3937
176 Ga0157370_10405754 3300013104 Bacteria 1254
177 Ga0157369_10000122 3300013105 Bacteria 110862
178 Ga0157369_10058081 3300013105 Bacteria 4173
179 Ga0157369_10070158 3300013105 Bacteria 3765
180 Ga0157369_10096592 3300013105 Bacteria 3152
181 Ga0157369_10199948 3300013105 Bacteria 2098
182 Ga0157374_10000552 3300013296 Bacteria 33425
183 Ga0157374_10000645 3300013296 Bacteria 30745
184 Ga0157374_10004347 3300013296 Bacteria 11927
185 Ga0157374_10181264 3300013296 Bacteria 2057
186 Ga0157374_10200376 3300013296 Unclassified 1954
187 Ga0157378_10000224 3300013297 Bacteria 55272
188 Ga0157378_10015282 3300013297 Bacteria 6723
189 Ga0157378_10547937 3300013297 Bacteria 1161
190 Ga0163162_10638318 3300013306 Unclassified 1189
191 Ga0157372_10000316 3300013307 Bacteria 53248
192 Ga0157372_10000638 3300013307 Bacteria 38448
193 Ga0157372_10005772 3300013307 Bacteria 13190
194 Ga0157372_10096839 3300013307 Bacteria 3364
195 Ga0157375_11386965 3300013308 Unclassified 828
196 Ga0163163_10000054 3300014325 Bacteria 126041
197 Ga0163163_10009689 3300014325 Bacteria 8619
198 Ga0163163_10207463 3300014325 Unclassified 2008
199 Ga0157379_10238695 3300014968 Bacteria 1648
200 Ga0157376_10000845 3300014969 Bacteria 20086
201 Ga0157376_10283632 3300014969 Unclassified 1561
202 Ga0157376_10458139 3300014969 Bacteria 1245
203 Ga0163161_10266231 3300017792 Bacteria 1340
204 Ga0207656_10037608 3300025321 Bacteria 2037
205 Ga0207692_10004896 3300025898 Bacteria 5334
206 Ga0207692_10108178 3300025898 Bacteria 1538
207 Ga0207692_10359902 3300025898 Unclassified 899
208 Ga0207680_10016286 3300025903 Bacteria 3899
209 Ga0207685_10361553 3300025905 Bacteria 735
210 Ga0207684_10133969 3300025910 Bacteria 2127
211 Ga0207684_10250950 3300025910 Unclassified 1526
212 Ga0207684_10676341 3300025910 Bacteria 878
213 Ga0207654_10008624 3300025911 Bacteria 5165
214 Ga0207707_10000409 3300025912 Bacteria 44985
215 Ga0207695_10052196 3300025913 Bacteria 4285
216 Ga0207695_10083899 3300025913 Bacteria 3218
217 Ga0207671_10125295 3300025914 Bacteria 1967
218 Ga0207693_10011277 3300025915 Bacteria 7236
219 Ga0207693_10198848 3300025915 Bacteria 1576
220 Ga0207693_10338816 3300025915 Bacteria 1177
221 Ga0207660_10058455 3300025917 Bacteria 2765
222 Ga0207649_10574524 3300025920 Unclassified 865
223 Ga0207652_10006388 3300025921 Bacteria 9515
224 Ga0207652_10543520 3300025921 Unclassified 1044
225 Ga0207646_10000030 3300025922 Bacteria 219473
226 Ga0207646_10000057 3300025922 Bacteria 158121
227 Ga0207646_10068322 3300025922 Unclassified 3173
228 Ga0207694_10004573 3300025924 Bacteria 10781
229 Ga0207694_10068705 3300025924 Bacteria 2767
230 Ga0207694_10100583 3300025924 Bacteria 2290
231 Ga0207650_10761391 3300025925 Unclassified 820
232 Ga0207659_10259199 3300025926 Unclassified 1414
233 Ga0207700_10055166 3300025928 Bacteria 2986
234 Ga0207700_10922504 3300025928 Unclassified 782
235 Ga0207700_10963748 3300025928 Unclassified 763
236 Ga0207664_10400902 3300025929 Bacteria 1220
237 Ga0207664_10971758 3300025929 Unclassified 761
238 Ga0207706_10834118 3300025933 Bacteria 782
239 Ga0207686_10096580 3300025934 Unclassified 1964
240 Ga0207686_10705381 3300025934 Unclassified 802
241 Ga0207670_10080037 3300025936 Bacteria 2283
242 Ga0207704_10013203 3300025938 Unclassified 4127
243 Ga0207704_10110176 3300025938 Bacteria 1859
244 Ga0207665_10967050 3300025939 Bacteria 677
245 Ga0207691_10432132 3300025940 Bacteria 1121
246 Ga0207691_10664639 3300025940 Bacteria 880
247 Ga0207711_10011830 3300025941 Bacteria 7251
248 Ga0207711_10111891 3300025941 Bacteria 2429
249 Ga0207711_10269750 3300025941 Bacteria 1566
250 Ga0207711_10929743 3300025941 Bacteria 808
251 Ga0207689_10428987 3300025942 Bacteria 1104
252 Ga0207661_10052521 3300025944 Bacteria 3257
253 Ga0207661_10191002 3300025944 Bacteria 1795
254 Ga0207661_10474689 3300025944 Bacteria 1141
255 Ga0207679_10062068 3300025945 Bacteria 2784
256 Ga0207679_10150940 3300025945 Bacteria 1891
257 Ga0207679_10310895 3300025945 Unclassified 1361
258 Ga0207667_10000182 3300025949 Bacteria 91423
259 Ga0207667_10004452 3300025949 Bacteria 17153
260 Ga0207667_10412522 3300025949 Bacteria 1374
261 Ga0207667_10496285 3300025949 Bacteria 1238
262 Ga0207667_10678230 3300025949 Unclassified 1034
263 Ga0207651_10122655 3300025960 Unclassified 1974
264 Ga0207651_10140640 3300025960 Unclassified 1864
265 Ga0207651_10862160 3300025960 Unclassified 805
266 Ga0207640_10032628 3300025981 Unclassified 3230
267 Ga0207658_10047318 3300025986 Bacteria 3147
268 Ga0207677_10044673 3300026023 Bacteria 2953
269 Ga0207677_10135610 3300026023 Unclassified 1876
270 Ga0207703_10037416 3300026035 Unclassified 3866
271 Ga0207703_10296759 3300026035 Bacteria 1473
272 Ga0207703_10397966 3300026035 Bacteria 1277
273 Ga0207639_10025033 3300026041 Bacteria 4325
274 Ga0207708_10115816 3300026075 Bacteria 2085
275 Ga0207702_10000169 3300026078 Bacteria 78281
276 Ga0207702_10000849 3300026078 Bacteria 31962
277 Ga0207702_11623529 3300026078 Unclassified 640
278 Ga0207641_10048082 3300026088 Bacteria 3599
279 Ga0207641_10055994 3300026088 Unclassified 3350
280 Ga0207641_10317902 3300026088 Bacteria 1475
281 Ga0207641_10620068 3300026088 Unclassified 1060
282 Ga0207648_10245334 3300026089 Unclassified 1596
283 Ga0207676_10002658 3300026095 Bacteria 12694
284 Ga0207676_10115250 3300026095 Bacteria 2256
285 Ga0207676_10263055 3300026095 Archaea 1558
286 Ga0207674_10006585 3300026116 Bacteria 13653
287 Ga0207674_10019461 3300026116 Bacteria 7351
288 Ga0207675_101196952 3300026118 Bacteria 780
289 Ga0207683_10160889 3300026121 Bacteria 2029
290 Ga0207698_10024519 3300026142 Bacteria 4236
291 Ga0207698_10353457 3300026142 Bacteria 1389
292 Ga0207698_10753207 3300026142 Bacteria 973
293 Ga0209968_1007962 3300027526 Bacteria 1610
294 Ga0209968_1028429 3300027526 Unclassified 928
295 Ga0209999_1003646 3300027543 Bacteria 2756
296 Ga0209982_1031371 3300027552 Unclassified 836
297 Ga0209970_1011734 3300027614 Bacteria 1444
298 Ga0210002_1018842 3300027617 Bacteria 1105
299 Ga0209983_1000542 3300027665 Bacteria 8153
300 Ga0209971_1000706 3300027682 Bacteria 8591
301 Ga0209974_10003113 3300027876 Bacteria 6006
302 Ga0207428_10027614 3300027907 Bacteria 4724
303 Ga0268266_10352759 3300028379 Unclassified 1383
304 Ga0268265_10658906 3300028380 Bacteria 1007
305 Ga0268265_11459259 3300028380 Bacteria 687
306 Ga0265322_10000036 3300028654 Bacteria 79374
307 Ga0265770_1014170 3300030878 Bacteria 1200
308 Ga0265316_10016481 3300031344 Bacteria 6407
309 Ga0265314_10006083 3300031711 Bacteria 10723
310 Ga0316576_10233039 3300031727 Bacteria 1384
311 Ga0373934_0000251 3300035086 Bacteria 19178
312 Ga0373934_0011738 3300035086 Bacteria 3299
313 Ga0373932_0127024 3300035112 Bacteria 856
314 Ga0373936_0030487 3300035113 Bacteria 2127
315 Ga0373954_0008236 3300035118 Bacteria 4571
316 Ga0373956_0002983 3300035119 Bacteria 6853
317 Ga0373956_0093977 3300035119 Unclassified 1385
318 Ga0373957_0049411 3300035120 Bacteria 1605
319 Ga0373960_0178466 3300035121 Unclassified 740
320 Ga0373943_0291135 3300035170 Unclassified 925
321 Ga0373955_0003949 3300035172 Bacteria 6543
322 Ga0373924_0034266 3300035410 Bacteria 2054
323 Ga0373931_0003650 3300035691 Bacteria 6955
324 Ga0373931_0032799 3300035691 Bacteria 2689
325 Ga0373927_0020158 3300035695 Bacteria 4372
326 Ga0373933_0000131 3300035724 Bacteria 47471
327 Ga0373933_0010265 3300035724 Bacteria 5131
328 Ga0373937_0000056 3300036401 Bacteria 100023
329 Ga0373937_0000357 3300036401 Bacteria 42470
330 Ga0373937_0043657 3300036401 Unclassified 4093
331 Ga0373937_0151273 3300036401 Unclassified 2174
332 Ga0373937_0364610 3300036401 Bacteria 1369
333 Ga0373925_0181452 3300037068 Bacteria 1666
334 Ga0395905_0208202 3300037471 Unclassified 1833
335 Ga0439446_0042203 3300042156 Bacteria 1345
336 Ga0439434_0008950 3300042435 Bacteria 2943
337 Ga0451577_0001841 3300042876 Bacteria 27027
338 Ga0451577_0013665 3300042876 Bacteria 7591
339 Ga0451577_0123538 3300042876 Bacteria 2319
340 Ga0451577_0437488 3300042876 Unclassified 1187
341 Ga0451577_0553441 3300042876 Bacteria 1044
342 Ga0451577_0831723 3300042876 Bacteria 833
343 Ga0451577_1159233 3300042876 Unclassified 690
344 Ga0453683_0001153 3300044673 Bacteria 23986
345 Ga0453683_0001305 3300044673 Bacteria 21982
346 Ga0453683_0117646 3300044673 Bacteria 1672
347 Ga0453683_0251637 3300044673 Bacteria 1126
348 Ga0453683_0260288 3300044673 Unclassified 1107
349 Ga0453683_0347800 3300044673 Bacteria 952
350 Ga0453683_0697241 3300044673 Unclassified 665
351 Ga0453684_0004974 3300044712 Bacteria 27048
352 Ga0453684_0049683 3300044712 Bacteria 5527
353 Ga0453684_0101174 3300044712 Bacteria 3526
354 Ga0453684_0251497 3300044712 Bacteria 2029
355 Ga0453684_0508155 3300044712 Bacteria 1333
356 Ga0453684_0524152 3300044712 Bacteria 1309
357 Ga0453684_0601642 3300044712 Unclassified 1205
358 Ga0453684_1332357 3300044712 Unclassified 747
359 Ga0451576_0009208 3300045051 Bacteria 11475
360 Ga0451576_0011619 3300045051 Bacteria 9976
361 Ga0451576_0179553 3300045051 Bacteria 2210
362 Ga0466967_0076743 3300045976 Bacteria 3006
363 Ga0495629_0019196 3300046459 Bacteria 4887
364 Ga0495651_0000098 3300046462 Bacteria 63881
365 Ga0495651_0130060 3300046462 Bacteria 1839
366 Ga0495653_0000168 3300046463 Bacteria 54127
367 Ga0495580_0005550 3300046472 Bacteria 10403
368 Ga0495628_0025851 3300046516 Bacteria 4794
369 Ga0495630_0000544 3300046517 Bacteria 27577
370 Ga0495652_0000694 3300046529 Bacteria 39080
371 Ga0495665_0059235 3300046531 Bacteria 2021
372 Ga0495640_0479492 3300046533 Unclassified 758
373 Ga0495587_0000808 3300046536 Bacteria 20871
374 Ga0495645_0000106 3300046543 Bacteria 57528
375 Ga0495667_0000570 3300046559 Bacteria 23526
376 Ga0495635_0000223 3300046663 Bacteria 35975
377 Ga0495657_0049072 3300046675 Bacteria 2845
378 Ga0495599_0000150 3300046678 Bacteria 45637
379 Ga0495599_0478140 3300046678 Unclassified 735
380 Ga0495623_0000509 3300046679 Bacteria 25753
381 Ga0495669_0008151 3300046684 Bacteria 4396
382 Ga0495669_0313101 3300046684 Bacteria 757
383 Ga0495600_0000944 3300046809 Bacteria 15646
384 Ga0495581_0526915 3300047315 Unclassified 686
385 Ga0495604_0002016 3300047317 Bacteria 16374
386 Ga0495674_0316114 3300047319 Bacteria 1273
387 Ga0495684_0000216 3300047471 Bacteria 44631
388 Ga0495602_0005893 3300048088 Bacteria 12874
389 Ga0496101_0157396 3300048904 Unclassified 1741
390 Ga0496102_0719642 3300048905 Bacteria 921
391 Ga0496104_0062206 3300048907 Bacteria 3539
392 Ga0496104_0256900 3300048907 Bacteria 1660
393 Ga0496104_0412925 3300048907 Unclassified 1262
394 Ga0496104_0778037 3300048907 Unclassified 864
395 Ga0496105_0213461 3300048908 Bacteria 1572
396 Ga0496105_0391242 3300048908 Unclassified 1105
397 Ga0496108_0279991 3300048911 Unclassified 1452
398 Ga0496108_0382805 3300048911 Bacteria 1228
399 Ga0496109_0360119 3300048912 Archaea 1374
400 Ga0496109_1161748 3300048912 Unclassified 709
401 Ga0496110_0008912 3300048913 Bacteria 8087
402 Ga0496110_0040286 3300048913 Bacteria 4071
403 Ga0496111_0115750 3300048914 Bacteria 1977
404 Ga0496111_0708205 3300048914 Unclassified 732
405 Ga0496112_0005590 3300048915 Bacteria 10900
406 Ga0496112_0045798 3300048915 Unclassified 4288
407 Ga0496112_0094736 3300048915 Bacteria 2956
408 Ga0496112_0131649 3300048915 Bacteria 2472
409 Ga0496113_0056388 3300048916 Unclassified 2950
410 Ga0496113_0904563 3300048916 Bacteria 698
411 Ga0496115_0206732 3300048918 Archaea 1622
412 Ga0496115_0297752 3300048918 Unclassified 1322
413 Ga0496115_0743889 3300048918 Bacteria 767
414 Ga0501048_0922143 3300049582 Unclassified 628
415 Ga0501068_0090587 3300049584 Bacteria 1886
416 Ga0501072_0086226 3300049588 Bacteria 2492
417 Ga0501072_1260562 3300049588 Unclassified 573
418 Ga0501073_0021929 3300049589 Bacteria 4601
419 Ga0501074_0004155 3300049590 Bacteria 10336
420 Ga0501074_0577985 3300049590 Unclassified 795
421 Ga0501076_0035820 3300049592 Bacteria 3884
422 Ga0501076_0100571 3300049592 Bacteria 2330
423 Ga0501076_0204461 3300049592 Unclassified 1613
424 Ga0501077_0000841 3300049593 Bacteria 18587
425 Ga0501079_0002708 3300049741 Bacteria 12906
426 Ga0501079_0306271 3300049741 Bacteria 1243
427 Ga0501080_0001115 3300049742 Bacteria 22121
428 Ga0501081_0060723 3300049743 Bacteria 2620
429 Ga0501081_0614175 3300049743 Unclassified 814
430 Ga0501083_0017903 3300049744 Bacteria 4942
431 nmdc:mga05p37_631298_c1 3300050507 Bacteria 1203
432 nmdc:mga08y16_118879_c1 3300050511 Bacteria 2751
433 nmdc:mga08y16_13655_c1 3300050511 Bacteria 8551
434 nmdc:mga0n895_1340862_c1 3300050512 Unclassified 685
435 nmdc:mga0n895_361955_c1 3300050512 Bacteria 1469
436 nmdc:mga0n895_422240_c1 3300050512 Bacteria 1348
437 nmdc:mga0rr50_271679_c1 3300050513 Bacteria 1413
438 nmdc:mga08x19_151143_c1 3300050514 Bacteria 1173
439 nmdc:mga0a205_93921_c1 3300050515 Bacteria 2898
440 Ga0495601_0005320 3300053077 Bacteria 7492
441 Ga0495612_0000864 3300053078 Bacteria 12341
442 Ga0495619_0024379 3300053085 Bacteria 3881
443 Ga0501084_1103626 3300054114 Bacteria 666
444 Ga0501082_1112688 3300060353 Bacteria 690
445 Ga0530510_0923312 3300061734 Bacteria 667
446 Ga0451577_0027005
447 JGI26141J51220_1007640
448 Ga0070658_10039192
449 Ga0070658_10601266
450 Ga0070676_10607419
451 Ga0070683_100045795
452 Ga0070683_100229413
453 Ga0070670_101056437
454 Ga0070666_10105031
455 Ga0068868_100007826
456 Ga0068868_100022193
457 Ga0068868_100069692
458 Ga0068868_100125713
459 Ga0070689_100037152
460 Ga0070661_100237849
461 Ga0070669_100380962
462 Ga0070675_100262678
463 Ga0070671_100053041
464 Ga0070671_100139561
465 Ga0070673_100102843
466 Ga0070659_100914152
467 Ga0070667_100156085
468 Ga0070709_10214262
469 Ga0070709_11068523
470 Ga0070714_100172551
471 Ga0070714_101119919
472 Ga0070713_100044246
473 Ga0070713_100049184
474 Ga0070713_100754084
475 Ga0070713_101042263
476 Ga0070713_101591437
477 Ga0070710_10060508
478 Ga0070710_10312396
479 Ga0070710_10665862
480 Ga0070705_100723339
481 Ga0070708_100005085
482 Ga0070708_100083874
483 Ga0070678_100250429
484 Ga0070681_10002572
485 Ga0068867_100217395
486 Ga0070706_100233893
487 Ga0070707_100000016
488 Ga0070707_100000843
489 Ga0070707_100106918
490 Ga0070707_100199314
491 Ga0070707_100854566
492 Ga0070707_101019659
493 Ga0070698_100365407
494 Ga0070699_100182687
495 Ga0070679_100001599
496 Ga0070679_100144413
497 Ga0070684_100135256
498 Ga0070684_100392997
499 Ga0070684_100617944
500 Ga0070697_100039385
501 Ga0070697_100042291
502 Ga0070697_100313004
503 Ga0070697_100319818
504 Ga0070697_100438814
505 Ga0070697_100499675
506 Ga0070697_100878275
507 Ga0068853_100290139
508 Ga0070672_100417274
509 Ga0070686_100564164
510 Ga0070695_100008259
511 Ga0070695_100132916
512 Ga0070696_100000486
513 Ga0070696_100190418
514 Ga0070696_100456806
515 Ga0070696_100726809
516 Ga0070693_100057868
517 Ga0070693_100707257
518 Ga0070665_100090603
519 Ga0070665_100208076
520 Ga0070704_100050078
521 Ga0068855_100000543
522 Ga0068855_100000926
523 Ga0068855_100110839
524 Ga0068855_100219148
525 Ga0070664_100134015
526 Ga0070664_100183428
527 Ga0070664_100530360
528 Ga0068857_100001937
529 Ga0068857_100209843
530 Ga0068857_100606503
531 Ga0068854_100026383
532 Ga0068854_100149065
533 Ga0068856_100002725
534 Ga0068856_100008413
535 Ga0068856_100055104
536 Ga0068856_100103752
537 Ga0068852_100021196
538 Ga0068852_100186887
539 Ga0068852_100583155
540 Ga0068859_100221768
541 Ga0068859_101039213
542 Ga0068864_100001736
543 Ga0068861_101021182
544 Ga0068861_101518526
545 Ga0068851_10122572
546 Ga0068870_10337995
547 Ga0068863_100011258
548 Ga0068863_100083036
549 Ga0068863_100481580
550 Ga0068858_100017994
551 Ga0068858_100128034
552 Ga0068858_100364107
553 Ga0068860_100073880
554 Ga0068860_100618113
555 Ga0068862_100447416
556 Ga0068862_100924726
557 Ga0081539_10000953
558 Ga0070715_10180547
559 Ga0070715_10356280
560 Ga0070716_100349976
561 Ga0070712_100010954
562 Ga0097621_100000752
563 Ga0097621_100003538
564 Ga0097621_100045303
565 Ga0068871_100000148
566 Ga0068871_100002237
567 Ga0068871_100005659
568 Ga0068871_100030797
569 Ga0068871_100098320
570 Ga0068871_100812302
571 Ga0075428_100023222
572 Ga0075428_100066235
573 Ga0075428_101950473
574 Ga0075431_100071019
575 Ga0075433_10327641
576 Ga0075433_10400241
577 Ga0075434_100047049
578 Ga0075434_100552241
579 Ga0068865_100005520
580 Ga0068865_100135447
581 Ga0075436_100183357
582 Ga0097620_100221777
583 Ga0097620_101038855
584 Ga0075435_100084356
585 Ga0075435_100979276
586 Ga0099794_10020476
587 Ga0099795_10012348
588 Ga0099795_10103602
589 Ga0105240_10012442
590 Ga0105240_10090677
591 Ga0105240_10561095
592 Ga0105240_10673215
593 Ga0111539_10032434
594 Ga0111539_10135627
595 Ga0105245_10054605
596 Ga0105247_10064371
597 Ga0114129_11134532
598 Ga0105243_10693791
599 Ga0105241_10001985
600 Ga0105241_10031402
601 Ga0105241_10096234
602 Ga0105242_10144750
603 Ga0105242_10278467
604 Ga0105248_10003911
605 Ga0105248_10021290
606 Ga0105248_10150586
607 Ga0105248_11502587
608 Ga0105237_10371638
609 Ga0105238_10000353
610 Ga0105238_10043822
611 Ga0105238_10640774
612 Ga0099796_10010108
613 Ga0105239_10178254
614 Ga0105239_10646219
615 Ga0105239_10822991
616 Ga0105239_10958213
617 Ga0157373_10001041
618 Ga0157371_10137679
619 Ga0157370_10036871
620 Ga0157370_10051398
621 Ga0157370_10405754
622 Ga0157369_10000122
623 Ga0157369_10058081
624 Ga0157369_10070158
625 Ga0157369_10096592
626 Ga0157369_10199948
627 Ga0157374_10000552
628 Ga0157374_10000645
629 Ga0157374_10004347
630 Ga0157374_10181264
631 Ga0157374_10200376
632 Ga0157378_10000224
633 Ga0157378_10015282
634 Ga0157378_10547937
635 Ga0163162_10638318
636 Ga0157372_10000316
637 Ga0157372_10000638
638 Ga0157372_10005772
639 Ga0157372_10096839
640 Ga0157375_11386965
641 Ga0163163_10000054
642 Ga0163163_10009689
643 Ga0163163_10207463
644 Ga0157379_10238695
645 Ga0157376_10000845
646 Ga0157376_10283632
647 Ga0157376_10458139
648 Ga0163161_10266231
649 Ga0207656_10037608
650 Ga0207692_10004896
651 Ga0207692_10108178
652 Ga0207692_10359902
653 Ga0207680_10016286
654 Ga0207685_10361553
655 Ga0207684_10133969
656 Ga0207684_10250950
657 Ga0207684_10676341
658 Ga0207654_10008624
659 Ga0207707_10000409
660 Ga0207695_10052196
661 Ga0207695_10083899
662 Ga0207671_10125295
663 Ga0207693_10011277
664 Ga0207693_10198848
665 Ga0207693_10338816
666 Ga0207660_10058455
667 Ga0207649_10574524
668 Ga0207652_10006388
669 Ga0207652_10543520
670 Ga0207646_10000030
671 Ga0207646_10000057
672 Ga0207646_10068322
673 Ga0207694_10004573
674 Ga0207694_10068705
675 Ga0207694_10100583
676 Ga0207650_10761391
677 Ga0207659_10259199
678 Ga0207700_10055166
679 Ga0207700_10922504
680 Ga0207700_10963748
681 Ga0207664_10400902
682 Ga0207664_10971758
683 Ga0207706_10834118
684 Ga0207686_10096580
685 Ga0207686_10705381
686 Ga0207670_10080037
687 Ga0207704_10013203
688 Ga0207704_10110176
689 Ga0207665_10967050
690 Ga0207691_10432132
691 Ga0207691_10664639
692 Ga0207711_10011830
693 Ga0207711_10111891
694 Ga0207711_10269750
695 Ga0207711_10929743
696 Ga0207689_10428987
697 Ga0207661_10052521
698 Ga0207661_10191002
699 Ga0207661_10474689
700 Ga0207679_10062068
701 Ga0207679_10150940
702 Ga0207679_10310895
703 Ga0207667_10000182
704 Ga0207667_10004452
705 Ga0207667_10412522
706 Ga0207667_10496285
707 Ga0207667_10678230
708 Ga0207651_10122655
709 Ga0207651_10140640
710 Ga0207651_10862160
711 Ga0207640_10032628
712 Ga0207658_10047318
713 Ga0207677_10044673
714 Ga0207677_10135610
715 Ga0207703_10037416
716 Ga0207703_10296759
717 Ga0207703_10397966
718 Ga0207639_10025033
719 Ga0207708_10115816
720 Ga0207702_10000169
721 Ga0207702_10000849
722 Ga0207702_11623529
723 Ga0207641_10048082
724 Ga0207641_10055994
725 Ga0207641_10317902
726 Ga0207641_10620068
727 Ga0207648_10245334
728 Ga0207676_10002658
729 Ga0207676_10115250
730 Ga0207676_10263055
731 Ga0207674_10006585
732 Ga0207674_10019461
733 Ga0207675_101196952
734 Ga0207683_10160889
735 Ga0207698_10024519
736 Ga0207698_10353457
737 Ga0207698_10753207
738 Ga0209968_1007962
739 Ga0209968_1028429
740 Ga0209999_1003646
741 Ga0209982_1031371
742 Ga0209970_1011734
743 Ga0210002_1018842
744 Ga0209983_1000542
745 Ga0209971_1000706
746 Ga0209974_10003113
747 Ga0207428_10027614
748 Ga0268266_10352759
749 Ga0268265_10658906
750 Ga0268265_11459259
751 Ga0265322_10000036
752 Ga0265770_1014170
753 Ga0265316_10016481
754 Ga0265314_10006083
755 Ga0316576_10233039
756 Ga0373934_0000251
757 Ga0373934_0011738
758 Ga0373932_0127024
759 Ga0373936_0030487
760 Ga0373954_0008236
761 Ga0373956_0002983
762 Ga0373956_0093977
763 Ga0373957_0049411
764 Ga0373960_0178466
765 Ga0373943_0291135
766 Ga0373955_0003949
767 Ga0373924_0034266
768 Ga0373931_0003650
769 Ga0373931_0032799
770 Ga0373927_0020158
771 Ga0373933_0000131
772 Ga0373933_0010265
773 Ga0373937_0000056
774 Ga0373937_0000357
775 Ga0373937_0043657
776 Ga0373937_0151273
777 Ga0373937_0364610
778 Ga0373925_0181452
779 Ga0395905_0208202
780 Ga0439446_0042203
781 Ga0439434_0008950
782 Ga0451577_0001841
783 Ga0451577_0013665
784 Ga0451577_0123538
785 Ga0451577_0437488
786 Ga0451577_0553441
787 Ga0451577_0831723
788 Ga0451577_1159233
789 Ga0453683_0001153
790 Ga0453683_0001305
791 Ga0453683_0117646
792 Ga0453683_0251637
793 Ga0453683_0260288
794 Ga0453683_0347800
795 Ga0453683_0697241
796 Ga0453684_0004974
797 Ga0453684_0049683
798 Ga0453684_0101174
799 Ga0453684_0251497
800 Ga0453684_0508155
801 Ga0453684_0524152
802 Ga0453684_0601642
803 Ga0453684_1332357
804 Ga0451576_0009208
805 Ga0451576_0011619
806 Ga0451576_0179553
807 Ga0466967_0076743
808 Ga0495629_0019196
809 Ga0495651_0000098
810 Ga0495651_0130060
811 Ga0495653_0000168
812 Ga0495580_0005550
813 Ga0495628_0025851
814 Ga0495630_0000544
815 Ga0495652_0000694
816 Ga0495665_0059235
817 Ga0495640_0479492
818 Ga0495587_0000808
819 Ga0495645_0000106
820 Ga0495667_0000570
821 Ga0495635_0000223
822 Ga0495657_0049072
823 Ga0495599_0000150
824 Ga0495599_0478140
825 Ga0495623_0000509
826 Ga0495669_0008151
827 Ga0495669_0313101
828 Ga0495600_0000944
829 Ga0495581_0526915
830 Ga0495604_0002016
831 Ga0495674_0316114
832 Ga0495684_0000216
833 Ga0495602_0005893
834 Ga0496101_0157396
835 Ga0496102_0719642
836 Ga0496104_0062206
837 Ga0496104_0256900
838 Ga0496104_0412925
839 Ga0496104_0778037
840 Ga0496105_0213461
841 Ga0496105_0391242
842 Ga0496108_0279991
843 Ga0496108_0382805
844 Ga0496109_0360119
845 Ga0496109_1161748
846 Ga0496110_0008912
847 Ga0496110_0040286
848 Ga0496111_0115750
849 Ga0496111_0708205
850 Ga0496112_0005590
851 Ga0496112_0045798
852 Ga0496112_0094736
853 Ga0496112_0131649
854 Ga0496113_0056388
855 Ga0496113_0904563
856 Ga0496115_0206732
857 Ga0496115_0297752
858 Ga0496115_0743889
859 Ga0501048_0922143
860 Ga0501068_0090587
861 Ga0501072_0086226
862 Ga0501072_1260562
863 Ga0501073_0021929
864 Ga0501074_0004155
865 Ga0501074_0577985
866 Ga0501076_0035820
867 Ga0501076_0100571
868 Ga0501076_0204461
869 Ga0501077_0000841
870 Ga0501079_0002708
871 Ga0501079_0306271
872 Ga0501080_0001115
873 Ga0501081_0060723
874 Ga0501081_0614175
875 Ga0501083_0017903
876 nmdc:mga05p37_631298_c1
877 nmdc:mga08y16_118879_c1
878 nmdc:mga08y16_13655_c1
879 nmdc:mga0n895_1340862_c1
880 nmdc:mga0n895_361955_c1
881 nmdc:mga0n895_422240_c1
882 nmdc:mga0rr50_271679_c1
883 nmdc:mga08x19_151143_c1
884 nmdc:mga0a205_93921_c1
885 Ga0495601_0005320
886 Ga0495612_0000864
887 Ga0495619_0024379
888 Ga0501084_1103626
889 Ga0501082_1112688
890 Ga0530510_0923312

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z5s-assembly1.cif.gz_W rc-lh1(14)-w complex from rhodopseudomonas palustris 0.6366 104 180
4hzu-assembly1.cif.gz_S structure of a bacterial energy-coupling factor transporter 0.6007 101 181
5edl-assembly1.cif.gz_A crystal structure of an s-component of ecf transporter 0.546 97 180
6z5s-assembly1.cif.gz_W rc-lh1(14)-w complex from rhodopseudomonas palustris 0.5456 104 180
6qc4-assembly1.cif.gz_AK ovine respiratory supercomplex i+iii2 open class 3 0.4405 97 172
ID Description Score Start End Superfamily
4hzuS00 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6007 101 181 1.10.1760.20
af_Q2FUT1_1_180_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.5383 102 179 1.10.1760.20
5kc4E00 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4354 95 181 1.10.1760.20
af_G5EEW0_732_899_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.4218 98 181 1.20.1640.10
af_Q95YD0_772_940_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.4204 96 183 1.20.1640.10
ID Description Score Start End GO Terms
AF-A0A2V6AUG6-F1-model_v4 DUF1761 domain-containing protein 0.9886 99 184 GO:0016020
AF-A0A521JUW4-F1-model_v4 DUF1761 domain-containing protein 0.988 2 184 GO:0016020
AF-A0A849MDE0-F1-model_v4 DUF1761 domain-containing protein 0.985 1 184 GO:0016020
AF-A0A800E5B1-F1-model_v4 deleted 0.984 1 184
AF-A0A7V9TFT3-F1-model_v4 DUF1761 domain-containing protein 0.9839 1 183 GO:0016020

Map