F445540

General Info

Members Datasets Scaffolds Average Seq Length
445 219 890 136

Family's Representative Sequence

Representative Sequence 3300035691|Ga0373931_0316207|Ga0373931_0316207_388_939
Length 152
Sequence MANPHTPGPEIANEAVHHEESDVNIRAIFGFGLGLFVVAVFVHLAVFLLFRYFSNGQEAANRVRQYPLAAGQENRLPPEPRLQTNPRQDLLDLRAQEDQLLNGYSWVDRNAGVVRIPIDDAMKLVVQRGLPARGPGQLPQPQRTAQPQGRRR

Samples

Sample ID Description Type Environment
1 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
138 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
139 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
140 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
141 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
142 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
143 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
144 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
145 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
146 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
147 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
148 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
149 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
150 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
153 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
154 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
157 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
158 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
163 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
164 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
206 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.84
Rhizosphere 94.16
Stem 0
Stem Tuber 0
Unclassified 22.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373931_0316207 3300035691 Bacteria 968
2 Ga0065712_10070052 3300005290 Bacteria 6375
3 Ga0065715_10135768 3300005293 Unclassified 1913
4 Ga0065715_10203574 3300005293 Bacteria 1349
5 Ga0065715_10310134 3300005293 Bacteria 1022
6 Ga0065707_10639567 3300005295 Unclassified 669
7 Ga0070683_101328271 3300005329 Unclassified 691
8 Ga0070690_100002248 3300005330 Bacteria 10354
9 Ga0070670_101108566 3300005331 Unclassified 722
10 Ga0070670_101273985 3300005331 Bacteria 673
11 Ga0070666_10009755 3300005335 Bacteria 6001
12 Ga0070666_10127763 3300005335 Bacteria 1765
13 Ga0070666_10187368 3300005335 Bacteria 1453
14 Ga0070666_10379607 3300005335 Unclassified 1014
15 Ga0070680_101707810 3300005336 Bacteria 546
16 Ga0070660_100041376 3300005339 Bacteria 3512
17 Ga0070660_101108581 3300005339 Unclassified 670
18 Ga0070689_100035057 3300005340 Bacteria 3832
19 Ga0070689_100885206 3300005340 Unclassified 789
20 Ga0070691_10265181 3300005341 Unclassified 926
21 Ga0070687_100077715 3300005343 Bacteria 1802
22 Ga0070687_101091725 3300005343 Bacteria 583
23 Ga0070669_100183761 3300005353 Bacteria 1637
24 Ga0070669_100899329 3300005353 Bacteria 756
25 Ga0070675_101402912 3300005354 Bacteria 644
26 Ga0070671_100299581 3300005355 Bacteria 1369
27 Ga0070671_101209941 3300005355 Archaea 665
28 Ga0070674_100157069 3300005356 Bacteria 1722
29 Ga0070673_100026625 3300005364 Bacteria 4274
30 Ga0070673_100428541 3300005364 Unclassified 1187
31 Ga0070673_100822933 3300005364 Bacteria 858
32 Ga0070688_100029166 3300005365 Bacteria 3302
33 Ga0070659_100027824 3300005366 Bacteria 4358
34 Ga0070659_101932496 3300005366 Bacteria 529
35 Ga0070667_100461093 3300005367 Bacteria 1162
36 Ga0070714_100138235 3300005435 Bacteria 2184
37 Ga0070713_101998656 3300005436 Unclassified 562
38 Ga0070705_100171993 3300005440 Bacteria 1459
39 Ga0070694_100438980 3300005444 Unclassified 1029
40 Ga0070694_101506680 3300005444 Unclassified 569
41 Ga0070708_100016561 3300005445 Bacteria 6121
42 Ga0070708_101016524 3300005445 Bacteria 777
43 Ga0070678_101685732 3300005456 Unclassified 596
44 Ga0070662_100894639 3300005457 Bacteria 757
45 Ga0070662_100940691 3300005457 Bacteria 738
46 Ga0070681_10277437 3300005458 Bacteria 1587
47 Ga0068867_100498243 3300005459 Bacteria 1046
48 Ga0068867_101890394 3300005459 Unclassified 563
49 Ga0070685_10155268 3300005466 Bacteria 1454
50 Ga0070685_10476461 3300005466 Unclassified 879
51 Ga0070706_101146018 3300005467 Unclassified 715
52 Ga0070707_100394040 3300005468 Bacteria 1345
53 Ga0070707_100396678 3300005468 Bacteria 1340
54 Ga0070707_100441461 3300005468 Bacteria 1262
55 Ga0070707_102229038 3300005468 Bacteria 515
56 Ga0070698_100466318 3300005471 Bacteria 1199
57 Ga0070698_100855911 3300005471 Unclassified 854
58 Ga0070699_100007883 3300005518 Bacteria 9254
59 Ga0070699_100140281 3300005518 Bacteria 2134
60 Ga0070699_100198872 3300005518 Bacteria 1782
61 Ga0070699_100313048 3300005518 Bacteria 1410
62 Ga0070679_100111740 3300005530 Bacteria 2719
63 Ga0070697_100015093 3300005536 Bacteria 6064
64 Ga0070697_100227977 3300005536 Bacteria 1588
65 Ga0070697_100612002 3300005536 Bacteria 958
66 Ga0070697_101231671 3300005536 Bacteria 667
67 Ga0070697_101376756 3300005536 Bacteria 630
68 Ga0070697_101773383 3300005536 Bacteria 552
69 Ga0070672_100432455 3300005543 Unclassified 1132
70 Ga0070672_100489170 3300005543 Unclassified 1063
71 Ga0070686_100001661 3300005544 Bacteria 12427
72 Ga0070686_100184493 3300005544 Bacteria 1485
73 Ga0070686_101445123 3300005544 Bacteria 578
74 Ga0070695_100602364 3300005545 Unclassified 863
75 Ga0070695_101263652 3300005545 Bacteria 609
76 Ga0070696_100623187 3300005546 Unclassified 872
77 Ga0070696_100905561 3300005546 Bacteria 732
78 Ga0070693_100273399 3300005547 Bacteria 1129
79 Ga0070665_100008057 3300005548 Bacteria 10668
80 Ga0070704_100592960 3300005549 Unclassified 973
81 Ga0068855_100109271 3300005563 Bacteria 3176
82 Ga0070664_100753851 3300005564 Unclassified 909
83 Ga0068854_100017870 3300005578 Bacteria 4754
84 Ga0068854_100082396 3300005578 Unclassified 2378
85 Ga0068854_100158175 3300005578 Bacteria 1753
86 Ga0068854_100606491 3300005578 Bacteria 935
87 Ga0068859_100178789 3300005617 Bacteria 2204
88 Ga0068859_100262775 3300005617 Unclassified 1817
89 Ga0068859_100743439 3300005617 Bacteria 1070
90 Ga0068859_100743903 3300005617 Bacteria 1070
91 Ga0068859_100851832 3300005617 Unclassified 998
92 Ga0068859_101672609 3300005617 Unclassified 703
93 Ga0068864_100001487 3300005618 Bacteria 19306
94 Ga0068864_100124712 3300005618 Bacteria 2306
95 Ga0068864_100281294 3300005618 Unclassified 1553
96 Ga0068864_100443219 3300005618 Bacteria 1241
97 Ga0068864_100459641 3300005618 Unclassified 1218
98 Ga0068864_100813034 3300005618 Bacteria 919
99 Ga0068864_100820519 3300005618 Bacteria 915
100 Ga0068864_101638703 3300005618 Bacteria 648
101 Ga0068866_10189243 3300005718 Bacteria 1222
102 Ga0068866_10230142 3300005718 Bacteria 1124
103 Ga0068866_10668022 3300005718 Archaea 709
104 Ga0068861_100228514 3300005719 Bacteria 1577
105 Ga0068863_100977753 3300005841 Unclassified 849
106 Ga0068863_102455829 3300005841 Unclassified 530
107 Ga0068858_100017669 3300005842 Bacteria 6685
108 Ga0068858_100195024 3300005842 Bacteria 1914
109 Ga0068858_100446048 3300005842 Bacteria 1247
110 Ga0068858_100802140 3300005842 Bacteria 918
111 Ga0068858_101104271 3300005842 Unclassified 779
112 Ga0068858_101328289 3300005842 Bacteria 708
113 Ga0068860_100301830 3300005843 Bacteria 1569
114 Ga0068860_100306549 3300005843 Bacteria 1557
115 Ga0068860_100335556 3300005843 Bacteria 1486
116 Ga0068860_100338011 3300005843 Bacteria 1480
117 Ga0068860_100598300 3300005843 Bacteria 1108
118 Ga0068860_101727685 3300005843 Unclassified 648
119 Ga0068862_101878474 3300005844 Bacteria 609
120 Ga0081539_10022104 3300005985 Bacteria 4220
121 Ga0081539_10209922 3300005985 Unclassified 893
122 Ga0070717_11293694 3300006028 Bacteria 663
123 Ga0097621_100851630 3300006237 Bacteria 847
124 Ga0068871_100071688 3300006358 Bacteria 2850
125 Ga0068871_100162118 3300006358 Bacteria 1913
126 Ga0068871_100468444 3300006358 Bacteria 1132
127 Ga0075428_100607525 3300006844 Bacteria 1168
128 Ga0075428_101141879 3300006844 Unclassified 822
129 Ga0075433_10041822 3300006852 Bacteria 3973
130 Ga0075433_10122285 3300006852 Bacteria 2312
131 Ga0075433_10603023 3300006852 Bacteria 964
132 Ga0075433_10848013 3300006852 Bacteria 798
133 Ga0075433_10891054 3300006852 Archaea 776
134 Ga0075434_100003759 3300006871 Bacteria 13555
135 Ga0075434_100104939 3300006871 Bacteria 2836
136 Ga0075434_100184666 3300006871 Bacteria 2106
137 Ga0075434_101763624 3300006871 Bacteria 626
138 Ga0075429_100188239 3300006880 Bacteria 1809
139 Ga0075429_100549806 3300006880 Bacteria 1012
140 Ga0068865_100184659 3300006881 Unclassified 1608
141 Ga0068865_100553576 3300006881 Unclassified 966
142 Ga0075436_100002675 3300006914 Bacteria 12253
143 Ga0075436_100008812 3300006914 Bacteria 6900
144 Ga0075436_100082490 3300006914 Bacteria 2230
145 Ga0075436_100217435 3300006914 Bacteria 1355
146 Ga0075436_101334167 3300006914 Bacteria 543
147 Ga0097620_100178802 3300006931 Bacteria 2204
148 Ga0097620_100262776 3300006931 Unclassified 1817
149 Ga0097620_100743479 3300006931 Bacteria 1070
150 Ga0097620_100743826 3300006931 Bacteria 1070
151 Ga0097620_100851829 3300006931 Unclassified 998
152 Ga0097620_101672438 3300006931 Unclassified 703
153 Ga0075435_100002315 3300007076 Bacteria 12600
154 Ga0075435_100015054 3300007076 Bacteria 5805
155 Ga0075435_100175709 3300007076 Bacteria 1808
156 Ga0075435_100206778 3300007076 Bacteria 1664
157 Ga0105240_10057187 3300009093 Bacteria 4875
158 Ga0105240_10057833 3300009093 Bacteria 4842
159 Ga0105240_10213572 3300009093 Bacteria 2253
160 Ga0105240_10284768 3300009093 Bacteria 1897
161 Ga0105240_10655602 3300009093 Bacteria 1150
162 Ga0105240_10740890 3300009093 Bacteria 1069
163 Ga0111539_10136960 3300009094 Bacteria 2867
164 Ga0111539_10217925 3300009094 Bacteria 2223
165 Ga0111539_10587933 3300009094 Bacteria 1296
166 Ga0111539_10737367 3300009094 Bacteria 1147
167 Ga0111539_10773817 3300009094 Unclassified 1117
168 Ga0111539_10850234 3300009094 Unclassified 1062
169 Ga0105245_10009869 3300009098 Bacteria 8315
170 Ga0105245_10010809 3300009098 Bacteria 7942
171 Ga0105245_10516835 3300009098 Bacteria 1212
172 Ga0105247_11345811 3300009101 Unclassified 575
173 Ga0114129_10000418 3300009147 Bacteria 50300
174 Ga0114129_10009369 3300009147 Bacteria 13961
175 Ga0114129_10318220 3300009147 Unclassified 2069
176 Ga0114129_10439966 3300009147 Bacteria 1712
177 Ga0114129_10631762 3300009147 Bacteria 1384
178 Ga0114129_10940975 3300009147 Unclassified 1092
179 Ga0114129_12026684 3300009147 Unclassified 696
180 Ga0105243_10974707 3300009148 Unclassified 849
181 Ga0105242_10034999 3300009176 Bacteria 4027
182 Ga0105242_10041664 3300009176 Bacteria 3705
183 Ga0105242_10518814 3300009176 Unclassified 1136
184 Ga0105242_11175442 3300009176 Bacteria 785
185 Ga0105248_10011457 3300009177 Bacteria 9771
186 Ga0105248_10028585 3300009177 Bacteria 6212
187 Ga0105248_10034396 3300009177 Bacteria 5666
188 Ga0105248_10074760 3300009177 Bacteria 3808
189 Ga0105248_10082548 3300009177 Bacteria 3614
190 Ga0105248_10085099 3300009177 Bacteria 3558
191 Ga0105248_10242580 3300009177 Bacteria 2028
192 Ga0105248_10303390 3300009177 Bacteria 1798
193 Ga0105248_10331894 3300009177 Bacteria 1713
194 Ga0105248_10453027 3300009177 Bacteria 1446
195 Ga0105248_11202085 3300009177 Bacteria 857
196 Ga0105237_11041322 3300009545 Unclassified 825
197 Ga0105237_11830677 3300009545 Unclassified 615
198 Ga0105238_10204694 3300009551 Bacteria 1949
199 Ga0105238_10559834 3300009551 Bacteria 1148
200 Ga0105238_10574954 3300009551 Bacteria 1133
201 Ga0105249_10285081 3300009553 Unclassified 1651
202 Ga0105249_10510546 3300009553 Bacteria 1248
203 Ga0105249_10603224 3300009553 Bacteria 1153
204 Ga0105239_12362598 3300010375 Unclassified 619
205 Ga0105246_11189089 3300011119 Bacteria 701
206 Ga0105246_12024978 3300011119 Bacteria 556
207 Ga0157374_10012245 3300013296 Bacteria 7456
208 Ga0157374_11288080 3300013296 Bacteria 753
209 Ga0157378_12162032 3300013297 Unclassified 607
210 Ga0157378_12920039 3300013297 Unclassified 530
211 Ga0163162_10083025 3300013306 Bacteria 3277
212 Ga0163162_10410789 3300013306 Bacteria 1486
213 Ga0157372_12408408 3300013307 Viruses 604
214 Ga0157375_10665299 3300013308 Bacteria 1197
215 Ga0157375_12070519 3300013308 Archaea 677
216 Ga0163163_10237404 3300014325 Bacteria 1872
217 Ga0163163_10364186 3300014325 Bacteria 1502
218 Ga0163163_10476286 3300014325 Bacteria 1309
219 Ga0157380_10191962 3300014326 Unclassified 1804
220 Ga0157380_11075805 3300014326 Unclassified 842
221 Ga0157379_10024409 3300014968 Bacteria 5368
222 Ga0157379_10090500 3300014968 Bacteria 2745
223 Ga0157379_11121813 3300014968 Bacteria 754
224 Ga0157376_10003443 3300014969 Bacteria 10895
225 Ga0157376_10052197 3300014969 Bacteria 3399
226 Ga0157376_10595191 3300014969 Bacteria 1100
227 Ga0182007_10041219 3300015262 Bacteria 1540
228 Ga0163161_11095176 3300017792 Bacteria 684
229 Ga0207653_10114754 3300025885 Bacteria 965
230 Ga0207642_10154797 3300025899 Bacteria 1224
231 Ga0207642_10199437 3300025899 Bacteria 1104
232 Ga0207710_10025345 3300025900 Bacteria 2559
233 Ga0207680_10009816 3300025903 Bacteria 4765
234 Ga0207680_10011972 3300025903 Bacteria 4405
235 Ga0207680_10281477 3300025903 Bacteria 1155
236 Ga0207680_10566834 3300025903 Unclassified 811
237 Ga0207705_10076921 3300025909 Bacteria 2427
238 Ga0207695_10144997 3300025913 Bacteria 2319
239 Ga0207695_10208536 3300025913 Unclassified 1866
240 Ga0207695_11176257 3300025913 Bacteria 647
241 Ga0207695_11243189 3300025913 Unclassified 625
242 Ga0207662_10132111 3300025918 Bacteria 1575
243 Ga0207657_10001420 3300025919 Bacteria 25553
244 Ga0207649_10082951 3300025920 Bacteria 2079
245 Ga0207652_10048927 3300025921 Bacteria 3616
246 Ga0207646_10446489 3300025922 Bacteria 1167
247 Ga0207646_10895110 3300025922 Unclassified 787
248 Ga0207681_10217601 3300025923 Bacteria 1476
249 Ga0207694_10273795 3300025924 Bacteria 1385
250 Ga0207694_10310006 3300025924 Bacteria 1301
251 Ga0207694_10669987 3300025924 Bacteria 874
252 Ga0207650_10337737 3300025925 Bacteria 1237
253 Ga0207659_10000574 3300025926 Bacteria 22106
254 Ga0207687_10045023 3300025927 Bacteria 3049
255 Ga0207687_10381407 3300025927 Bacteria 1155
256 Ga0207664_10124524 3300025929 Bacteria 2162
257 Ga0207644_10184121 3300025931 Bacteria 1639
258 Ga0207644_10574337 3300025931 Bacteria 935
259 Ga0207690_10150761 3300025932 Bacteria 1723
260 Ga0207686_10171298 3300025934 Bacteria 1531
261 Ga0207686_10291699 3300025934 Unclassified 1208
262 Ga0207686_10433051 3300025934 Bacteria 1008
263 Ga0207709_10243199 3300025935 Bacteria 1310
264 Ga0207670_10110852 3300025936 Bacteria 1978
265 Ga0207670_11597645 3300025936 Bacteria 555
266 Ga0207669_10126364 3300025937 Bacteria 1748
267 Ga0207704_10052002 3300025938 Bacteria 2481
268 Ga0207704_10135199 3300025938 Bacteria 1715
269 Ga0207691_10227746 3300025940 Unclassified 1615
270 Ga0207711_10003836 3300025941 Bacteria 12928
271 Ga0207711_10056420 3300025941 Bacteria 3375
272 Ga0207711_10233966 3300025941 Bacteria 1683
273 Ga0207711_10308925 3300025941 Bacteria 1460
274 Ga0207711_10370290 3300025941 Bacteria 1328
275 Ga0207711_10379061 3300025941 Unclassified 1312
276 Ga0207711_10528271 3300025941 Bacteria 1100
277 Ga0207711_10625602 3300025941 Bacteria 1004
278 Ga0207711_10833684 3300025941 Archaea 858
279 Ga0207711_11220571 3300025941 Bacteria 694
280 Ga0207689_10040561 3300025942 Bacteria 3853
281 Ga0207689_10749692 3300025942 Bacteria 824
282 Ga0207661_11213604 3300025944 Unclassified 694
283 Ga0207679_10334746 3300025945 Bacteria 1315
284 Ga0207667_10069649 3300025949 Bacteria 3661
285 Ga0207667_10507242 3300025949 Bacteria 1223
286 Ga0207651_10056354 3300025960 Unclassified 2704
287 Ga0207651_10353647 3300025960 Bacteria 1238
288 Ga0207651_10599296 3300025960 Bacteria 963
289 Ga0207712_10305233 3300025961 Bacteria 1308
290 Ga0207712_11050178 3300025961 Bacteria 724
291 Ga0207640_10010100 3300025981 Bacteria 5307
292 Ga0207640_10053157 3300025981 Unclassified 2643
293 Ga0207640_10155773 3300025981 Bacteria 1684
294 Ga0207658_10150609 3300025986 Bacteria 1895
295 Ga0207658_10729187 3300025986 Unclassified 897
296 Ga0207677_10165245 3300026023 Bacteria 1724
297 Ga0207677_10882115 3300026023 Unclassified 805
298 Ga0207677_10969111 3300026023 Bacteria 770
299 Ga0207677_11740059 3300026023 Archaea 578
300 Ga0207703_10007629 3300026035 Bacteria 8578
301 Ga0207703_10023913 3300026035 Bacteria 4804
302 Ga0207703_10197798 3300026035 Bacteria 1784
303 Ga0207703_10272820 3300026035 Bacteria 1533
304 Ga0207703_10285483 3300026035 Bacteria 1500
305 Ga0207703_10644937 3300026035 Bacteria 1004
306 Ga0207639_11801613 3300026041 Bacteria 573
307 Ga0207641_10120310 3300026088 Bacteria 2342
308 Ga0207641_10192589 3300026088 Bacteria 1875
309 Ga0207641_10614097 3300026088 Bacteria 1066
310 Ga0207641_10625212 3300026088 Unclassified 1056
311 Ga0207648_10053697 3300026089 Bacteria 3521
312 Ga0207648_10533876 3300026089 Bacteria 1076
313 Ga0207676_10028404 3300026095 Bacteria 4178
314 Ga0207676_10169452 3300026095 Bacteria 1901
315 Ga0207676_10405505 3300026095 Bacteria 1275
316 Ga0207675_100090822 3300026118 Bacteria 2871
317 Ga0207428_10146802 3300027907 Bacteria 1797
318 Ga0268266_10088178 3300028379 Bacteria 2715
319 Ga0268265_10224340 3300028380 Bacteria 1647
320 Ga0268264_10046812 3300028381 Bacteria 3594
321 Ga0268264_10314015 3300028381 Bacteria 1480
322 Ga0373930_0018175 3300034816 Bacteria 1348
323 Ga0373948_0000276 3300034817 Bacteria 6216
324 Ga0373950_0011983 3300034818 Bacteria 1425
325 Ga0373959_0000801 3300034820 Bacteria 5368
326 Ga0373938_0000195 3300034957 Bacteria 9049
327 Ga0373928_0001035 3300035084 Bacteria 5479
328 Ga0373929_0000205 3300035085 Bacteria 10612
329 Ga0373940_0000272 3300035088 Bacteria 7441
330 Ga0373949_0000817 3300035090 Bacteria 9928
331 Ga0373951_0001426 3300035091 Bacteria 6278
332 Ga0373952_0002649 3300035092 Bacteria 3230
333 Ga0373932_0000673 3300035112 Bacteria 10369
334 Ga0373939_0000915 3300035114 Bacteria 7329
335 Ga0373941_0002363 3300035115 Bacteria 4144
336 Ga0373954_0444132 3300035118 Unclassified 642
337 Ga0373957_0017436 3300035120 Bacteria 2500
338 Ga0373960_0000771 3300035121 Bacteria 6710
339 Ga0373943_0287534 3300035170 Unclassified 931
340 Ga0373955_0245076 3300035172 Bacteria 1074
341 Ga0373955_0322173 3300035172 Bacteria 934
342 Ga0373942_0000027 3300035207 Bacteria 27511
343 Ga0373961_0000998 3300035241 Bacteria 9295
344 Ga0373962_0002113 3300035242 Bacteria 4746
345 Ga0373931_0002138 3300035691 Bacteria 8706
346 Ga0373931_0425409 3300035691 Unclassified 845
347 Ga0373935_0043715 3300035692 Bacteria 2821
348 Ga0373935_0768407 3300035692 Bacteria 710
349 Ga0373937_0259025 3300036401 Unclassified 1640
350 Ga0373925_0451869 3300037068 Bacteria 1052
351 Ga0450923_146840 3300042125 Bacteria 569
352 Ga0439435_0124643 3300042436 Bacteria 809
353 Ga0439444_0043778 3300042437 Bacteria 888
354 Ga0466963_0067943 3300044694 Bacteria 2393
355 Ga0466963_0083577 3300044694 Bacteria 2165
356 Ga0451576_0005274 3300045051 Bacteria 16262
357 Ga0466967_0241137 3300045976 Bacteria 1725
358 Ga0495653_0447702 3300046463 Bacteria 813
359 Ga0495664_0698550 3300046477 Unclassified 599
360 Ga0495628_0496498 3300046516 Unclassified 882
361 Ga0495586_0183002 3300046535 Bacteria 1186
362 Ga0495645_0001271 3300046543 Bacteria 17186
363 Ga0495635_0111462 3300046663 Bacteria 1869
364 Ga0495635_0665662 3300046663 Unclassified 677
365 Ga0495659_0086493 3300046664 Bacteria 1198
366 Ga0495599_0110610 3300046678 Bacteria 1711
367 Ga0495674_0196145 3300047319 Unclassified 1677
368 Ga0495680_0182118 3300047322 Bacteria 1516
369 Ga0495684_0061981 3300047471 Bacteria 2845
370 Ga0496100_1287510 3300048903 Bacteria 577
371 Ga0496101_0434944 3300048904 Bacteria 1035
372 Ga0496101_0651617 3300048904 Unclassified 832
373 Ga0496102_0043622 3300048905 Bacteria 4068
374 Ga0496103_0588304 3300048906 Bacteria 709
375 Ga0496104_0011453 3300048907 Bacteria 7948
376 Ga0496104_0065584 3300048907 Bacteria 3446
377 Ga0496104_0744116 3300048907 Unclassified 887
378 Ga0496105_0029112 3300048908 Bacteria 4520
379 Ga0496106_0154924 3300048909 Bacteria 1809
380 Ga0496106_0414367 3300048909 Bacteria 1083
381 Ga0496107_0107717 3300048910 Bacteria 2047
382 Ga0496108_0022264 3300048911 Bacteria 5211
383 Ga0496110_0275735 3300048913 Unclassified 1531
384 Ga0496111_1037564 3300048914 Unclassified 586
385 Ga0496111_1135137 3300048914 Unclassified 556
386 Ga0496112_0008714 3300048915 Bacteria 9095
387 Ga0496112_0175677 3300048915 Bacteria 2107
388 Ga0496112_0180963 3300048915 Bacteria 2072
389 Ga0496112_0355933 3300048915 Bacteria 1406
390 Ga0496112_1785027 3300048915 Bacteria 527
391 Ga0496113_0005813 3300048916 Bacteria 7741
392 Ga0496113_0295444 3300048916 Bacteria 1297
393 Ga0496114_0068427 3300048917 Unclassified 2981
394 Ga0496114_0106774 3300048917 Bacteria 2396
395 Ga0496115_0661923 3300048918 Unclassified 824
396 Ga0501031_0351419 3300049568 Unclassified 954
397 Ga0501033_0441034 3300049570 Unclassified 905
398 Ga0501036_0063655 3300049572 Unclassified 3122
399 Ga0501040_0036005 3300049576 Bacteria 3358
400 Ga0501041_0039015 3300049577 Unclassified 2881
401 Ga0501042_1023498 3300049578 Bacteria 602
402 Ga0501067_0472704 3300049583 Bacteria 701
403 Ga0501069_0489011 3300049585 Unclassified 734
404 Ga0501070_0873111 3300049586 Bacteria 703
405 Ga0501072_0094986 3300049588 Bacteria 2369
406 Ga0501075_0023401 3300049591 Bacteria 4523
407 Ga0501077_0518949 3300049593 Bacteria 764
408 Ga0501229_078494 3300049706 Unclassified 526
409 Ga0501081_0101999 3300049743 Bacteria 2029
410 Ga0501283_128228 3300049779 Unclassified 513
411 nmdc:mga05p37_219641_c1 3300050507 Bacteria 2294
412 nmdc:mga05p37_337325_c1 3300050507 Unclassified 1778
413 nmdc:mga05p37_39279_c1 3300050507 Bacteria 5810
414 nmdc:mga05p37_490935_c1 3300050507 Bacteria 1412
415 nmdc:mga05p37_601299_c1 3300050507 Bacteria 1241
416 nmdc:mga05p37_613880_c1 3300050507 Bacteria 1225
417 nmdc:mga05p37_741861_c1 3300050507 Unclassified 1084
418 nmdc:mga05p37_833_c1 3300050507 Bacteria 34555
419 nmdc:mga09592_176544_c1 3300050508 Unclassified 1847
420 nmdc:mga09592_466765_c1 3300050508 Unclassified 1088
421 nmdc:mga08y16_207813_c1 3300050511 Bacteria 2028
422 nmdc:mga08y16_465947_c1 3300050511 Bacteria 1287
423 nmdc:mga08y16_700244_c1 3300050511 Bacteria 1013
424 nmdc:mga0n895_1517163_c1 3300050512 Bacteria 636
425 nmdc:mga0n895_226195_c1 3300050512 Bacteria 1899
426 nmdc:mga0n895_29645_c1 3300050512 Bacteria 5222
427 nmdc:mga0n895_37257_c1 3300050512 Bacteria 4703
428 nmdc:mga0n895_739495_c1 3300050512 Bacteria 977
429 nmdc:mga0n895_93823_c1 3300050512 Bacteria 3005
430 nmdc:mga0rr50_224647_c1 3300050513 Bacteria 1552
431 nmdc:mga0rr50_885_c1 3300050513 Bacteria 16201
432 nmdc:mga08x19_242942_c1 3300050514 Unclassified 1242
433 nmdc:mga08x19_26437_c1 3300050514 Bacteria 3622
434 nmdc:mga08x19_423095_c1 3300050514 Unclassified 936
435 nmdc:mga08x19_438594_c1 3300050514 Bacteria 918
436 nmdc:mga08x19_442537_c1 3300050514 Unclassified 914
437 nmdc:mga08x19_4468_c1 3300050514 Bacteria 8286
438 nmdc:mga0a205_3926_c1 3300050515 Bacteria 9115
439 nmdc:mga0a205_53224_c1 3300050515 Bacteria 3907
440 nmdc:mga0a205_802658_c1 3300050515 Archaea 789
441 Ga0495601_0017724 3300053077 Bacteria 4327
442 Ga0495601_0041833 3300053077 Bacteria 2873
443 Ga0495595_0293379 3300053084 Bacteria 817
444 Ga0495619_0381894 3300053085 Bacteria 973
445 Ga0530510_0046445 3300061734 Bacteria 3137
446 Ga0373931_0316207
447 Ga0065712_10070052
448 Ga0065715_10135768
449 Ga0065715_10203574
450 Ga0065715_10310134
451 Ga0065707_10639567
452 Ga0070683_101328271
453 Ga0070690_100002248
454 Ga0070670_101108566
455 Ga0070670_101273985
456 Ga0070666_10009755
457 Ga0070666_10127763
458 Ga0070666_10187368
459 Ga0070666_10379607
460 Ga0070680_101707810
461 Ga0070660_100041376
462 Ga0070660_101108581
463 Ga0070689_100035057
464 Ga0070689_100885206
465 Ga0070691_10265181
466 Ga0070687_100077715
467 Ga0070687_101091725
468 Ga0070669_100183761
469 Ga0070669_100899329
470 Ga0070675_101402912
471 Ga0070671_100299581
472 Ga0070671_101209941
473 Ga0070674_100157069
474 Ga0070673_100026625
475 Ga0070673_100428541
476 Ga0070673_100822933
477 Ga0070688_100029166
478 Ga0070659_100027824
479 Ga0070659_101932496
480 Ga0070667_100461093
481 Ga0070714_100138235
482 Ga0070713_101998656
483 Ga0070705_100171993
484 Ga0070694_100438980
485 Ga0070694_101506680
486 Ga0070708_100016561
487 Ga0070708_101016524
488 Ga0070678_101685732
489 Ga0070662_100894639
490 Ga0070662_100940691
491 Ga0070681_10277437
492 Ga0068867_100498243
493 Ga0068867_101890394
494 Ga0070685_10155268
495 Ga0070685_10476461
496 Ga0070706_101146018
497 Ga0070707_100394040
498 Ga0070707_100396678
499 Ga0070707_100441461
500 Ga0070707_102229038
501 Ga0070698_100466318
502 Ga0070698_100855911
503 Ga0070699_100007883
504 Ga0070699_100140281
505 Ga0070699_100198872
506 Ga0070699_100313048
507 Ga0070679_100111740
508 Ga0070697_100015093
509 Ga0070697_100227977
510 Ga0070697_100612002
511 Ga0070697_101231671
512 Ga0070697_101376756
513 Ga0070697_101773383
514 Ga0070672_100432455
515 Ga0070672_100489170
516 Ga0070686_100001661
517 Ga0070686_100184493
518 Ga0070686_101445123
519 Ga0070695_100602364
520 Ga0070695_101263652
521 Ga0070696_100623187
522 Ga0070696_100905561
523 Ga0070693_100273399
524 Ga0070665_100008057
525 Ga0070704_100592960
526 Ga0068855_100109271
527 Ga0070664_100753851
528 Ga0068854_100017870
529 Ga0068854_100082396
530 Ga0068854_100158175
531 Ga0068854_100606491
532 Ga0068859_100178789
533 Ga0068859_100262775
534 Ga0068859_100743439
535 Ga0068859_100743903
536 Ga0068859_100851832
537 Ga0068859_101672609
538 Ga0068864_100001487
539 Ga0068864_100124712
540 Ga0068864_100281294
541 Ga0068864_100443219
542 Ga0068864_100459641
543 Ga0068864_100813034
544 Ga0068864_100820519
545 Ga0068864_101638703
546 Ga0068866_10189243
547 Ga0068866_10230142
548 Ga0068866_10668022
549 Ga0068861_100228514
550 Ga0068863_100977753
551 Ga0068863_102455829
552 Ga0068858_100017669
553 Ga0068858_100195024
554 Ga0068858_100446048
555 Ga0068858_100802140
556 Ga0068858_101104271
557 Ga0068858_101328289
558 Ga0068860_100301830
559 Ga0068860_100306549
560 Ga0068860_100335556
561 Ga0068860_100338011
562 Ga0068860_100598300
563 Ga0068860_101727685
564 Ga0068862_101878474
565 Ga0081539_10022104
566 Ga0081539_10209922
567 Ga0070717_11293694
568 Ga0097621_100851630
569 Ga0068871_100071688
570 Ga0068871_100162118
571 Ga0068871_100468444
572 Ga0075428_100607525
573 Ga0075428_101141879
574 Ga0075433_10041822
575 Ga0075433_10122285
576 Ga0075433_10603023
577 Ga0075433_10848013
578 Ga0075433_10891054
579 Ga0075434_100003759
580 Ga0075434_100104939
581 Ga0075434_100184666
582 Ga0075434_101763624
583 Ga0075429_100188239
584 Ga0075429_100549806
585 Ga0068865_100184659
586 Ga0068865_100553576
587 Ga0075436_100002675
588 Ga0075436_100008812
589 Ga0075436_100082490
590 Ga0075436_100217435
591 Ga0075436_101334167
592 Ga0097620_100178802
593 Ga0097620_100262776
594 Ga0097620_100743479
595 Ga0097620_100743826
596 Ga0097620_100851829
597 Ga0097620_101672438
598 Ga0075435_100002315
599 Ga0075435_100015054
600 Ga0075435_100175709
601 Ga0075435_100206778
602 Ga0105240_10057187
603 Ga0105240_10057833
604 Ga0105240_10213572
605 Ga0105240_10284768
606 Ga0105240_10655602
607 Ga0105240_10740890
608 Ga0111539_10136960
609 Ga0111539_10217925
610 Ga0111539_10587933
611 Ga0111539_10737367
612 Ga0111539_10773817
613 Ga0111539_10850234
614 Ga0105245_10009869
615 Ga0105245_10010809
616 Ga0105245_10516835
617 Ga0105247_11345811
618 Ga0114129_10000418
619 Ga0114129_10009369
620 Ga0114129_10318220
621 Ga0114129_10439966
622 Ga0114129_10631762
623 Ga0114129_10940975
624 Ga0114129_12026684
625 Ga0105243_10974707
626 Ga0105242_10034999
627 Ga0105242_10041664
628 Ga0105242_10518814
629 Ga0105242_11175442
630 Ga0105248_10011457
631 Ga0105248_10028585
632 Ga0105248_10034396
633 Ga0105248_10074760
634 Ga0105248_10082548
635 Ga0105248_10085099
636 Ga0105248_10242580
637 Ga0105248_10303390
638 Ga0105248_10331894
639 Ga0105248_10453027
640 Ga0105248_11202085
641 Ga0105237_11041322
642 Ga0105237_11830677
643 Ga0105238_10204694
644 Ga0105238_10559834
645 Ga0105238_10574954
646 Ga0105249_10285081
647 Ga0105249_10510546
648 Ga0105249_10603224
649 Ga0105239_12362598
650 Ga0105246_11189089
651 Ga0105246_12024978
652 Ga0157374_10012245
653 Ga0157374_11288080
654 Ga0157378_12162032
655 Ga0157378_12920039
656 Ga0163162_10083025
657 Ga0163162_10410789
658 Ga0157372_12408408
659 Ga0157375_10665299
660 Ga0157375_12070519
661 Ga0163163_10237404
662 Ga0163163_10364186
663 Ga0163163_10476286
664 Ga0157380_10191962
665 Ga0157380_11075805
666 Ga0157379_10024409
667 Ga0157379_10090500
668 Ga0157379_11121813
669 Ga0157376_10003443
670 Ga0157376_10052197
671 Ga0157376_10595191
672 Ga0182007_10041219
673 Ga0163161_11095176
674 Ga0207653_10114754
675 Ga0207642_10154797
676 Ga0207642_10199437
677 Ga0207710_10025345
678 Ga0207680_10009816
679 Ga0207680_10011972
680 Ga0207680_10281477
681 Ga0207680_10566834
682 Ga0207705_10076921
683 Ga0207695_10144997
684 Ga0207695_10208536
685 Ga0207695_11176257
686 Ga0207695_11243189
687 Ga0207662_10132111
688 Ga0207657_10001420
689 Ga0207649_10082951
690 Ga0207652_10048927
691 Ga0207646_10446489
692 Ga0207646_10895110
693 Ga0207681_10217601
694 Ga0207694_10273795
695 Ga0207694_10310006
696 Ga0207694_10669987
697 Ga0207650_10337737
698 Ga0207659_10000574
699 Ga0207687_10045023
700 Ga0207687_10381407
701 Ga0207664_10124524
702 Ga0207644_10184121
703 Ga0207644_10574337
704 Ga0207690_10150761
705 Ga0207686_10171298
706 Ga0207686_10291699
707 Ga0207686_10433051
708 Ga0207709_10243199
709 Ga0207670_10110852
710 Ga0207670_11597645
711 Ga0207669_10126364
712 Ga0207704_10052002
713 Ga0207704_10135199
714 Ga0207691_10227746
715 Ga0207711_10003836
716 Ga0207711_10056420
717 Ga0207711_10233966
718 Ga0207711_10308925
719 Ga0207711_10370290
720 Ga0207711_10379061
721 Ga0207711_10528271
722 Ga0207711_10625602
723 Ga0207711_10833684
724 Ga0207711_11220571
725 Ga0207689_10040561
726 Ga0207689_10749692
727 Ga0207661_11213604
728 Ga0207679_10334746
729 Ga0207667_10069649
730 Ga0207667_10507242
731 Ga0207651_10056354
732 Ga0207651_10353647
733 Ga0207651_10599296
734 Ga0207712_10305233
735 Ga0207712_11050178
736 Ga0207640_10010100
737 Ga0207640_10053157
738 Ga0207640_10155773
739 Ga0207658_10150609
740 Ga0207658_10729187
741 Ga0207677_10165245
742 Ga0207677_10882115
743 Ga0207677_10969111
744 Ga0207677_11740059
745 Ga0207703_10007629
746 Ga0207703_10023913
747 Ga0207703_10197798
748 Ga0207703_10272820
749 Ga0207703_10285483
750 Ga0207703_10644937
751 Ga0207639_11801613
752 Ga0207641_10120310
753 Ga0207641_10192589
754 Ga0207641_10614097
755 Ga0207641_10625212
756 Ga0207648_10053697
757 Ga0207648_10533876
758 Ga0207676_10028404
759 Ga0207676_10169452
760 Ga0207676_10405505
761 Ga0207675_100090822
762 Ga0207428_10146802
763 Ga0268266_10088178
764 Ga0268265_10224340
765 Ga0268264_10046812
766 Ga0268264_10314015
767 Ga0373930_0018175
768 Ga0373948_0000276
769 Ga0373950_0011983
770 Ga0373959_0000801
771 Ga0373938_0000195
772 Ga0373928_0001035
773 Ga0373929_0000205
774 Ga0373940_0000272
775 Ga0373949_0000817
776 Ga0373951_0001426
777 Ga0373952_0002649
778 Ga0373932_0000673
779 Ga0373939_0000915
780 Ga0373941_0002363
781 Ga0373954_0444132
782 Ga0373957_0017436
783 Ga0373960_0000771
784 Ga0373943_0287534
785 Ga0373955_0245076
786 Ga0373955_0322173
787 Ga0373942_0000027
788 Ga0373961_0000998
789 Ga0373962_0002113
790 Ga0373931_0002138
791 Ga0373931_0425409
792 Ga0373935_0043715
793 Ga0373935_0768407
794 Ga0373937_0259025
795 Ga0373925_0451869
796 Ga0450923_146840
797 Ga0439435_0124643
798 Ga0439444_0043778
799 Ga0466963_0067943
800 Ga0466963_0083577
801 Ga0451576_0005274
802 Ga0466967_0241137
803 Ga0495653_0447702
804 Ga0495664_0698550
805 Ga0495628_0496498
806 Ga0495586_0183002
807 Ga0495645_0001271
808 Ga0495635_0111462
809 Ga0495635_0665662
810 Ga0495659_0086493
811 Ga0495599_0110610
812 Ga0495674_0196145
813 Ga0495680_0182118
814 Ga0495684_0061981
815 Ga0496100_1287510
816 Ga0496101_0434944
817 Ga0496101_0651617
818 Ga0496102_0043622
819 Ga0496103_0588304
820 Ga0496104_0011453
821 Ga0496104_0065584
822 Ga0496104_0744116
823 Ga0496105_0029112
824 Ga0496106_0154924
825 Ga0496106_0414367
826 Ga0496107_0107717
827 Ga0496108_0022264
828 Ga0496110_0275735
829 Ga0496111_1037564
830 Ga0496111_1135137
831 Ga0496112_0008714
832 Ga0496112_0175677
833 Ga0496112_0180963
834 Ga0496112_0355933
835 Ga0496112_1785027
836 Ga0496113_0005813
837 Ga0496113_0295444
838 Ga0496114_0068427
839 Ga0496114_0106774
840 Ga0496115_0661923
841 Ga0501031_0351419
842 Ga0501033_0441034
843 Ga0501036_0063655
844 Ga0501040_0036005
845 Ga0501041_0039015
846 Ga0501042_1023498
847 Ga0501067_0472704
848 Ga0501069_0489011
849 Ga0501070_0873111
850 Ga0501072_0094986
851 Ga0501075_0023401
852 Ga0501077_0518949
853 Ga0501229_078494
854 Ga0501081_0101999
855 Ga0501283_128228
856 nmdc:mga05p37_219641_c1
857 nmdc:mga05p37_337325_c1
858 nmdc:mga05p37_39279_c1
859 nmdc:mga05p37_490935_c1
860 nmdc:mga05p37_601299_c1
861 nmdc:mga05p37_613880_c1
862 nmdc:mga05p37_741861_c1
863 nmdc:mga05p37_833_c1
864 nmdc:mga09592_176544_c1
865 nmdc:mga09592_466765_c1
866 nmdc:mga08y16_207813_c1
867 nmdc:mga08y16_465947_c1
868 nmdc:mga08y16_700244_c1
869 nmdc:mga0n895_1517163_c1
870 nmdc:mga0n895_226195_c1
871 nmdc:mga0n895_29645_c1
872 nmdc:mga0n895_37257_c1
873 nmdc:mga0n895_739495_c1
874 nmdc:mga0n895_93823_c1
875 nmdc:mga0rr50_224647_c1
876 nmdc:mga0rr50_885_c1
877 nmdc:mga08x19_242942_c1
878 nmdc:mga08x19_26437_c1
879 nmdc:mga08x19_423095_c1
880 nmdc:mga08x19_438594_c1
881 nmdc:mga08x19_442537_c1
882 nmdc:mga08x19_4468_c1
883 nmdc:mga0a205_3926_c1
884 nmdc:mga0a205_53224_c1
885 nmdc:mga0a205_802658_c1
886 Ga0495601_0017724
887 Ga0495601_0041833
888 Ga0495595_0293379
889 Ga0495619_0381894
890 Ga0530510_0046445

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map