F445521

General Info

Members Datasets Scaffolds Average Seq Length
445 199 890 291

Family's Representative Sequence

Representative Sequence 3300025935|Ga0207709_10353173|Ga0207709_103531732
Length 253
Sequence VSLAFAAGRTKKLKLGTSVQVLPGRNPVLLAKQWASLDVLSGGRALPAFGLGVVEPHEQQAFGVTREERAPWFDEALPLMRRLWSEDVVDHDGPRFHYEGVSIGTRPIQQPPDVWLGGRAPRELRRVGELADGWLPSFCTPAQVAEGRETVEAAAAAAGRAIDDEHYGAMVFYARSEVPEPYASMVGTRLGFDPTEVIVVGTSALRDRLEEFLAVGFSKLVLVPVQEAASWRTEVEELADELLDVQGTRSFTR

Samples

Sample ID Description Type Environment
1 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
143 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
144 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
145 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
148 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 1.57
Rhizosphere 98.2
Stem 0
Stem Tuber 0
Unclassified 5.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207709_10353173 3300025935 Bacteria 1110
2 Ga0070676_10004430 3300005328 Bacteria 7388
3 Ga0070683_100235467 3300005329 Bacteria 1741
4 Ga0070690_100082038 3300005330 Bacteria 2111
5 Ga0070690_100168676 3300005330 Bacteria 1505
6 Ga0070670_100013985 3300005331 Bacteria 6882
7 Ga0068869_100000855 3300005334 Bacteria 17469
8 Ga0068869_100007829 3300005334 Bacteria 6855
9 Ga0068869_100210808 3300005334 Bacteria 1536
10 Ga0070680_100002977 3300005336 Bacteria 12590
11 Ga0070682_100002957 3300005337 Bacteria 9435
12 Ga0068868_100172253 3300005338 Bacteria 1792
13 Ga0070660_100000943 3300005339 Bacteria 19406
14 Ga0070689_100025393 3300005340 Bacteria 4450
15 Ga0070691_10009291 3300005341 Bacteria 4494
16 Ga0070691_10019722 3300005341 Bacteria 3113
17 Ga0070691_10036326 3300005341 Bacteria 2322
18 Ga0070661_100000426 3300005344 Bacteria 32270
19 Ga0070692_10009577 3300005345 Bacteria 4373
20 Ga0070692_10023649 3300005345 Bacteria 3012
21 Ga0070669_100065063 3300005353 Bacteria 2686
22 Ga0070669_100134698 3300005353 Bacteria 1899
23 Ga0070669_100523786 3300005353 Bacteria 986
24 Ga0070673_100002409 3300005364 Bacteria 11380
25 Ga0070659_100014481 3300005366 Bacteria 5894
26 Ga0070667_100205673 3300005367 Bacteria 1748
27 Ga0070703_10001170 3300005406 Bacteria 8087
28 Ga0070701_10022033 3300005438 Bacteria 3050
29 Ga0070701_10024878 3300005438 Bacteria 2901
30 Ga0070705_100000293 3300005440 Bacteria 29832
31 Ga0070705_100071857 3300005440 Bacteria 2094
32 Ga0070705_100080292 3300005440 Bacteria 2001
33 Ga0070705_100111145 3300005440 Bacteria 1751
34 Ga0070705_100353019 3300005440 Unclassified 1073
35 Ga0070700_100080386 3300005441 Bacteria 2103
36 Ga0070694_100000056 3300005444 Bacteria 52311
37 Ga0070694_100000282 3300005444 Bacteria 27232
38 Ga0070694_100010506 3300005444 Bacteria 5714
39 Ga0070694_100045050 3300005444 Bacteria 2955
40 Ga0070694_100090065 3300005444 Bacteria 2150
41 Ga0070708_100018975 3300005445 Bacteria 5766
42 Ga0070708_100021416 3300005445 Bacteria 5466
43 Ga0070708_100040895 3300005445 Bacteria 4062
44 Ga0070708_100204267 3300005445 Bacteria 1850
45 Ga0070708_100313060 3300005445 Bacteria 1479
46 Ga0070663_100006993 3300005455 Bacteria 6833
47 Ga0070662_100127586 3300005457 Bacteria 1957
48 Ga0070662_100156948 3300005457 Bacteria 1777
49 Ga0070681_10014685 3300005458 Bacteria 7789
50 Ga0068867_100062643 3300005459 Bacteria 2764
51 Ga0070706_100005325 3300005467 Bacteria 12255
52 Ga0070706_100005793 3300005467 Bacteria 11742
53 Ga0070706_100024610 3300005467 Bacteria 5542
54 Ga0070706_100171097 3300005467 Bacteria 2028
55 Ga0070706_100185289 3300005467 Unclassified 1945
56 Ga0070706_100188523 3300005467 Bacteria 1927
57 Ga0070707_100006878 3300005468 Bacteria 10534
58 Ga0070707_100012451 3300005468 Bacteria 7945
59 Ga0070707_100200841 3300005468 Bacteria 1943
60 Ga0070707_100271005 3300005468 Bacteria 1650
61 Ga0070698_100002035 3300005471 Bacteria 22482
62 Ga0070698_100011273 3300005471 Bacteria 9493
63 Ga0070698_100141014 3300005471 Bacteria 2361
64 Ga0070698_100143024 3300005471 Bacteria 2342
65 Ga0070698_100272992 3300005471 Bacteria 1622
66 Ga0070699_100003730 3300005518 Bacteria 13446
67 Ga0070699_100019685 3300005518 Bacteria 5815
68 Ga0070699_100029740 3300005518 Bacteria 4711
69 Ga0070699_100248199 3300005518 Bacteria 1590
70 Ga0070679_100002904 3300005530 Bacteria 15572
71 Ga0070679_100026159 3300005530 Bacteria 5729
72 Ga0070697_100009180 3300005536 Bacteria 7726
73 Ga0070697_100045483 3300005536 Bacteria 3557
74 Ga0070697_100071893 3300005536 Unclassified 2838
75 Ga0070697_100083542 3300005536 Bacteria 2634
76 Ga0070697_100319361 3300005536 Bacteria 1337
77 Ga0068853_100000387 3300005539 Bacteria 30152
78 Ga0070672_100171538 3300005543 Bacteria 1804
79 Ga0070695_100000877 3300005545 Bacteria 16205
80 Ga0070695_100003430 3300005545 Bacteria 9260
81 Ga0070695_100070840 3300005545 Bacteria 2282
82 Ga0070696_100009469 3300005546 Bacteria 6524
83 Ga0070696_100011951 3300005546 Bacteria 5818
84 Ga0070696_100044375 3300005546 Bacteria 3078
85 Ga0070696_100078951 3300005546 Bacteria 2328
86 Ga0070693_100000595 3300005547 Bacteria 16030
87 Ga0070693_100009740 3300005547 Bacteria 4788
88 Ga0070704_100000716 3300005549 Bacteria 16188
89 Ga0070704_100005220 3300005549 Bacteria 7559
90 Ga0070704_100078511 3300005549 Bacteria 2422
91 Ga0070704_100211841 3300005549 Bacteria 1570
92 Ga0070704_100327746 3300005549 Bacteria 1285
93 Ga0068855_100010963 3300005563 Bacteria 10938
94 Ga0070664_100007171 3300005564 Bacteria 8986
95 Ga0068857_100133125 3300005577 Bacteria 2243
96 Ga0068854_100019626 3300005578 Bacteria 4558
97 Ga0068856_100005709 3300005614 Bacteria 12259
98 Ga0070702_100225895 3300005615 Bacteria 1255
99 Ga0068852_100552133 3300005616 Bacteria 1152
100 Ga0068859_100017491 3300005617 Bacteria 7206
101 Ga0068859_100129377 3300005617 Bacteria 2596
102 Ga0068859_100160426 3300005617 Bacteria 2328
103 Ga0068864_100065933 3300005618 Bacteria 3141
104 Ga0068866_10039251 3300005718 Bacteria 2337
105 Ga0068861_100008599 3300005719 Bacteria 7023
106 Ga0068861_100055250 3300005719 Bacteria 3027
107 Ga0068863_100003990 3300005841 Bacteria 14569
108 Ga0068858_100016765 3300005842 Bacteria 6880
109 Ga0068860_100066529 3300005843 Bacteria 3423
110 Ga0068862_100010240 3300005844 Bacteria 7736
111 Ga0068862_100020881 3300005844 Bacteria 5471
112 Ga0068862_100046214 3300005844 Bacteria 3715
113 Ga0068862_100169217 3300005844 Bacteria 1955
114 Ga0081455_10000189 3300005937 Bacteria 78564
115 Ga0081538_10027064 3300005981 Bacteria 3986
116 Ga0081540_1052298 3300005983 Unclassified 2012
117 Ga0081539_10000180 3300005985 Bacteria 148269
118 Ga0070716_100059757 3300006173 Bacteria 2199
119 Ga0070712_100073030 3300006175 Bacteria 2459
120 Ga0097621_100205745 3300006237 Bacteria 1710
121 Ga0075428_100004038 3300006844 Bacteria 16128
122 Ga0075428_100010074 3300006844 Bacteria 10502
123 Ga0075428_100166944 3300006844 Bacteria 2387
124 Ga0075428_100261070 3300006844 Bacteria 1865
125 Ga0075428_100455644 3300006844 Bacteria 1370
126 Ga0075428_100464291 3300006844 Unclassified 1355
127 Ga0075428_100467717 3300006844 Bacteria 1350
128 Ga0075430_100004684 3300006846 Bacteria 11503
129 Ga0075430_100180247 3300006846 Bacteria 1757
130 Ga0075430_100181073 3300006846 Unclassified 1753
131 Ga0075431_100001546 3300006847 Bacteria 21340
132 Ga0075431_100003062 3300006847 Bacteria 16187
133 Ga0075431_100012139 3300006847 Bacteria 8690
134 Ga0075431_100014105 3300006847 Bacteria 8076
135 Ga0075431_100049713 3300006847 Bacteria 4323
136 Ga0075431_100142629 3300006847 Bacteria 2469
137 Ga0075431_100678216 3300006847 Bacteria 1009
138 Ga0075433_10010148 3300006852 Bacteria 7553
139 Ga0075433_10013298 3300006852 Bacteria 6688
140 Ga0075433_10018180 3300006852 Bacteria 5839
141 Ga0075433_10039285 3300006852 Bacteria 4091
142 Ga0075433_10053299 3300006852 Bacteria 3526
143 Ga0075433_10146439 3300006852 Bacteria 2100
144 Ga0075433_10157662 3300006852 Bacteria 2020
145 Ga0075433_10349300 3300006852 Bacteria 1307
146 Ga0075434_100000105 3300006871 Bacteria 47780
147 Ga0075434_100006539 3300006871 Bacteria 10690
148 Ga0075434_100035283 3300006871 Bacteria 4944
149 Ga0075434_100061337 3300006871 Bacteria 3741
150 Ga0075434_100087980 3300006871 Bacteria 3107
151 Ga0075434_100503139 3300006871 Bacteria 1232
152 Ga0075429_100000231 3300006880 Bacteria 38094
153 Ga0075429_100001801 3300006880 Bacteria 17750
154 Ga0075429_100002072 3300006880 Bacteria 16731
155 Ga0075429_100021153 3300006880 Bacteria 5640
156 Ga0075429_100148075 3300006880 Bacteria 2055
157 Ga0068865_100077302 3300006881 Unclassified 2378
158 Ga0068865_100219432 3300006881 Bacteria 1486
159 Ga0097620_100017490 3300006931 Bacteria 7206
160 Ga0097620_100129378 3300006931 Bacteria 2596
161 Ga0097620_100160420 3300006931 Bacteria 2328
162 Ga0075435_100026025 3300007076 Bacteria 4562
163 Ga0075435_100065129 3300007076 Unclassified 2962
164 Ga0099794_10003196 3300007265 Bacteria 6212
165 Ga0099794_10020910 3300007265 Bacteria 2967
166 Ga0111539_10000139 3300009094 Bacteria 82909
167 Ga0111539_10000622 3300009094 Bacteria 45985
168 Ga0111539_10265191 3300009094 Bacteria 1999
169 Ga0105245_10174457 3300009098 Bacteria 2049
170 Ga0114129_10003348 3300009147 Bacteria 22517
171 Ga0114129_10005765 3300009147 Bacteria 17548
172 Ga0114129_10007755 3300009147 Bacteria 15271
173 Ga0114129_10017726 3300009147 Bacteria 10140
174 Ga0114129_10028712 3300009147 Bacteria 7882
175 Ga0114129_10056086 3300009147 Bacteria 5520
176 Ga0114129_10183785 3300009147 Bacteria 2843
177 Ga0114129_10234028 3300009147 Bacteria 2473
178 Ga0114129_10269579 3300009147 Bacteria 2278
179 Ga0114129_10300084 3300009147 Bacteria 2141
180 Ga0114129_10334902 3300009147 Bacteria 2008
181 Ga0114129_10338736 3300009147 Bacteria 1995
182 Ga0114129_10418104 3300009147 Bacteria 1764
183 Ga0105243_10086274 3300009148 Bacteria 2574
184 Ga0105243_10257622 3300009148 Bacteria 1561
185 Ga0105241_10003314 3300009174 Bacteria 11981
186 Ga0105241_10036267 3300009174 Bacteria 3710
187 Ga0105248_10267839 3300009177 Bacteria 1923
188 Ga0105249_10078693 3300009553 Bacteria 3059
189 Ga0105249_10685499 3300009553 Bacteria 1084
190 Ga0105239_10451375 3300010375 Bacteria 1458
191 Ga0157373_10001331 3300013100 Bacteria 18921
192 Ga0157369_10045998 3300013105 Bacteria 4744
193 Ga0157378_10114348 3300013297 Bacteria 2479
194 Ga0157372_10000624 3300013307 Bacteria 38616
195 Ga0157372_10046035 3300013307 Bacteria 4841
196 Ga0157375_10407955 3300013308 Bacteria 1525
197 Ga0163163_10013260 3300014325 Bacteria 7539
198 Ga0157379_10568490 3300014968 Bacteria 1056
199 Ga0207653_10006658 3300025885 Bacteria 3608
200 Ga0207688_10038672 3300025901 Bacteria 2649
201 Ga0207645_10000213 3300025907 Bacteria 48054
202 Ga0207643_10000553 3300025908 Bacteria 23925
203 Ga0207684_10003690 3300025910 Bacteria 14852
204 Ga0207684_10005695 3300025910 Bacteria 11444
205 Ga0207684_10008507 3300025910 Bacteria 9130
206 Ga0207684_10015631 3300025910 Bacteria 6532
207 Ga0207684_10015740 3300025910 Bacteria 6507
208 Ga0207684_10072294 3300025910 Bacteria 2929
209 Ga0207684_10102121 3300025910 Unclassified 2452
210 Ga0207684_10380960 3300025910 Bacteria 1213
211 Ga0207654_10006160 3300025911 Bacteria 6028
212 Ga0207707_10002064 3300025912 Bacteria 18224
213 Ga0207693_10022872 3300025915 Bacteria 4963
214 Ga0207693_10039606 3300025915 Bacteria 3712
215 Ga0207660_10003019 3300025917 Bacteria 11014
216 Ga0207660_10061878 3300025917 Bacteria 2696
217 Ga0207660_10117432 3300025917 Bacteria 2011
218 Ga0207657_10000300 3300025919 Bacteria 52449
219 Ga0207649_10007024 3300025920 Bacteria 6116
220 Ga0207652_10002301 3300025921 Bacteria 16191
221 Ga0207646_10006866 3300025922 Bacteria 11692
222 Ga0207646_10008871 3300025922 Bacteria 10015
223 Ga0207646_10008912 3300025922 Bacteria 9991
224 Ga0207646_10048697 3300025922 Bacteria 3798
225 Ga0207646_10166943 3300025922 Bacteria 1987
226 Ga0207646_10192019 3300025922 Bacteria 1844
227 Ga0207646_10461163 3300025922 Bacteria 1146
228 Ga0207681_10147885 3300025923 Bacteria 1757
229 Ga0207681_10216279 3300025923 Bacteria 1480
230 Ga0207650_10055230 3300025925 Bacteria 2948
231 Ga0207659_10215785 3300025926 Bacteria 1540
232 Ga0207706_10004549 3300025933 Bacteria 13018
233 Ga0207706_10035037 3300025933 Bacteria 4465
234 Ga0207665_10040379 3300025939 Bacteria 3113
235 Ga0207691_10156574 3300025940 Bacteria 2001
236 Ga0207689_10000257 3300025942 Bacteria 47544
237 Ga0207689_10020982 3300025942 Bacteria 5490
238 Ga0207661_10297974 3300025944 Bacteria 1445
239 Ga0207679_10000581 3300025945 Bacteria 24412
240 Ga0207667_10002064 3300025949 Bacteria 25183
241 Ga0207651_10148477 3300025960 Bacteria 1821
242 Ga0207712_10117254 3300025961 Bacteria 2008
243 Ga0207712_10493333 3300025961 Bacteria 1046
244 Ga0207658_10107269 3300025986 Bacteria 2201
245 Ga0207677_10259610 3300026023 Bacteria 1415
246 Ga0207703_10026820 3300026035 Bacteria 4538
247 Ga0207703_10049632 3300026035 Bacteria 3393
248 Ga0207639_10029712 3300026041 Bacteria 4004
249 Ga0207678_10004328 3300026067 Bacteria 12745
250 Ga0207708_10106506 3300026075 Bacteria 2174
251 Ga0207702_10001265 3300026078 Bacteria 25469
252 Ga0207648_10008904 3300026089 Bacteria 9662
253 Ga0207648_10019757 3300026089 Bacteria 6079
254 Ga0207648_10022707 3300026089 Bacteria 5629
255 Ga0207648_10062546 3300026089 Bacteria 3245
256 Ga0207648_10226529 3300026089 Bacteria 1662
257 Ga0207676_10038299 3300026095 Bacteria 3658
258 Ga0207676_10148638 3300026095 Bacteria 2015
259 Ga0207674_10012264 3300026116 Bacteria 9585
260 Ga0207675_100004379 3300026118 Bacteria 13652
261 Ga0207675_100081640 3300026118 Bacteria 3032
262 Ga0207675_100317153 3300026118 Bacteria 1521
263 Ga0207698_10426728 3300026142 Bacteria 1274
264 Ga0209995_1004434 3300027471 Bacteria 2245
265 Ga0209970_1002705 3300027614 Bacteria 2995
266 Ga0209983_1002650 3300027665 Bacteria 3879
267 Ga0209588_1002320 3300027671 Bacteria 5152
268 Ga0209971_1000015 3300027682 Bacteria 65578
269 Ga0209966_1000025 3300027695 Bacteria 66143
270 Ga0209998_10000022 3300027717 Bacteria 70281
271 Ga0207428_10000069 3300027907 Bacteria 149507
272 Ga0207428_10000239 3300027907 Bacteria 75249
273 Ga0207428_10217576 3300027907 Bacteria 1433
274 Ga0268266_10511543 3300028379 Bacteria 1147
275 Ga0268265_10012241 3300028380 Bacteria 5811
276 Ga0268265_10053805 3300028380 Unclassified 3051
277 Ga0268265_10058244 3300028380 Bacteria 2948
278 Ga0268265_10621921 3300028380 Unclassified 1035
279 Ga0268264_10004493 3300028381 Bacteria 11900
280 Ga0268264_10058869 3300028381 Bacteria 3218
281 Ga0265327_10033021 3300031251 Bacteria 2890
282 Ga0307408_100015034 3300031548 Bacteria 5150
283 Ga0307410_10156363 3300031852 Bacteria 1703
284 Ga0307410_10260606 3300031852 Bacteria 1352
285 Ga0307410_10275472 3300031852 Bacteria 1318
286 Ga0307406_10029029 3300031901 Bacteria 3346
287 Ga0307412_10528067 3300031911 Bacteria 987
288 Ga0307411_10407129 3300032005 Bacteria 1126
289 Ga0373940_0022276 3300035088 Bacteria 1627
290 Ga0373940_0061036 3300035088 Bacteria 1078
291 Ga0373951_0010045 3300035091 Bacteria 2124
292 Ga0373941_0034739 3300035115 Bacteria 1523
293 Ga0373960_0037917 3300035121 Bacteria 1379
294 Ga0373931_0006893 3300035691 Bacteria 5343
295 Ga0373931_0024199 3300035691 Bacteria 3074
296 Ga0373931_0110432 3300035691 Bacteria 1559
297 Ga0373931_0147285 3300035691 Bacteria 1370
298 Ga0439464_0016622 3300042439 Bacteria 1991
299 Ga0439460_0015514 3300042461 Bacteria 2018
300 Ga0451577_0004804 3300042876 Bacteria 14111
301 Ga0451577_0161525 3300042876 Bacteria 2017
302 Ga0451577_0310392 3300042876 Bacteria 1429
303 Ga0451577_0568138 3300042876 Bacteria 1029
304 Ga0453683_0066450 3300044673 Bacteria 2254
305 Ga0453683_0124624 3300044673 Bacteria 1622
306 Ga0453683_0155328 3300044673 Bacteria 1446
307 Ga0453684_0025661 3300044712 Bacteria 8548
308 Ga0453684_0108408 3300044712 Bacteria 3380
309 Ga0453684_0189450 3300044712 Bacteria 2407
310 Ga0453684_0444782 3300044712 Bacteria 1444
311 Ga0451576_0005302 3300045051 Bacteria 16202
312 Ga0451576_0036561 3300045051 Bacteria 5204
313 Ga0451576_0197529 3300045051 Bacteria 2101
314 Ga0451576_0296933 3300045051 Bacteria 1689
315 Ga0495580_0005263 3300046472 Bacteria 10747
316 Ga0495594_0005474 3300046499 Bacteria 6528
317 Ga0495669_0040220 3300046684 Bacteria 2073
318 Ga0495636_0010991 3300047318 Bacteria 3583
319 Ga0496101_0393451 3300048904 Bacteria 1091
320 Ga0496102_0092677 3300048905 Bacteria 2798
321 Ga0496104_0074022 3300048907 Bacteria 3242
322 Ga0496104_0428173 3300048907 Bacteria 1235
323 Ga0496106_0031145 3300048909 Bacteria 3975
324 Ga0496106_0107268 3300048909 Bacteria 2172
325 Ga0496112_0133055 3300048915 Bacteria 2458
326 Ga0501032_0073821 3300049569 Bacteria 2273
327 Ga0501032_0257589 3300049569 Bacteria 1132
328 Ga0501033_0164095 3300049570 Bacteria 1598
329 Ga0501033_0390363 3300049570 Unclassified 972
330 Ga0501036_0069056 3300049572 Bacteria 2990
331 Ga0501036_0113663 3300049572 Bacteria 2288
332 Ga0501036_0488165 3300049572 Bacteria 1025
333 Ga0501038_0021681 3300049574 Bacteria 5763
334 Ga0501038_0126329 3300049574 Bacteria 2105
335 Ga0501038_0231538 3300049574 Bacteria 1470
336 Ga0501039_0051762 3300049575 Bacteria 3177
337 Ga0501039_0232598 3300049575 Bacteria 1449
338 Ga0501040_0018910 3300049576 Bacteria 4578
339 Ga0501040_0022676 3300049576 Bacteria 4205
340 Ga0501040_0033576 3300049576 Bacteria 3477
341 Ga0501041_0009365 3300049577 Bacteria 5771
342 Ga0501041_0028949 3300049577 Bacteria 3342
343 Ga0501041_0203677 3300049577 Bacteria 1241
344 Ga0501042_0010376 3300049578 Bacteria 6242
345 Ga0501042_0179477 3300049578 Bacteria 1527
346 Ga0501042_0422657 3300049578 Bacteria 966
347 Ga0501046_0000680 3300049580 Bacteria 33002
348 Ga0501046_0018993 3300049580 Bacteria 5706
349 Ga0501046_0173957 3300049580 Unclassified 1614
350 Ga0501047_0011303 3300049581 Bacteria 8451
351 Ga0501048_0003206 3300049582 Bacteria 12467
352 Ga0501067_0034215 3300049583 Bacteria 2820
353 Ga0501069_0098761 3300049585 Bacteria 1656
354 Ga0501070_0143979 3300049586 Bacteria 1968
355 Ga0501071_0249640 3300049587 Bacteria 1339
356 Ga0501072_0054137 3300049588 Bacteria 3161
357 Ga0501074_0003918 3300049590 Bacteria 10603
358 Ga0501074_0043024 3300049590 Bacteria 3269
359 Ga0501074_0246563 3300049590 Unclassified 1270
360 Ga0501075_0016015 3300049591 Bacteria 5393
361 Ga0501075_0038000 3300049591 Bacteria 3599
362 Ga0501075_0072277 3300049591 Bacteria 2608
363 Ga0501076_0015616 3300049592 Bacteria 5743
364 Ga0501076_0027436 3300049592 Bacteria 4417
365 Ga0501076_0038379 3300049592 Bacteria 3760
366 Ga0501076_0146724 3300049592 Unclassified 1918
367 Ga0501076_0355680 3300049592 Bacteria 1203
368 Ga0501077_0003561 3300049593 Bacteria 9361
369 Ga0501077_0024073 3300049593 Bacteria 3864
370 Ga0501077_0053452 3300049593 Bacteria 2564
371 Ga0501079_0004303 3300049741 Bacteria 10568
372 Ga0501079_0015119 3300049741 Bacteria 5886
373 Ga0501079_0034252 3300049741 Bacteria 3907
374 Ga0501079_0142430 3300049741 Unclassified 1867
375 Ga0501079_0249638 3300049741 Unclassified 1387
376 Ga0501079_0457291 3300049741 Bacteria 1002
377 Ga0501080_0014800 3300049742 Bacteria 7184
378 Ga0501080_0075630 3300049742 Bacteria 3132
379 Ga0501081_0008252 3300049743 Bacteria 6760
380 Ga0501081_0045718 3300049743 Bacteria 3007
381 Ga0501081_0050246 3300049743 Bacteria 2873
382 Ga0501081_0131596 3300049743 Bacteria 1787
383 Ga0501083_0029822 3300049744 Bacteria 3749
384 Ga0501083_0173418 3300049744 Bacteria 1409
385 nmdc:mga00v17_64841_c1 3300050491 Bacteria 2252
386 nmdc:mga05p37_121995_c1 3300050507 Bacteria 3201
387 nmdc:mga05p37_139788_c1 3300050507 Unclassified 2967
388 nmdc:mga05p37_162644_c1 3300050507 Bacteria 2725
389 nmdc:mga05p37_204918_c1 3300050507 Bacteria 2387
390 nmdc:mga05p37_227697_c1 3300050507 Unclassified 2247
391 nmdc:mga05p37_269005_c1 3300050507 Bacteria 2037
392 nmdc:mga05p37_29685_c1 3300050507 Bacteria 6672
393 nmdc:mga05p37_3021_c1 3300050507 Bacteria 19531
394 nmdc:mga05p37_42362_c1 3300050507 Bacteria 5594
395 nmdc:mga05p37_7465_c1 3300050507 Bacteria 12892
396 nmdc:mga05p37_867131_c1 3300050507 Unclassified 978
397 nmdc:mga05p37_867852_c1 3300050507 Bacteria 978
398 nmdc:mga05p37_95660_c1 3300050507 Bacteria 3659
399 nmdc:mga09592_132897_c1 3300050508 Bacteria 2142
400 nmdc:mga09592_4014_c1 3300050508 Bacteria 11872
401 nmdc:mga09592_47184_c1 3300050508 Bacteria 3630
402 nmdc:mga09592_542_c1 3300050508 Bacteria 28621
403 nmdc:mga09592_57928_c1 3300050508 Bacteria 3276
404 nmdc:mga09592_83148_c1 3300050508 Bacteria 2729
405 nmdc:mga0qj67_123282_c1 3300050509 Bacteria 2096
406 nmdc:mga0qj67_140277_c1 3300050509 Bacteria 1959
407 nmdc:mga0qj67_166793_c1 3300050509 Unclassified 1788
408 nmdc:mga0qj67_213_c1 3300050509 Bacteria 39502
409 nmdc:mga06r32_142566_c1 3300050510 Bacteria 2373
410 nmdc:mga06r32_2497_c1 3300050510 Bacteria 16458
411 nmdc:mga06r32_257987_c1 3300050510 Bacteria 1731
412 nmdc:mga06r32_5587_c1 3300050510 Bacteria 11314
413 nmdc:mga08y16_13021_c1 3300050511 Bacteria 8754
414 nmdc:mga08y16_5205_c1 3300050511 Bacteria 13585
415 nmdc:mga0n895_13804_c1 3300050512 Bacteria 7306
416 nmdc:mga0n895_18433_c1 3300050512 Bacteria 6460
417 nmdc:mga0n895_3405_c1 3300050512 Bacteria 12810
418 nmdc:mga0n895_50177_c1 3300050512 Bacteria 4090
419 nmdc:mga0n895_612133_c1 3300050512 Bacteria 1091
420 nmdc:mga0rr50_111502_c1 3300050513 Unclassified 2165
421 nmdc:mga0rr50_23414_c1 3300050513 Bacteria 4259
422 nmdc:mga0rr50_4229_c1 3300050513 Bacteria 8396
423 nmdc:mga08x19_36888_c1 3300050514 Bacteria 3099
424 nmdc:mga08x19_50431_c1 3300050514 Bacteria 2671
425 nmdc:mga08x19_93855_c1 3300050514 Bacteria 1983
426 nmdc:mga0a205_102142_c1 3300050515 Unclassified 2766
427 nmdc:mga0a205_114175_c1 3300050515 Bacteria 2599
428 nmdc:mga0a205_127534_c1 3300050515 Bacteria 2444
429 nmdc:mga0a205_171607_c1 3300050515 Bacteria 2065
430 nmdc:mga0a205_196217_c1 3300050515 Bacteria 1910
431 nmdc:mga0a205_25489_c1 3300050515 Bacteria 5635
432 nmdc:mga0a205_376152_c1 3300050515 Bacteria 1286
433 nmdc:mga0a205_48840_c1 3300050515 Bacteria 4084
434 nmdc:mga0a205_6725_c1 3300050515 Bacteria 10396
435 nmdc:mga0a205_7861_c1 3300050515 Bacteria 9688
436 Ga0495601_0373276 3300053077 Bacteria 926
437 Ga0501084_0003240 3300054114 Bacteria 13179
438 Ga0501084_0007501 3300054114 Bacteria 8991
439 Ga0501084_0013151 3300054114 Bacteria 6847
440 Ga0501084_0032496 3300054114 Bacteria 4365
441 Ga0501082_0009043 3300060353 Bacteria 8592
442 Ga0501082_0009540 3300060353 Bacteria 8352
443 Ga0501082_0012960 3300060353 Bacteria 7166
444 Ga0501082_0150190 3300060353 Bacteria 2023
445 Ga0530510_0060658 3300061734 Bacteria 2737
446 Ga0207709_10353173
447 Ga0070676_10004430
448 Ga0070683_100235467
449 Ga0070690_100082038
450 Ga0070690_100168676
451 Ga0070670_100013985
452 Ga0068869_100000855
453 Ga0068869_100007829
454 Ga0068869_100210808
455 Ga0070680_100002977
456 Ga0070682_100002957
457 Ga0068868_100172253
458 Ga0070660_100000943
459 Ga0070689_100025393
460 Ga0070691_10009291
461 Ga0070691_10019722
462 Ga0070691_10036326
463 Ga0070661_100000426
464 Ga0070692_10009577
465 Ga0070692_10023649
466 Ga0070669_100065063
467 Ga0070669_100134698
468 Ga0070669_100523786
469 Ga0070673_100002409
470 Ga0070659_100014481
471 Ga0070667_100205673
472 Ga0070703_10001170
473 Ga0070701_10022033
474 Ga0070701_10024878
475 Ga0070705_100000293
476 Ga0070705_100071857
477 Ga0070705_100080292
478 Ga0070705_100111145
479 Ga0070705_100353019
480 Ga0070700_100080386
481 Ga0070694_100000056
482 Ga0070694_100000282
483 Ga0070694_100010506
484 Ga0070694_100045050
485 Ga0070694_100090065
486 Ga0070708_100018975
487 Ga0070708_100021416
488 Ga0070708_100040895
489 Ga0070708_100204267
490 Ga0070708_100313060
491 Ga0070663_100006993
492 Ga0070662_100127586
493 Ga0070662_100156948
494 Ga0070681_10014685
495 Ga0068867_100062643
496 Ga0070706_100005325
497 Ga0070706_100005793
498 Ga0070706_100024610
499 Ga0070706_100171097
500 Ga0070706_100185289
501 Ga0070706_100188523
502 Ga0070707_100006878
503 Ga0070707_100012451
504 Ga0070707_100200841
505 Ga0070707_100271005
506 Ga0070698_100002035
507 Ga0070698_100011273
508 Ga0070698_100141014
509 Ga0070698_100143024
510 Ga0070698_100272992
511 Ga0070699_100003730
512 Ga0070699_100019685
513 Ga0070699_100029740
514 Ga0070699_100248199
515 Ga0070679_100002904
516 Ga0070679_100026159
517 Ga0070697_100009180
518 Ga0070697_100045483
519 Ga0070697_100071893
520 Ga0070697_100083542
521 Ga0070697_100319361
522 Ga0068853_100000387
523 Ga0070672_100171538
524 Ga0070695_100000877
525 Ga0070695_100003430
526 Ga0070695_100070840
527 Ga0070696_100009469
528 Ga0070696_100011951
529 Ga0070696_100044375
530 Ga0070696_100078951
531 Ga0070693_100000595
532 Ga0070693_100009740
533 Ga0070704_100000716
534 Ga0070704_100005220
535 Ga0070704_100078511
536 Ga0070704_100211841
537 Ga0070704_100327746
538 Ga0068855_100010963
539 Ga0070664_100007171
540 Ga0068857_100133125
541 Ga0068854_100019626
542 Ga0068856_100005709
543 Ga0070702_100225895
544 Ga0068852_100552133
545 Ga0068859_100017491
546 Ga0068859_100129377
547 Ga0068859_100160426
548 Ga0068864_100065933
549 Ga0068866_10039251
550 Ga0068861_100008599
551 Ga0068861_100055250
552 Ga0068863_100003990
553 Ga0068858_100016765
554 Ga0068860_100066529
555 Ga0068862_100010240
556 Ga0068862_100020881
557 Ga0068862_100046214
558 Ga0068862_100169217
559 Ga0081455_10000189
560 Ga0081538_10027064
561 Ga0081540_1052298
562 Ga0081539_10000180
563 Ga0070716_100059757
564 Ga0070712_100073030
565 Ga0097621_100205745
566 Ga0075428_100004038
567 Ga0075428_100010074
568 Ga0075428_100166944
569 Ga0075428_100261070
570 Ga0075428_100455644
571 Ga0075428_100464291
572 Ga0075428_100467717
573 Ga0075430_100004684
574 Ga0075430_100180247
575 Ga0075430_100181073
576 Ga0075431_100001546
577 Ga0075431_100003062
578 Ga0075431_100012139
579 Ga0075431_100014105
580 Ga0075431_100049713
581 Ga0075431_100142629
582 Ga0075431_100678216
583 Ga0075433_10010148
584 Ga0075433_10013298
585 Ga0075433_10018180
586 Ga0075433_10039285
587 Ga0075433_10053299
588 Ga0075433_10146439
589 Ga0075433_10157662
590 Ga0075433_10349300
591 Ga0075434_100000105
592 Ga0075434_100006539
593 Ga0075434_100035283
594 Ga0075434_100061337
595 Ga0075434_100087980
596 Ga0075434_100503139
597 Ga0075429_100000231
598 Ga0075429_100001801
599 Ga0075429_100002072
600 Ga0075429_100021153
601 Ga0075429_100148075
602 Ga0068865_100077302
603 Ga0068865_100219432
604 Ga0097620_100017490
605 Ga0097620_100129378
606 Ga0097620_100160420
607 Ga0075435_100026025
608 Ga0075435_100065129
609 Ga0099794_10003196
610 Ga0099794_10020910
611 Ga0111539_10000139
612 Ga0111539_10000622
613 Ga0111539_10265191
614 Ga0105245_10174457
615 Ga0114129_10003348
616 Ga0114129_10005765
617 Ga0114129_10007755
618 Ga0114129_10017726
619 Ga0114129_10028712
620 Ga0114129_10056086
621 Ga0114129_10183785
622 Ga0114129_10234028
623 Ga0114129_10269579
624 Ga0114129_10300084
625 Ga0114129_10334902
626 Ga0114129_10338736
627 Ga0114129_10418104
628 Ga0105243_10086274
629 Ga0105243_10257622
630 Ga0105241_10003314
631 Ga0105241_10036267
632 Ga0105248_10267839
633 Ga0105249_10078693
634 Ga0105249_10685499
635 Ga0105239_10451375
636 Ga0157373_10001331
637 Ga0157369_10045998
638 Ga0157378_10114348
639 Ga0157372_10000624
640 Ga0157372_10046035
641 Ga0157375_10407955
642 Ga0163163_10013260
643 Ga0157379_10568490
644 Ga0207653_10006658
645 Ga0207688_10038672
646 Ga0207645_10000213
647 Ga0207643_10000553
648 Ga0207684_10003690
649 Ga0207684_10005695
650 Ga0207684_10008507
651 Ga0207684_10015631
652 Ga0207684_10015740
653 Ga0207684_10072294
654 Ga0207684_10102121
655 Ga0207684_10380960
656 Ga0207654_10006160
657 Ga0207707_10002064
658 Ga0207693_10022872
659 Ga0207693_10039606
660 Ga0207660_10003019
661 Ga0207660_10061878
662 Ga0207660_10117432
663 Ga0207657_10000300
664 Ga0207649_10007024
665 Ga0207652_10002301
666 Ga0207646_10006866
667 Ga0207646_10008871
668 Ga0207646_10008912
669 Ga0207646_10048697
670 Ga0207646_10166943
671 Ga0207646_10192019
672 Ga0207646_10461163
673 Ga0207681_10147885
674 Ga0207681_10216279
675 Ga0207650_10055230
676 Ga0207659_10215785
677 Ga0207706_10004549
678 Ga0207706_10035037
679 Ga0207665_10040379
680 Ga0207691_10156574
681 Ga0207689_10000257
682 Ga0207689_10020982
683 Ga0207661_10297974
684 Ga0207679_10000581
685 Ga0207667_10002064
686 Ga0207651_10148477
687 Ga0207712_10117254
688 Ga0207712_10493333
689 Ga0207658_10107269
690 Ga0207677_10259610
691 Ga0207703_10026820
692 Ga0207703_10049632
693 Ga0207639_10029712
694 Ga0207678_10004328
695 Ga0207708_10106506
696 Ga0207702_10001265
697 Ga0207648_10008904
698 Ga0207648_10019757
699 Ga0207648_10022707
700 Ga0207648_10062546
701 Ga0207648_10226529
702 Ga0207676_10038299
703 Ga0207676_10148638
704 Ga0207674_10012264
705 Ga0207675_100004379
706 Ga0207675_100081640
707 Ga0207675_100317153
708 Ga0207698_10426728
709 Ga0209995_1004434
710 Ga0209970_1002705
711 Ga0209983_1002650
712 Ga0209588_1002320
713 Ga0209971_1000015
714 Ga0209966_1000025
715 Ga0209998_10000022
716 Ga0207428_10000069
717 Ga0207428_10000239
718 Ga0207428_10217576
719 Ga0268266_10511543
720 Ga0268265_10012241
721 Ga0268265_10053805
722 Ga0268265_10058244
723 Ga0268265_10621921
724 Ga0268264_10004493
725 Ga0268264_10058869
726 Ga0265327_10033021
727 Ga0307408_100015034
728 Ga0307410_10156363
729 Ga0307410_10260606
730 Ga0307410_10275472
731 Ga0307406_10029029
732 Ga0307412_10528067
733 Ga0307411_10407129
734 Ga0373940_0022276
735 Ga0373940_0061036
736 Ga0373951_0010045
737 Ga0373941_0034739
738 Ga0373960_0037917
739 Ga0373931_0006893
740 Ga0373931_0024199
741 Ga0373931_0110432
742 Ga0373931_0147285
743 Ga0439464_0016622
744 Ga0439460_0015514
745 Ga0451577_0004804
746 Ga0451577_0161525
747 Ga0451577_0310392
748 Ga0451577_0568138
749 Ga0453683_0066450
750 Ga0453683_0124624
751 Ga0453683_0155328
752 Ga0453684_0025661
753 Ga0453684_0108408
754 Ga0453684_0189450
755 Ga0453684_0444782
756 Ga0451576_0005302
757 Ga0451576_0036561
758 Ga0451576_0197529
759 Ga0451576_0296933
760 Ga0495580_0005263
761 Ga0495594_0005474
762 Ga0495669_0040220
763 Ga0495636_0010991
764 Ga0496101_0393451
765 Ga0496102_0092677
766 Ga0496104_0074022
767 Ga0496104_0428173
768 Ga0496106_0031145
769 Ga0496106_0107268
770 Ga0496112_0133055
771 Ga0501032_0073821
772 Ga0501032_0257589
773 Ga0501033_0164095
774 Ga0501033_0390363
775 Ga0501036_0069056
776 Ga0501036_0113663
777 Ga0501036_0488165
778 Ga0501038_0021681
779 Ga0501038_0126329
780 Ga0501038_0231538
781 Ga0501039_0051762
782 Ga0501039_0232598
783 Ga0501040_0018910
784 Ga0501040_0022676
785 Ga0501040_0033576
786 Ga0501041_0009365
787 Ga0501041_0028949
788 Ga0501041_0203677
789 Ga0501042_0010376
790 Ga0501042_0179477
791 Ga0501042_0422657
792 Ga0501046_0000680
793 Ga0501046_0018993
794 Ga0501046_0173957
795 Ga0501047_0011303
796 Ga0501048_0003206
797 Ga0501067_0034215
798 Ga0501069_0098761
799 Ga0501070_0143979
800 Ga0501071_0249640
801 Ga0501072_0054137
802 Ga0501074_0003918
803 Ga0501074_0043024
804 Ga0501074_0246563
805 Ga0501075_0016015
806 Ga0501075_0038000
807 Ga0501075_0072277
808 Ga0501076_0015616
809 Ga0501076_0027436
810 Ga0501076_0038379
811 Ga0501076_0146724
812 Ga0501076_0355680
813 Ga0501077_0003561
814 Ga0501077_0024073
815 Ga0501077_0053452
816 Ga0501079_0004303
817 Ga0501079_0015119
818 Ga0501079_0034252
819 Ga0501079_0142430
820 Ga0501079_0249638
821 Ga0501079_0457291
822 Ga0501080_0014800
823 Ga0501080_0075630
824 Ga0501081_0008252
825 Ga0501081_0045718
826 Ga0501081_0050246
827 Ga0501081_0131596
828 Ga0501083_0029822
829 Ga0501083_0173418
830 nmdc:mga00v17_64841_c1
831 nmdc:mga05p37_121995_c1
832 nmdc:mga05p37_139788_c1
833 nmdc:mga05p37_162644_c1
834 nmdc:mga05p37_204918_c1
835 nmdc:mga05p37_227697_c1
836 nmdc:mga05p37_269005_c1
837 nmdc:mga05p37_29685_c1
838 nmdc:mga05p37_3021_c1
839 nmdc:mga05p37_42362_c1
840 nmdc:mga05p37_7465_c1
841 nmdc:mga05p37_867131_c1
842 nmdc:mga05p37_867852_c1
843 nmdc:mga05p37_95660_c1
844 nmdc:mga09592_132897_c1
845 nmdc:mga09592_4014_c1
846 nmdc:mga09592_47184_c1
847 nmdc:mga09592_542_c1
848 nmdc:mga09592_57928_c1
849 nmdc:mga09592_83148_c1
850 nmdc:mga0qj67_123282_c1
851 nmdc:mga0qj67_140277_c1
852 nmdc:mga0qj67_166793_c1
853 nmdc:mga0qj67_213_c1
854 nmdc:mga06r32_142566_c1
855 nmdc:mga06r32_2497_c1
856 nmdc:mga06r32_257987_c1
857 nmdc:mga06r32_5587_c1
858 nmdc:mga08y16_13021_c1
859 nmdc:mga08y16_5205_c1
860 nmdc:mga0n895_13804_c1
861 nmdc:mga0n895_18433_c1
862 nmdc:mga0n895_3405_c1
863 nmdc:mga0n895_50177_c1
864 nmdc:mga0n895_612133_c1
865 nmdc:mga0rr50_111502_c1
866 nmdc:mga0rr50_23414_c1
867 nmdc:mga0rr50_4229_c1
868 nmdc:mga08x19_36888_c1
869 nmdc:mga08x19_50431_c1
870 nmdc:mga08x19_93855_c1
871 nmdc:mga0a205_102142_c1
872 nmdc:mga0a205_114175_c1
873 nmdc:mga0a205_127534_c1
874 nmdc:mga0a205_171607_c1
875 nmdc:mga0a205_196217_c1
876 nmdc:mga0a205_25489_c1
877 nmdc:mga0a205_376152_c1
878 nmdc:mga0a205_48840_c1
879 nmdc:mga0a205_6725_c1
880 nmdc:mga0a205_7861_c1
881 Ga0495601_0373276
882 Ga0501084_0003240
883 Ga0501084_0007501
884 Ga0501084_0013151
885 Ga0501084_0032496
886 Ga0501082_0009043
887 Ga0501082_0009540
888 Ga0501082_0012960
889 Ga0501082_0150190
890 Ga0530510_0060658

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

1

213

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7k64-assembly2.cif.gz_E binary titrated soak structure of alkanesulfonate monooxygenase msud from pseudomonas fluorescens with fmn 0.8332 3 293
3fgc-assembly2.cif.gz_C crystal structure of the bacterial luciferase:flavin complex reveals the basis of intersubunit communication 0.8329 3 293
1rhc-assembly1.cif.gz_A-2 f420-dependent secondary alcohol dehydrogenase in complex with an f420-acetone adduct 0.8301 1 293
3fgc-assembly1.cif.gz_A crystal structure of the bacterial luciferase:flavin complex reveals the basis of intersubunit communication 0.8295 3 293
1rhc-assembly1.cif.gz_A-2 f420-dependent secondary alcohol dehydrogenase in complex with an f420-acetone adduct 0.8275 1 293
ID Description Score Start End Superfamily
3fgcC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8329 3 293 3.20.20.30
1rhcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8301 1 293 3.20.20.30
1rhcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8275 1 293 3.20.20.30
3fgcC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8251 3 293 3.20.20.30
af_P71701_5_258_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8198 1 283 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A2V7IDH9-F1-model_v4 Luciferase-like domain-containing protein 0.9908 1 167 GO:0008726
GO:0046306
AF-A0A2V7HA50-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9763 61 160 GO:0008726
GO:0046306
AF-A0A2V7HA50-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9576 61 160 GO:0008726
GO:0046306
AF-A0A358A3S5-F1-model_v4 TIGR03854 family LLM class F420-dependent oxidoreductase 0.9353 51 164 GO:0008726
GO:0046306
AF-A0A6B1BA96-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9343 1 293 GO:0008726
GO:0046306

Map