F445464

General Info

Members Datasets Scaffolds Average Seq Length
445 253 880 149

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10001904|Ga0081538_100019042
Length 177
Sequence MTTTTELATQVYQVFIRATPEAIWEAITKPEFTAKYFHGSRVEITPAGRRSIGPDGEVRGDSPVFEFDPPRRLVHGWHSIYDPELAAEEPSRVTWEIEPQNGGFCKLTVTHDQLEGAPKTAESVVGDGWMMVISGLKTVLETGKGLTDRRGPLVGTSARSRPAATPAPAGPASSTAG

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
141 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
142 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
143 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
169 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
170 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
171 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
172 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
173 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
174 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
175 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
176 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
191 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
223 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.61
Metatranscriptomes 5.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.71
Rhizosphere 85.17
Stem 0
Stem Tuber 0
Unclassified 4.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10001904 3300005981 Bacteria 20954
2 JGI25407J50210_10039377 3300003373 Bacteria 1212
3 Ga0058863_11896241 3300004799 Bacteria 885
4 Ga0058862_12817179 3300004803 Bacteria 874
5 Ga0070658_10138098 3300005327 Bacteria 2035
6 Ga0070683_100003840 3300005329 Bacteria 12277
7 Ga0070683_100194858 3300005329 Bacteria 1924
8 Ga0070683_100295171 3300005329 Bacteria 1542
9 Ga0068869_100877700 3300005334 Bacteria 775
10 Ga0070666_10218400 3300005335 Bacteria 1344
11 Ga0070680_100192334 3300005336 Bacteria 1719
12 Ga0070680_100641351 3300005336 Bacteria 913
13 Ga0070682_100334028 3300005337 Bacteria 1124
14 Ga0070682_100829909 3300005337 Unclassified 753
15 Ga0070660_100000845 3300005339 Bacteria 20392
16 Ga0070689_100265146 3300005340 Bacteria 1421
17 Ga0070687_100256033 3300005343 Bacteria 1090
18 Ga0070668_100876339 3300005347 Bacteria 801
19 Ga0070671_100494286 3300005355 Bacteria 1052
20 Ga0070674_100129713 3300005356 Bacteria 1878
21 Ga0070674_100465445 3300005356 Bacteria 1046
22 Ga0070674_100777516 3300005356 Bacteria 825
23 Ga0070659_100215699 3300005366 Bacteria 1583
24 Ga0070703_10319617 3300005406 Bacteria 653
25 Ga0070714_100006626 3300005435 Bacteria 8960
26 Ga0070714_100167373 3300005435 Bacteria 1992
27 Ga0070714_100228972 3300005435 Bacteria 1711
28 Ga0070714_100254778 3300005435 Bacteria 1624
29 Ga0070714_100879264 3300005435 Bacteria 870
30 Ga0070713_100024263 3300005436 Bacteria 4721
31 Ga0070713_100231776 3300005436 Bacteria 1679
32 Ga0070713_100760117 3300005436 Bacteria 928
33 Ga0070701_10304391 3300005438 Bacteria 981
34 Ga0070711_100000341 3300005439 Bacteria 23948
35 Ga0070711_100091316 3300005439 Bacteria 2195
36 Ga0070705_100092859 3300005440 Bacteria 1885
37 Ga0070705_101338595 3300005440 Unclassified 595
38 Ga0070700_100152884 3300005441 Bacteria 1580
39 Ga0070678_100036813 3300005456 Bacteria 3429
40 Ga0070678_101228075 3300005456 Bacteria 696
41 Ga0070662_101105040 3300005457 Bacteria 680
42 Ga0070681_10002222 3300005458 Bacteria 17679
43 Ga0070681_10038733 3300005458 Bacteria 4779
44 Ga0070681_11420515 3300005458 Bacteria 618
45 Ga0068867_100422106 3300005459 Bacteria 1130
46 Ga0068867_101551360 3300005459 Bacteria 618
47 Ga0070706_100553483 3300005467 Bacteria 1070
48 Ga0070706_101663397 3300005467 Bacteria 582
49 Ga0070698_100543853 3300005471 Bacteria 1101
50 Ga0070679_100010278 3300005530 Bacteria 8872
51 Ga0070679_100042124 3300005530 Bacteria 4547
52 Ga0070679_100093182 3300005530 Bacteria 3000
53 Ga0070679_100381242 3300005530 Bacteria 1357
54 Ga0070679_100550141 3300005530 Bacteria 1098
55 Ga0070684_100003093 3300005535 Bacteria 12417
56 Ga0070684_100996023 3300005535 Unclassified 786
57 Ga0070697_100392701 3300005536 Bacteria 1203
58 Ga0068853_100201009 3300005539 Bacteria 1814
59 Ga0068853_100702506 3300005539 Bacteria 965
60 Ga0070672_100210329 3300005543 Bacteria 1629
61 Ga0070686_100640152 3300005544 Bacteria 842
62 Ga0070686_100717960 3300005544 Bacteria 799
63 Ga0070686_100764744 3300005544 Bacteria 776
64 Ga0070696_100041518 3300005546 Bacteria 3178
65 Ga0070693_100246111 3300005547 Bacteria 1183
66 Ga0070693_101369597 3300005547 Bacteria 549
67 Ga0070704_100670577 3300005549 Bacteria 917
68 Ga0068855_100019701 3300005563 Bacteria 8101
69 Ga0068855_100114191 3300005563 Bacteria 3097
70 Ga0070664_100689295 3300005564 Bacteria 951
71 Ga0068857_100002942 3300005577 Bacteria 14031
72 Ga0068854_101831014 3300005578 Bacteria 557
73 Ga0068856_100026501 3300005614 Bacteria 5651
74 Ga0068856_100357205 3300005614 Bacteria 1480
75 Ga0070702_100050348 3300005615 Bacteria 2379
76 Ga0070702_100155360 3300005615 Bacteria 1473
77 Ga0068866_10226123 3300005718 Bacteria 1132
78 Ga0068866_10267307 3300005718 Bacteria 1054
79 Ga0068861_100676762 3300005719 Bacteria 956
80 Ga0068870_10146200 3300005840 Bacteria 1388
81 Ga0068858_101482174 3300005842 Bacteria 669
82 Ga0081455_10030898 3300005937 Bacteria 4858
83 Ga0081538_10000974 3300005981 Bacteria 30620
84 Ga0070717_10011606 3300006028 Bacteria 6698
85 Ga0070716_100713090 3300006173 Bacteria 768
86 Ga0070712_100035628 3300006175 Bacteria 3379
87 Ga0070712_100551884 3300006175 Bacteria 971
88 Ga0097621_100026614 3300006237 Bacteria 4540
89 Ga0068871_100054808 3300006358 Bacteria 3236
90 Ga0075430_101309827 3300006846 Bacteria 596
91 Ga0075429_100312478 3300006880 Bacteria 1376
92 Ga0068865_100224932 3300006881 Bacteria 1469
93 Ga0068865_101103143 3300006881 Unclassified 699
94 Ga0105240_10227767 3300009093 Bacteria 2168
95 Ga0105240_11260334 3300009093 Unclassified 781
96 Ga0111539_10588313 3300009094 Bacteria 1296
97 Ga0111539_11947820 3300009094 Bacteria 681
98 Ga0111539_12672575 3300009094 Bacteria 579
99 Ga0105245_10019002 3300009098 Bacteria 6015
100 Ga0105245_10097455 3300009098 Bacteria 2716
101 Ga0105245_10381619 3300009098 Bacteria 1403
102 Ga0105245_10544135 3300009098 Bacteria 1182
103 Ga0105247_10079894 3300009101 Bacteria 2059
104 Ga0105247_10317301 3300009101 Bacteria 1086
105 Ga0114129_11008321 3300009147 Bacteria 1048
106 Ga0114129_11598024 3300009147 Bacteria 798
107 Ga0105243_10091768 3300009148 Bacteria 2502
108 Ga0105241_10518659 3300009174 Bacteria 1065
109 Ga0105242_10031695 3300009176 Bacteria 4225
110 Ga0105242_10378608 3300009176 Bacteria 1315
111 Ga0105242_10447907 3300009176 Bacteria 1216
112 Ga0105242_12382663 3300009176 Unclassified 576
113 Ga0105248_10033632 3300009177 Bacteria 5728
114 Ga0105237_10054969 3300009545 Bacteria 3988
115 Ga0105238_10010847 3300009551 Bacteria 9158
116 Ga0105238_10360303 3300009551 Bacteria 1444
117 Ga0105238_10452365 3300009551 Bacteria 1281
118 Ga0105238_10986137 3300009551 Bacteria 863
119 Ga0105249_10206433 3300009553 Bacteria 1925
120 Ga0105239_10223145 3300010375 Bacteria 2114
121 Ga0105239_10967779 3300010375 Bacteria 978
122 Ga0105239_12886179 3300010375 Unclassified 561
123 Ga0105246_10009926 3300011119 Bacteria 5875
124 Ga0105246_10640394 3300011119 Bacteria 924
125 Ga0157373_10086126 3300013100 Bacteria 2214
126 Ga0157373_10818163 3300013100 Unclassified 688
127 Ga0157370_10106604 3300013104 Bacteria 2622
128 Ga0157370_10564091 3300013104 Unclassified 1043
129 Ga0157374_10047246 3300013296 Bacteria 3991
130 Ga0157374_10304125 3300013296 Bacteria 1578
131 Ga0157378_10148755 3300013297 Bacteria 2181
132 Ga0157372_10083879 3300013307 Bacteria 3610
133 Ga0157372_10114949 3300013307 Bacteria 3085
134 Ga0157372_10219347 3300013307 Bacteria 2205
135 Ga0157375_10502728 3300013308 Bacteria 1376
136 Ga0157375_10721280 3300013308 Bacteria 1150
137 Ga0157375_10945632 3300013308 Bacteria 1004
138 Ga0163163_10631818 3300014325 Bacteria 1134
139 Ga0157380_10932954 3300014326 Bacteria 897
140 Ga0157379_10067193 3300014968 Bacteria 3205
141 Ga0157379_10867503 3300014968 Bacteria 855
142 Ga0157379_12010646 3300014968 Bacteria 571
143 Ga0157376_10038043 3300014969 Bacteria 3912
144 Ga0157376_10331469 3300014969 Bacteria 1450
145 Ga0163161_10334260 3300017792 Bacteria 1200
146 Ga0197907_10528986 3300020069 Bacteria 798
147 Ga0206356_10381586 3300020070 Bacteria 1158
148 Ga0206356_10964136 3300020070 Bacteria 1490
149 Ga0206356_11774256 3300020070 Bacteria 3272
150 Ga0206354_11446913 3300020081 Bacteria 864
151 Ga0206353_11079783 3300020082 Bacteria 2136
152 Ga0206353_11951601 3300020082 Unclassified 652
153 Ga0224712_10160222 3300022467 Bacteria 1003
154 Ga0224712_10191573 3300022467 Bacteria 926
155 Ga0224712_10432053 3300022467 Unclassified 630
156 Ga0207692_10012797 3300025898 Bacteria 3616
157 Ga0207642_10086775 3300025899 Bacteria 1535
158 Ga0207642_10258318 3300025899 Bacteria 992
159 Ga0207710_10087729 3300025900 Bacteria 1452
160 Ga0207688_10262795 3300025901 Bacteria 1048
161 Ga0207680_10359953 3300025903 Bacteria 1023
162 Ga0207699_10652729 3300025906 Bacteria 768
163 Ga0207643_10078041 3300025908 Bacteria 1915
164 Ga0207705_10517591 3300025909 Bacteria 927
165 Ga0207684_10550298 3300025910 Bacteria 987
166 Ga0207684_10612550 3300025910 Bacteria 929
167 Ga0207654_10508151 3300025911 Bacteria 852
168 Ga0207707_10030395 3300025912 Bacteria 4726
169 Ga0207707_10115266 3300025912 Bacteria 2348
170 Ga0207695_10831296 3300025913 Unclassified 804
171 Ga0207693_10016172 3300025915 Bacteria 5967
172 Ga0207663_10016574 3300025916 Bacteria 4089
173 Ga0207663_10034393 3300025916 Bacteria 3030
174 Ga0207660_10139616 3300025917 Bacteria 1852
175 Ga0207660_10226075 3300025917 Bacteria 1470
176 Ga0207660_10852731 3300025917 Bacteria 743
177 Ga0207662_10378398 3300025918 Bacteria 956
178 Ga0207662_10395305 3300025918 Bacteria 936
179 Ga0207657_10001953 3300025919 Bacteria 22262
180 Ga0207657_11311830 3300025919 Unclassified 546
181 Ga0207649_10589225 3300025920 Bacteria 854
182 Ga0207652_10039250 3300025921 Bacteria 4018
183 Ga0207652_10054129 3300025921 Bacteria 3449
184 Ga0207652_10297969 3300025921 Bacteria 1455
185 Ga0207652_11286074 3300025921 Bacteria 634
186 Ga0207694_10143922 3300025924 Bacteria 1918
187 Ga0207694_10398240 3300025924 Bacteria 1144
188 Ga0207687_10036954 3300025927 Bacteria 3330
189 Ga0207687_10163517 3300025927 Bacteria 1710
190 Ga0207687_10475648 3300025927 Bacteria 1039
191 Ga0207687_10552583 3300025927 Bacteria 966
192 Ga0207687_10650977 3300025927 Bacteria 891
193 Ga0207700_10006711 3300025928 Bacteria 6985
194 Ga0207700_10307604 3300025928 Bacteria 1370
195 Ga0207700_10962037 3300025928 Bacteria 764
196 Ga0207664_10031646 3300025929 Bacteria 4049
197 Ga0207664_10671109 3300025929 Bacteria 932
198 Ga0207664_10879963 3300025929 Bacteria 805
199 Ga0207664_11270036 3300025929 Bacteria 655
200 Ga0207644_10676436 3300025931 Bacteria 860
201 Ga0207644_11238066 3300025931 Bacteria 627
202 Ga0207690_10046631 3300025932 Bacteria 2871
203 Ga0207706_10494661 3300025933 Bacteria 1056
204 Ga0207706_11277142 3300025933 Unclassified 607
205 Ga0207686_10023948 3300025934 Bacteria 3530
206 Ga0207686_10760432 3300025934 Bacteria 774
207 Ga0207670_10221726 3300025936 Bacteria 1448
208 Ga0207669_10095129 3300025937 Bacteria 1952
209 Ga0207669_10391026 3300025937 Bacteria 1086
210 Ga0207669_10531129 3300025937 Bacteria 946
211 Ga0207669_10865846 3300025937 Bacteria 753
212 Ga0207704_10285596 3300025938 Bacteria 1256
213 Ga0207691_10219548 3300025940 Bacteria 1649
214 Ga0207711_10328765 3300025941 Bacteria 1413
215 Ga0207689_11136601 3300025942 Bacteria 658
216 Ga0207661_10006395 3300025944 Bacteria 8334
217 Ga0207661_10054259 3300025944 Bacteria 3211
218 Ga0207661_10303837 3300025944 Bacteria 1431
219 Ga0207679_10586803 3300025945 Bacteria 1003
220 Ga0207667_10065234 3300025949 Bacteria 3798
221 Ga0207667_10386288 3300025949 Bacteria 1426
222 Ga0207712_10366721 3300025961 Bacteria 1201
223 Ga0207712_10537900 3300025961 Bacteria 1003
224 Ga0207712_10879595 3300025961 Bacteria 791
225 Ga0207668_10824699 3300025972 Bacteria 822
226 Ga0207640_10330054 3300025981 Unclassified 1218
227 Ga0207658_10588440 3300025986 Bacteria 999
228 Ga0207677_10787154 3300026023 Bacteria 850
229 Ga0207703_10274265 3300026035 Bacteria 1529
230 Ga0207703_11223567 3300026035 Bacteria 722
231 Ga0207678_10096683 3300026067 Bacteria 2524
232 Ga0207678_10122728 3300026067 Bacteria 2216
233 Ga0207678_10255308 3300026067 Bacteria 1502
234 Ga0207678_11111335 3300026067 Bacteria 700
235 Ga0207708_10177827 3300026075 Bacteria 1688
236 Ga0207702_10018434 3300026078 Bacteria 5774
237 Ga0207702_10428766 3300026078 Bacteria 1280
238 Ga0207702_10740394 3300026078 Bacteria 970
239 Ga0207648_10373871 3300026089 Bacteria 1288
240 Ga0207648_10528919 3300026089 Bacteria 1081
241 Ga0207674_10343106 3300026116 Bacteria 1444
242 Ga0207675_100386423 3300026118 Bacteria 1377
243 Ga0207683_10000518 3300026121 Bacteria 35644
244 Ga0207683_10382715 3300026121 Bacteria 1293
245 Ga0207683_10970809 3300026121 Bacteria 789
246 Ga0207698_10723630 3300026142 Bacteria 992
247 Ga0207698_11698744 3300026142 Bacteria 647
248 Ga0268264_10081588 3300028381 Bacteria 2764
249 Ga0265319_1000887 3300028563 Bacteria 18918
250 Ga0265319_1014705 3300028563 Bacteria 3061
251 Ga0265319_1059455 3300028563 Bacteria 1243
252 Ga0265334_10056939 3300028573 Bacteria 1483
253 Ga0265318_10021119 3300028577 Bacteria 2618
254 Ga0265322_10043517 3300028654 Bacteria 1278
255 Ga0265322_10103127 3300028654 Bacteria 811
256 Ga0265338_10015843 3300028800 Bacteria 8252
257 Ga0265338_10314335 3300028800 Bacteria 1135
258 Ga0265320_10073784 3300031240 Bacteria 1603
259 Ga0265320_10186545 3300031240 Bacteria 928
260 Ga0265340_10089723 3300031247 Bacteria 1438
261 Ga0265327_10024861 3300031251 Bacteria 3506
262 Ga0265316_10067268 3300031344 Bacteria 2770
263 Ga0307408_100408950 3300031548 Bacteria 1167
264 Ga0265314_10005758 3300031711 Bacteria 11118
265 Ga0307413_10019064 3300031824 Bacteria 3615
266 Ga0307410_10087437 3300031852 Bacteria 2204
267 Ga0307406_10059314 3300031901 Bacteria 2463
268 Ga0307406_10392585 3300031901 Bacteria 1097
269 Ga0307412_10245674 3300031911 Bacteria 1387
270 Ga0307409_100233660 3300031995 Bacteria 1668
271 Ga0307409_100998938 3300031995 Bacteria 855
272 Ga0307416_100025382 3300032002 Bacteria 4344
273 Ga0307416_100488132 3300032002 Bacteria 1293
274 Ga0307411_10026933 3300032005 Bacteria 3469
275 Ga0307415_100358470 3300032126 Bacteria 1230
276 Ga0373931_0249427 3300035691 Bacteria 1079
277 Ga0373947_0138300 3300035725 Bacteria 1560
278 Ga0373937_0139436 3300036401 Bacteria 2268
279 Ga0373925_0831156 3300037068 Bacteria 761
280 Ga0395899_0333133 3300037312 Bacteria 1019
281 Ga0395900_0051489 3300037418 Bacteria 4241
282 Ga0395900_0204112 3300037418 Bacteria 1998
283 Ga0395898_0000926 3300037466 Bacteria 46928
284 Ga0395898_0007942 3300037466 Bacteria 11256
285 Ga0436364_0385734 3300037853 Bacteria 815
286 Ga0395901_0172658 3300038443 Bacteria 2268
287 Ga0436363_0039402 3300039450 Bacteria 3016
288 Ga0436363_0995447 3300039450 Bacteria 816
289 Ga0436363_1701558 3300039450 Unclassified 698
290 Ga0451835_0643427 3300041492 Unclassified 539
291 Ga0439448_0083727 3300042005 Bacteria 1073
292 Ga0439450_027122 3300042008 Bacteria 1267
293 Ga0439454_071765 3300042011 Bacteria 616
294 Ga0439434_0025273 3300042435 Bacteria 1792
295 Ga0439444_0138451 3300042437 Bacteria 580
296 Ga0439464_0011514 3300042439 Bacteria 2344
297 Ga0439440_0052990 3300042993 Bacteria 1018
298 Ga0466963_0001910 3300044694 Bacteria 11404
299 Ga0466963_0038102 3300044694 Bacteria 3143
300 Ga0466963_1175023 3300044694 Bacteria 539
301 Ga0466964_0025926 3300044706 Bacteria 2291
302 Ga0466959_0504283 3300045049 Bacteria 818
303 Ga0466967_0002685 3300045976 Bacteria 11235
304 Ga0466967_0009462 3300045976 Bacteria 7231
305 Ga0466967_0027879 3300045976 Bacteria 4705
306 Ga0466967_0089566 3300045976 Bacteria 2794
307 Ga0466967_0190878 3300045976 Bacteria 1936
308 Ga0466967_0241716 3300045976 Bacteria 1722
309 Ga0466967_0254768 3300045976 Bacteria 1677
310 Ga0466967_0916011 3300045976 Bacteria 872
311 Ga0466967_1690444 3300045976 Bacteria 630
312 Ga0466967_2485102 3300045976 Bacteria 513
313 Ga0495603_0727591 3300046455 Bacteria 567
314 Ga0495629_0250142 3300046459 Bacteria 1220
315 Ga0495651_0133482 3300046462 Bacteria 1810
316 Ga0495653_0533222 3300046463 Bacteria 728
317 Ga0495582_0537157 3300046473 Bacteria 676
318 Ga0495628_0152707 3300046516 Bacteria 1758
319 Ga0495652_0069347 3300046529 Bacteria 2952
320 Ga0495645_0352257 3300046543 Bacteria 948
321 Ga0495635_0620292 3300046663 Bacteria 705
322 Ga0495657_0371046 3300046675 Bacteria 845
323 Ga0495599_0378314 3300046678 Bacteria 846
324 Ga0495613_0614748 3300046689 Bacteria 722
325 Ga0495604_0448733 3300047317 Bacteria 843
326 Ga0495674_0015228 3300047319 Bacteria 7193
327 Ga0495674_0029473 3300047319 Bacteria 4997
328 Ga0495680_0160838 3300047322 Bacteria 1631
329 Ga0495602_0168832 3300048088 Bacteria 1700
330 Ga0496100_0001249 3300048903 Bacteria 12387
331 Ga0496100_0010312 3300048903 Bacteria 5287
332 Ga0496101_0003908 3300048904 Bacteria 9312
333 Ga0496101_0008872 3300048904 Bacteria 6583
334 Ga0496101_0188173 3300048904 Bacteria 1592
335 Ga0496101_0579168 3300048904 Bacteria 887
336 Ga0496102_0001864 3300048905 Bacteria 18168
337 Ga0496102_0017630 3300048905 Bacteria 6258
338 Ga0496102_0088354 3300048905 Bacteria 2865
339 Ga0496102_0416162 3300048905 Bacteria 1262
340 Ga0496102_0483553 3300048905 Bacteria 1160
341 Ga0496102_0510929 3300048905 Unclassified 1124
342 Ga0496103_0098806 3300048906 Bacteria 1846
343 Ga0496103_0194826 3300048906 Bacteria 1303
344 Ga0496103_0473505 3300048906 Bacteria 802
345 Ga0496103_0505174 3300048906 Bacteria 773
346 Ga0496104_0000288 3300048907 Bacteria 44366
347 Ga0496104_0090806 3300048907 Bacteria 2919
348 Ga0496104_0101361 3300048907 Bacteria 2756
349 Ga0496104_0117844 3300048907 Bacteria 2548
350 Ga0496105_0000133 3300048908 Bacteria 49866
351 Ga0496105_0038097 3300048908 Bacteria 3961
352 Ga0496105_0361743 3300048908 Bacteria 1157
353 Ga0496105_0623901 3300048908 Bacteria 834
354 Ga0496106_0000903 3300048909 Bacteria 21668
355 Ga0496106_0015743 3300048909 Bacteria 5594
356 Ga0496106_0020763 3300048909 Bacteria 4874
357 Ga0496106_0143011 3300048909 Bacteria 1882
358 Ga0496107_0012837 3300048910 Bacteria 5853
359 Ga0496107_0023955 3300048910 Bacteria 4315
360 Ga0496107_0057053 3300048910 Bacteria 2822
361 Ga0496107_0857514 3300048910 Bacteria 663
362 Ga0496108_0010504 3300048911 Bacteria 7521
363 Ga0496108_0015581 3300048911 Bacteria 6201
364 Ga0496108_1218961 3300048911 Bacteria 636
365 Ga0496108_1404823 3300048911 Bacteria 584
366 Ga0496108_1606984 3300048911 Bacteria 538
367 Ga0496109_0020759 3300048912 Bacteria 5801
368 Ga0496109_0031926 3300048912 Bacteria 4730
369 Ga0496109_0368480 3300048912 Bacteria 1357
370 Ga0496110_0002795 3300048913 Bacteria 13174
371 Ga0496110_0191472 3300048913 Bacteria 1857
372 Ga0496110_1861983 3300048913 Bacteria 512
373 Ga0496111_0017069 3300048914 Bacteria 5011
374 Ga0496112_0016684 3300048915 Bacteria 6885
375 Ga0496112_0247334 3300048915 Bacteria 1735
376 Ga0496112_0430539 3300048915 Bacteria 1258
377 Ga0496113_0094316 3300048916 Bacteria 2312
378 Ga0496114_0032894 3300048917 Bacteria 4271
379 Ga0496114_0109000 3300048917 Bacteria 2371
380 Ga0496114_0362385 3300048917 Bacteria 1282
381 Ga0496114_0395775 3300048917 Bacteria 1223
382 Ga0496114_0723742 3300048917 Bacteria 871
383 Ga0496114_0839960 3300048917 Bacteria 798
384 Ga0496114_0949849 3300048917 Bacteria 742
385 Ga0496115_0000494 3300048918 Bacteria 31060
386 Ga0496115_0002965 3300048918 Bacteria 12203
387 Ga0496115_0670081 3300048918 Bacteria 818
388 Ga0501291_157307 3300049514 Unclassified 517
389 Ga0501032_0622992 3300049569 Bacteria 686
390 Ga0501034_0166501 3300049571 Bacteria 2173
391 Ga0501036_0095155 3300049572 Bacteria 2518
392 Ga0501039_0173498 3300049575 Bacteria 1695
393 Ga0501040_0059134 3300049576 Bacteria 2633
394 Ga0501041_0620452 3300049577 Bacteria 690
395 Ga0501046_0181078 3300049580 Bacteria 1576
396 Ga0501046_0251414 3300049580 Bacteria 1301
397 Ga0501046_0530732 3300049580 Bacteria 841
398 Ga0501047_0083724 3300049581 Bacteria 3066
399 Ga0501047_0101998 3300049581 Bacteria 2749
400 Ga0501067_0172417 3300049583 Bacteria 1205
401 Ga0501067_0299955 3300049583 Bacteria 894
402 Ga0501069_0021224 3300049585 Bacteria 3523
403 Ga0501070_0239401 3300049586 Bacteria 1486
404 Ga0501072_0516059 3300049588 Bacteria 945
405 Ga0501073_0279146 3300049589 Bacteria 1153
406 Ga0501074_0317469 3300049590 Bacteria 1106
407 Ga0501075_0029147 3300049591 Bacteria 4081
408 Ga0501075_0056377 3300049591 Bacteria 2958
409 Ga0501076_1295061 3300049592 Bacteria 599
410 Ga0501080_0058445 3300049742 Bacteria 3590
411 Ga0501080_0190454 3300049742 Bacteria 1885
412 Ga0501080_1107343 3300049742 Bacteria 683
413 Ga0501081_1187677 3300049743 Unclassified 578
414 Ga0501044_0969490 3300049823 Bacteria 723
415 Ga0501045_0215414 3300049824 Bacteria 1430
416 Ga0501045_0679820 3300049824 Bacteria 760
417 nmdc:mga05p37_1637099_c1 3300050507 Bacteria 632
418 nmdc:mga09592_108546_c1 3300050508 Bacteria 2380
419 nmdc:mga06r32_700315_c1 3300050510 Bacteria 979
420 nmdc:mga08y16_1628874_c1 3300050511 Bacteria 602
421 nmdc:mga08y16_506827_c1 3300050511 Bacteria 1225
422 Ga0495601_0086904 3300053077 Bacteria 2010
423 Ga0495601_0324552 3300053077 Bacteria 1002
424 Ga0501084_0040586 3300054114 Bacteria 3894
425 Ga0587066_015469 3300059490 Bacteria 1187
426 Ga0587070_024056 3300059491 Bacteria 1051
427 Ga0587077_079467 3300059493 Bacteria 749
428 Ga0587083_0051770 3300059505 Bacteria 898
429 Ga0587090_032457 3300059510 Bacteria 880
430 Ga0587091_033354 3300059511 Bacteria 978
431 Ga0587106_021717 3300059605 Bacteria 958
432 Ga0587115_019866 3300059626 Bacteria 928
433 Ga0587067_060758 3300059640 Bacteria 791
434 Ga0587068_028322 3300059641 Bacteria 958
435 Ga0587069_024914 3300059642 Bacteria 927
436 Ga0587079_016317 3300059647 Bacteria 1273
437 Ga0501082_0179218 3300060353 Bacteria 1843
438 Ga0530510_0193122 3300061734 Bacteria 1511
439 Ga0530510_0231936 3300061734 Bacteria 1373
440 Ga0530510_0248275 3300061734 Bacteria 1326
441 Ga0081538_10001904
442 JGI25407J50210_10039377
443 Ga0058863_11896241
444 Ga0058862_12817179
445 Ga0070658_10138098
446 Ga0070683_100003840
447 Ga0070683_100194858
448 Ga0070683_100295171
449 Ga0068869_100877700
450 Ga0070666_10218400
451 Ga0070680_100192334
452 Ga0070680_100641351
453 Ga0070682_100334028
454 Ga0070682_100829909
455 Ga0070660_100000845
456 Ga0070689_100265146
457 Ga0070687_100256033
458 Ga0070668_100876339
459 Ga0070671_100494286
460 Ga0070674_100129713
461 Ga0070674_100465445
462 Ga0070674_100777516
463 Ga0070659_100215699
464 Ga0070703_10319617
465 Ga0070714_100006626
466 Ga0070714_100167373
467 Ga0070714_100228972
468 Ga0070714_100254778
469 Ga0070714_100879264
470 Ga0070713_100024263
471 Ga0070713_100231776
472 Ga0070713_100760117
473 Ga0070701_10304391
474 Ga0070711_100000341
475 Ga0070711_100091316
476 Ga0070705_100092859
477 Ga0070705_101338595
478 Ga0070700_100152884
479 Ga0070678_100036813
480 Ga0070678_101228075
481 Ga0070662_101105040
482 Ga0070681_10002222
483 Ga0070681_10038733
484 Ga0070681_11420515
485 Ga0068867_100422106
486 Ga0068867_101551360
487 Ga0070706_100553483
488 Ga0070706_101663397
489 Ga0070698_100543853
490 Ga0070679_100010278
491 Ga0070679_100042124
492 Ga0070679_100093182
493 Ga0070679_100381242
494 Ga0070679_100550141
495 Ga0070684_100003093
496 Ga0070684_100996023
497 Ga0070697_100392701
498 Ga0068853_100201009
499 Ga0068853_100702506
500 Ga0070672_100210329
501 Ga0070686_100640152
502 Ga0070686_100717960
503 Ga0070686_100764744
504 Ga0070696_100041518
505 Ga0070693_100246111
506 Ga0070693_101369597
507 Ga0070704_100670577
508 Ga0068855_100019701
509 Ga0068855_100114191
510 Ga0070664_100689295
511 Ga0068857_100002942
512 Ga0068854_101831014
513 Ga0068856_100026501
514 Ga0068856_100357205
515 Ga0070702_100050348
516 Ga0070702_100155360
517 Ga0068866_10226123
518 Ga0068866_10267307
519 Ga0068861_100676762
520 Ga0068870_10146200
521 Ga0068858_101482174
522 Ga0081455_10030898
523 Ga0081538_10000974
524 Ga0070717_10011606
525 Ga0070716_100713090
526 Ga0070712_100035628
527 Ga0070712_100551884
528 Ga0097621_100026614
529 Ga0068871_100054808
530 Ga0075430_101309827
531 Ga0075429_100312478
532 Ga0068865_100224932
533 Ga0068865_101103143
534 Ga0105240_10227767
535 Ga0105240_11260334
536 Ga0111539_10588313
537 Ga0111539_11947820
538 Ga0111539_12672575
539 Ga0105245_10019002
540 Ga0105245_10097455
541 Ga0105245_10381619
542 Ga0105245_10544135
543 Ga0105247_10079894
544 Ga0105247_10317301
545 Ga0114129_11008321
546 Ga0114129_11598024
547 Ga0105243_10091768
548 Ga0105241_10518659
549 Ga0105242_10031695
550 Ga0105242_10378608
551 Ga0105242_10447907
552 Ga0105242_12382663
553 Ga0105248_10033632
554 Ga0105237_10054969
555 Ga0105238_10010847
556 Ga0105238_10360303
557 Ga0105238_10452365
558 Ga0105238_10986137
559 Ga0105249_10206433
560 Ga0105239_10223145
561 Ga0105239_10967779
562 Ga0105239_12886179
563 Ga0105246_10009926
564 Ga0105246_10640394
565 Ga0157373_10086126
566 Ga0157373_10818163
567 Ga0157370_10106604
568 Ga0157370_10564091
569 Ga0157374_10047246
570 Ga0157374_10304125
571 Ga0157378_10148755
572 Ga0157372_10083879
573 Ga0157372_10114949
574 Ga0157372_10219347
575 Ga0157375_10502728
576 Ga0157375_10721280
577 Ga0157375_10945632
578 Ga0163163_10631818
579 Ga0157380_10932954
580 Ga0157379_10067193
581 Ga0157379_10867503
582 Ga0157379_12010646
583 Ga0157376_10038043
584 Ga0157376_10331469
585 Ga0163161_10334260
586 Ga0197907_10528986
587 Ga0206356_10381586
588 Ga0206356_10964136
589 Ga0206356_11774256
590 Ga0206354_11446913
591 Ga0206353_11079783
592 Ga0206353_11951601
593 Ga0224712_10160222
594 Ga0224712_10191573
595 Ga0224712_10432053
596 Ga0207692_10012797
597 Ga0207642_10086775
598 Ga0207642_10258318
599 Ga0207710_10087729
600 Ga0207688_10262795
601 Ga0207680_10359953
602 Ga0207699_10652729
603 Ga0207643_10078041
604 Ga0207705_10517591
605 Ga0207684_10550298
606 Ga0207684_10612550
607 Ga0207654_10508151
608 Ga0207707_10030395
609 Ga0207707_10115266
610 Ga0207695_10831296
611 Ga0207693_10016172
612 Ga0207663_10016574
613 Ga0207663_10034393
614 Ga0207660_10139616
615 Ga0207660_10226075
616 Ga0207660_10852731
617 Ga0207662_10378398
618 Ga0207662_10395305
619 Ga0207657_10001953
620 Ga0207657_11311830
621 Ga0207649_10589225
622 Ga0207652_10039250
623 Ga0207652_10054129
624 Ga0207652_10297969
625 Ga0207652_11286074
626 Ga0207694_10143922
627 Ga0207694_10398240
628 Ga0207687_10036954
629 Ga0207687_10163517
630 Ga0207687_10475648
631 Ga0207687_10552583
632 Ga0207687_10650977
633 Ga0207700_10006711
634 Ga0207700_10307604
635 Ga0207700_10962037
636 Ga0207664_10031646
637 Ga0207664_10671109
638 Ga0207664_10879963
639 Ga0207664_11270036
640 Ga0207644_10676436
641 Ga0207644_11238066
642 Ga0207690_10046631
643 Ga0207706_10494661
644 Ga0207706_11277142
645 Ga0207686_10023948
646 Ga0207686_10760432
647 Ga0207670_10221726
648 Ga0207669_10095129
649 Ga0207669_10391026
650 Ga0207669_10531129
651 Ga0207669_10865846
652 Ga0207704_10285596
653 Ga0207691_10219548
654 Ga0207711_10328765
655 Ga0207689_11136601
656 Ga0207661_10006395
657 Ga0207661_10054259
658 Ga0207661_10303837
659 Ga0207679_10586803
660 Ga0207667_10065234
661 Ga0207667_10386288
662 Ga0207712_10366721
663 Ga0207712_10537900
664 Ga0207712_10879595
665 Ga0207668_10824699
666 Ga0207640_10330054
667 Ga0207658_10588440
668 Ga0207677_10787154
669 Ga0207703_10274265
670 Ga0207703_11223567
671 Ga0207678_10096683
672 Ga0207678_10122728
673 Ga0207678_10255308
674 Ga0207678_11111335
675 Ga0207708_10177827
676 Ga0207702_10018434
677 Ga0207702_10428766
678 Ga0207702_10740394
679 Ga0207648_10373871
680 Ga0207648_10528919
681 Ga0207674_10343106
682 Ga0207675_100386423
683 Ga0207683_10000518
684 Ga0207683_10382715
685 Ga0207683_10970809
686 Ga0207698_10723630
687 Ga0207698_11698744
688 Ga0268264_10081588
689 Ga0265319_1000887
690 Ga0265319_1014705
691 Ga0265319_1059455
692 Ga0265334_10056939
693 Ga0265318_10021119
694 Ga0265322_10043517
695 Ga0265322_10103127
696 Ga0265338_10015843
697 Ga0265338_10314335
698 Ga0265320_10073784
699 Ga0265320_10186545
700 Ga0265340_10089723
701 Ga0265327_10024861
702 Ga0265316_10067268
703 Ga0307408_100408950
704 Ga0265314_10005758
705 Ga0307413_10019064
706 Ga0307410_10087437
707 Ga0307406_10059314
708 Ga0307406_10392585
709 Ga0307412_10245674
710 Ga0307409_100233660
711 Ga0307409_100998938
712 Ga0307416_100025382
713 Ga0307416_100488132
714 Ga0307411_10026933
715 Ga0307415_100358470
716 Ga0373931_0249427
717 Ga0373947_0138300
718 Ga0373937_0139436
719 Ga0373925_0831156
720 Ga0395899_0333133
721 Ga0395900_0051489
722 Ga0395900_0204112
723 Ga0395898_0000926
724 Ga0395898_0007942
725 Ga0436364_0385734
726 Ga0395901_0172658
727 Ga0436363_0039402
728 Ga0436363_0995447
729 Ga0436363_1701558
730 Ga0451835_0643427
731 Ga0439448_0083727
732 Ga0439450_027122
733 Ga0439454_071765
734 Ga0439434_0025273
735 Ga0439444_0138451
736 Ga0439464_0011514
737 Ga0439440_0052990
738 Ga0466963_0001910
739 Ga0466963_0038102
740 Ga0466963_1175023
741 Ga0466964_0025926
742 Ga0466959_0504283
743 Ga0466967_0002685
744 Ga0466967_0009462
745 Ga0466967_0027879
746 Ga0466967_0089566
747 Ga0466967_0190878
748 Ga0466967_0241716
749 Ga0466967_0254768
750 Ga0466967_0916011
751 Ga0466967_1690444
752 Ga0466967_2485102
753 Ga0495603_0727591
754 Ga0495629_0250142
755 Ga0495651_0133482
756 Ga0495653_0533222
757 Ga0495582_0537157
758 Ga0495628_0152707
759 Ga0495652_0069347
760 Ga0495645_0352257
761 Ga0495635_0620292
762 Ga0495657_0371046
763 Ga0495599_0378314
764 Ga0495613_0614748
765 Ga0495604_0448733
766 Ga0495674_0015228
767 Ga0495674_0029473
768 Ga0495680_0160838
769 Ga0495602_0168832
770 Ga0496100_0001249
771 Ga0496100_0010312
772 Ga0496101_0003908
773 Ga0496101_0008872
774 Ga0496101_0188173
775 Ga0496101_0579168
776 Ga0496102_0001864
777 Ga0496102_0017630
778 Ga0496102_0088354
779 Ga0496102_0416162
780 Ga0496102_0483553
781 Ga0496102_0510929
782 Ga0496103_0098806
783 Ga0496103_0194826
784 Ga0496103_0473505
785 Ga0496103_0505174
786 Ga0496104_0000288
787 Ga0496104_0090806
788 Ga0496104_0101361
789 Ga0496104_0117844
790 Ga0496105_0000133
791 Ga0496105_0038097
792 Ga0496105_0361743
793 Ga0496105_0623901
794 Ga0496106_0000903
795 Ga0496106_0015743
796 Ga0496106_0020763
797 Ga0496106_0143011
798 Ga0496107_0012837
799 Ga0496107_0023955
800 Ga0496107_0057053
801 Ga0496107_0857514
802 Ga0496108_0010504
803 Ga0496108_0015581
804 Ga0496108_1218961
805 Ga0496108_1404823
806 Ga0496108_1606984
807 Ga0496109_0020759
808 Ga0496109_0031926
809 Ga0496109_0368480
810 Ga0496110_0002795
811 Ga0496110_0191472
812 Ga0496110_1861983
813 Ga0496111_0017069
814 Ga0496112_0016684
815 Ga0496112_0247334
816 Ga0496112_0430539
817 Ga0496113_0094316
818 Ga0496114_0032894
819 Ga0496114_0109000
820 Ga0496114_0362385
821 Ga0496114_0395775
822 Ga0496114_0723742
823 Ga0496114_0839960
824 Ga0496114_0949849
825 Ga0496115_0000494
826 Ga0496115_0002965
827 Ga0496115_0670081
828 Ga0501291_157307
829 Ga0501032_0622992
830 Ga0501034_0166501
831 Ga0501036_0095155
832 Ga0501039_0173498
833 Ga0501040_0059134
834 Ga0501041_0620452
835 Ga0501046_0181078
836 Ga0501046_0251414
837 Ga0501046_0530732
838 Ga0501047_0083724
839 Ga0501047_0101998
840 Ga0501067_0172417
841 Ga0501067_0299955
842 Ga0501069_0021224
843 Ga0501070_0239401
844 Ga0501072_0516059
845 Ga0501073_0279146
846 Ga0501074_0317469
847 Ga0501075_0029147
848 Ga0501075_0056377
849 Ga0501076_1295061
850 Ga0501080_0058445
851 Ga0501080_0190454
852 Ga0501080_1107343
853 Ga0501081_1187677
854 Ga0501044_0969490
855 Ga0501045_0215414
856 Ga0501045_0679820
857 nmdc:mga05p37_1637099_c1
858 nmdc:mga09592_108546_c1
859 nmdc:mga06r32_700315_c1
860 nmdc:mga08y16_1628874_c1
861 nmdc:mga08y16_506827_c1
862 Ga0495601_0086904
863 Ga0495601_0324552
864 Ga0501084_0040586
865 Ga0587066_015469
866 Ga0587070_024056
867 Ga0587077_079467
868 Ga0587083_0051770
869 Ga0587090_032457
870 Ga0587091_033354
871 Ga0587106_021717
872 Ga0587115_019866
873 Ga0587067_060758
874 Ga0587068_028322
875 Ga0587069_024914
876 Ga0587079_016317
877 Ga0501082_0179218
878 Ga0530510_0193122
879 Ga0530510_0231936
880 Ga0530510_0248275

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

17

141

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.8232 7 144
4fpw-assembly3.cif.gz_B crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.8146 9 145
4fpw-assembly3.cif.gz_A crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.811 9 143
8es5-assembly1.cif.gz_B aha1 domain protein from pseudomonas aeruginosa 0.7978 9 143
3q6a-assembly1.cif.gz_A x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.7968 9 145
ID Description Score Start End Superfamily
af_Q9V9Q4_218_347_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8004 9 140 3.30.530.20
af_Q4E5D5_198_328_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.799 8 140 3.30.530.20
2luzA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7899 9 144 3.30.530.20
3q6aA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7854 11 145 3.30.530.20
4fpwA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.784 9 138 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A1E4PBZ2-F1-model_v4 deleted 0.9952 8 140
AF-A0A5M3VU97-F1-model_v4 ATPase 0.9932 14 145
AF-A0A538JWT0-F1-model_v4 ATPase 0.9825 4 145
AF-A0A5P9QEV8-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.982 6 145
AF-A0A5M3VU97-F1-model_v4 ATPase 0.9712 14 145

Map