F445458

General Info

Members Datasets Scaffolds Average Seq Length
445 239 890 192

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100642598|Ga0070665_1006425982
Length 231
Sequence VGAGGGGPAANRPPEAFVDDSPMNERQRDDRIPPSKLAVHASAVRSAAPASREEDRALIDRCRRGDAAAFEQLYRAHAGKLFSLTCRMVGHTPEAEDLLQDIFLVAHRKLDSFRGEAALGTWLYRLASNLCLDHLRSRAARTSQVTDSLGDAEPRLQDTGSRNLAERTVSKMDLERAIAQLPVGCRTAFVLHDVEGLEHGEVAEVMGIAEGTSKSQVHKARIRLRALLGGR

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
141 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
142 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
148 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
149 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
150 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
151 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
152 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
153 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
154 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
155 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
156 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
157 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
158 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
165 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
166 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
167 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
168 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
172 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
173 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
174 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
191 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
203 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
208 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
209 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
210 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
216 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
220 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
221 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
229 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
235 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
236 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
237 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.8
Nodule 0
Rhizoplane 4.72
Rhizosphere 93.48
Stem 0
Stem Tuber 0
Unclassified 21.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100642598 3300005548 Unclassified 1074
2 2214786057 2209111006 Bacteria 747
3 Ga0065712_10074785 3300005290 Bacteria 4010
4 Ga0065715_10048383 3300005293 Bacteria 1107
5 Ga0065715_10173758 3300005293 Bacteria 1527
6 Ga0065715_10208986 3300005293 Unclassified 1292
7 Ga0065715_10264094 3300005293 Bacteria 1129
8 Ga0065707_10032015 3300005295 Bacteria 1259
9 Ga0065707_10374446 3300005295 Bacteria 885
10 Ga0070658_10329648 3300005327 Bacteria 1304
11 Ga0070676_10144066 3300005328 Bacteria 1519
12 Ga0070676_10150747 3300005328 Bacteria 1488
13 Ga0070683_100000670 3300005329 Bacteria 24794
14 Ga0070670_100002296 3300005331 Bacteria 15758
15 Ga0070670_100003090 3300005331 Bacteria 13772
16 Ga0070670_100004654 3300005331 Bacteria 11512
17 Ga0070670_100068029 3300005331 Bacteria 3056
18 Ga0070677_10053195 3300005333 Bacteria 1645
19 Ga0068869_100025749 3300005334 Bacteria 4088
20 Ga0068869_100089480 3300005334 Unclassified 2312
21 Ga0070666_10048375 3300005335 Bacteria 2857
22 Ga0070666_10208267 3300005335 Bacteria 1377
23 Ga0068868_100311574 3300005338 Bacteria 1339
24 Ga0070689_100396231 3300005340 Bacteria 1166
25 Ga0070689_101421106 3300005340 Unclassified 627
26 Ga0070687_100117810 3300005343 Unclassified 1514
27 Ga0070661_100619519 3300005344 Unclassified 876
28 Ga0070669_100000449 3300005353 Bacteria 31407
29 Ga0070675_100055464 3300005354 Bacteria 3262
30 Ga0070675_100061139 3300005354 Unclassified 3110
31 Ga0070675_100522919 3300005354 Bacteria 1071
32 Ga0070671_100061632 3300005355 Bacteria 3124
33 Ga0070671_100077271 3300005355 Bacteria 2782
34 Ga0070671_100730358 3300005355 Unclassified 860
35 Ga0070674_100024454 3300005356 Bacteria 3920
36 Ga0070674_100029202 3300005356 Bacteria 3629
37 Ga0070674_100642522 3300005356 Unclassified 901
38 Ga0070673_100024294 3300005364 Bacteria 4441
39 Ga0070673_100093886 3300005364 Bacteria 2458
40 Ga0070688_100173455 3300005365 Bacteria 1490
41 Ga0070659_100711559 3300005366 Unclassified 869
42 Ga0070667_100057408 3300005367 Bacteria 3290
43 Ga0070667_100106655 3300005367 Bacteria 2425
44 Ga0070667_100476109 3300005367 Bacteria 1143
45 Ga0070711_100079958 3300005439 Bacteria 2326
46 Ga0070700_100050708 3300005441 Bacteria 2580
47 Ga0070700_100362057 3300005441 Unclassified 1079
48 Ga0070694_100608425 3300005444 Bacteria 881
49 Ga0070663_100670702 3300005455 Unclassified 879
50 Ga0070678_100046798 3300005456 Bacteria 3105
51 Ga0070678_100257580 3300005456 Bacteria 1466
52 Ga0070662_100087639 3300005457 Bacteria 2331
53 Ga0070662_100122545 3300005457 Unclassified 1994
54 Ga0070662_100148892 3300005457 Bacteria 1820
55 Ga0068867_100015355 3300005459 Bacteria 5430
56 Ga0070679_100111337 3300005530 Bacteria 2724
57 Ga0070684_100000191 3300005535 Bacteria 42600
58 Ga0070684_100684862 3300005535 Bacteria 955
59 Ga0070672_100032915 3300005543 Bacteria 3920
60 Ga0070672_100051259 3300005543 Bacteria 3217
61 Ga0070695_100351866 3300005545 Bacteria 1104
62 Ga0070693_100239817 3300005547 Bacteria 1197
63 Ga0070665_100204681 3300005548 Bacteria 1974
64 Ga0070665_100588509 3300005548 Unclassified 1126
65 Ga0070704_100131625 3300005549 Bacteria 1940
66 Ga0070704_100909079 3300005549 Unclassified 792
67 Ga0068855_100412234 3300005563 Bacteria 1479
68 Ga0070664_100000081 3300005564 Bacteria 60323
69 Ga0070664_100069087 3300005564 Bacteria 3022
70 Ga0070664_100481544 3300005564 Bacteria 1142
71 Ga0068854_100192808 3300005578 Bacteria 1597
72 Ga0068856_100655562 3300005614 Bacteria 1070
73 Ga0070702_100149496 3300005615 Unclassified 1497
74 Ga0068852_100396532 3300005616 Bacteria 1357
75 Ga0068852_100832621 3300005616 Bacteria 938
76 Ga0068859_100430740 3300005617 Bacteria 1415
77 Ga0068859_100570646 3300005617 Bacteria 1225
78 Ga0068864_100282274 3300005618 Bacteria 1550
79 Ga0068864_100829388 3300005618 Bacteria 910
80 Ga0068851_10125984 3300005834 Bacteria 1381
81 Ga0068870_10063416 3300005840 Bacteria 1993
82 Ga0068863_100080780 3300005841 Bacteria 3080
83 Ga0068863_100139641 3300005841 Bacteria 2315
84 Ga0068863_100509791 3300005841 Bacteria 1185
85 Ga0068858_100153155 3300005842 Bacteria 2168
86 Ga0068858_101235088 3300005842 Bacteria 735
87 Ga0068862_100158302 3300005844 Bacteria 2020
88 Ga0075365_10055131 3300006038 Bacteria 2638
89 Ga0075364_10019126 3300006051 Bacteria 4296
90 Ga0075432_10250924 3300006058 Bacteria 718
91 Ga0075367_10101650 3300006178 Bacteria 1758
92 Ga0075366_10065063 3300006195 Unclassified 2169
93 Ga0075428_100003841 3300006844 Bacteria 16495
94 Ga0075428_100011643 3300006844 Bacteria 9786
95 Ga0075428_100023217 3300006844 Bacteria 6860
96 Ga0075428_100034865 3300006844 Bacteria 5549
97 Ga0075430_100009436 3300006846 Bacteria 8242
98 Ga0075430_100021072 3300006846 Bacteria 5541
99 Ga0075430_100078565 3300006846 Bacteria 2766
100 Ga0075431_100002132 3300006847 Bacteria 18915
101 Ga0075431_100252551 3300006847 Bacteria 1791
102 Ga0075433_10050471 3300006852 Bacteria 3622
103 Ga0075433_10078237 3300006852 Unclassified 2914
104 Ga0075433_10256367 3300006852 Bacteria 1551
105 Ga0075433_10703557 3300006852 Archaea 885
106 Ga0075434_100001297 3300006871 Bacteria 20847
107 Ga0075434_100012662 3300006871 Bacteria 7999
108 Ga0075434_100132673 3300006871 Bacteria 2510
109 Ga0075434_100688513 3300006871 Bacteria 1040
110 Ga0075429_100001542 3300006880 Bacteria 18882
111 Ga0075429_100039382 3300006880 Bacteria 4113
112 Ga0068865_100176890 3300006881 Bacteria 1640
113 Ga0068865_100601031 3300006881 Bacteria 930
114 Ga0068865_100713621 3300006881 Bacteria 858
115 Ga0097620_100430751 3300006931 Bacteria 1415
116 Ga0097620_100570660 3300006931 Bacteria 1225
117 Ga0075435_100017323 3300007076 Bacteria 5451
118 Ga0075435_100211782 3300007076 Bacteria 1644
119 Ga0105240_10189595 3300009093 Unclassified 2419
120 Ga0105240_10234125 3300009093 Bacteria 2133
121 Ga0105240_10293633 3300009093 Bacteria 1862
122 Ga0111539_10002305 3300009094 Bacteria 25374
123 Ga0111539_10004654 3300009094 Bacteria 17933
124 Ga0111539_10014793 3300009094 Bacteria 9732
125 Ga0111539_10067014 3300009094 Bacteria 4240
126 Ga0111539_10071951 3300009094 Unclassified 4079
127 Ga0111539_10494423 3300009094 Bacteria 1425
128 Ga0111539_10777502 3300009094 Bacteria 1114
129 Ga0111539_10898331 3300009094 Bacteria 1030
130 Ga0105245_10615507 3300009098 Bacteria 1114
131 Ga0114129_10000365 3300009147 Bacteria 52392
132 Ga0114129_10006470 3300009147 Bacteria 16615
133 Ga0114129_10018853 3300009147 Bacteria 9828
134 Ga0114129_10020577 3300009147 Bacteria 9383
135 Ga0114129_10021009 3300009147 Bacteria 9271
136 Ga0114129_10156229 3300009147 Bacteria 3119
137 Ga0114129_10357450 3300009147 Unclassified 1933
138 Ga0114129_10485026 3300009147 Bacteria 1617
139 Ga0114129_10853010 3300009147 Bacteria 1158
140 Ga0105241_10041099 3300009174 Bacteria 3492
141 Ga0105242_10065891 3300009176 Bacteria 2990
142 Ga0105248_10268641 3300009177 Bacteria 1920
143 Ga0105238_10745097 3300009551 Bacteria 993
144 Ga0105249_10002636 3300009553 Bacteria 15518
145 Ga0105249_10337502 3300009553 Bacteria 1523
146 Ga0105239_10473846 3300010375 Bacteria 1422
147 Ga0105246_10104433 3300011119 Bacteria 2069
148 Ga0105246_10117954 3300011119 Bacteria 1962
149 Ga0105246_10504853 3300011119 Bacteria 1028
150 Ga0157378_10202747 3300013297 Bacteria 1877
151 Ga0157378_10888047 3300013297 Bacteria 921
152 Ga0157372_10351180 3300013307 Bacteria 1718
153 Ga0163163_10357753 3300014325 Bacteria 1516
154 Ga0163163_10564036 3300014325 Bacteria 1201
155 Ga0157380_10421308 3300014326 Bacteria 1273
156 Ga0157380_10630125 3300014326 Bacteria 1066
157 Ga0157380_11166025 3300014326 Unclassified 812
158 Ga0157377_10421838 3300014745 Unclassified 914
159 Ga0157379_10060229 3300014968 Bacteria 3393
160 Ga0157376_10346024 3300014969 Bacteria 1421
161 Ga0206353_10707237 3300020082 Bacteria 1395
162 Ga0207697_10007648 3300025315 Bacteria 4796
163 Ga0207697_10045382 3300025315 Bacteria 1809
164 Ga0207656_10204696 3300025321 Bacteria 954
165 Ga0207682_10054718 3300025893 Bacteria 1659
166 Ga0207682_10136805 3300025893 Unclassified 1097
167 Ga0207642_10414064 3300025899 Bacteria 809
168 Ga0207688_10000492 3300025901 Bacteria 18999
169 Ga0207688_10082138 3300025901 Bacteria 1841
170 Ga0207680_10175904 3300025903 Bacteria 1444
171 Ga0207645_10007438 3300025907 Bacteria 7734
172 Ga0207645_10073463 3300025907 Bacteria 2189
173 Ga0207643_10054148 3300025908 Unclassified 2280
174 Ga0207705_10123977 3300025909 Unclassified 1919
175 Ga0207707_10777254 3300025912 Bacteria 799
176 Ga0207663_10119855 3300025916 Bacteria 1800
177 Ga0207660_10172855 3300025917 Bacteria 1673
178 Ga0207662_10047604 3300025918 Bacteria 2540
179 Ga0207649_10262411 3300025920 Bacteria 1249
180 Ga0207652_10091763 3300025921 Bacteria 2671
181 Ga0207681_10001836 3300025923 Bacteria 13605
182 Ga0207681_10300834 3300025923 Bacteria 1269
183 Ga0207650_10017335 3300025925 Bacteria 5041
184 Ga0207650_10029259 3300025925 Bacteria 3959
185 Ga0207659_10061144 3300025926 Bacteria 2714
186 Ga0207659_10341894 3300025926 Unclassified 1239
187 Ga0207644_10001308 3300025931 Bacteria 16024
188 Ga0207644_10180132 3300025931 Unclassified 1655
189 Ga0207706_10275725 3300025933 Bacteria 1467
190 Ga0207686_10138636 3300025934 Bacteria 1678
191 Ga0207670_10208271 3300025936 Bacteria 1489
192 Ga0207669_10038524 3300025937 Bacteria 2753
193 Ga0207669_10054629 3300025937 Bacteria 2414
194 Ga0207669_10387486 3300025937 Bacteria 1091
195 Ga0207704_10765503 3300025938 Bacteria 804
196 Ga0207691_10008238 3300025940 Bacteria 10008
197 Ga0207691_10013408 3300025940 Bacteria 7846
198 Ga0207691_10571318 3300025940 Bacteria 958
199 Ga0207691_10632699 3300025940 Unclassified 905
200 Ga0207711_10053672 3300025941 Bacteria 3456
201 Ga0207689_10020674 3300025942 Bacteria 5535
202 Ga0207661_10033392 3300025944 Bacteria 3993
203 Ga0207679_10022187 3300025945 Bacteria 4318
204 Ga0207679_10067889 3300025945 Bacteria 2676
205 Ga0207679_10365907 3300025945 Bacteria 1261
206 Ga0207679_10968622 3300025945 Bacteria 779
207 Ga0207651_10211791 3300025960 Unclassified 1560
208 Ga0207712_10013927 3300025961 Bacteria 5158
209 Ga0207712_10943257 3300025961 Bacteria 764
210 Ga0207640_10018478 3300025981 Bacteria 4098
211 Ga0207640_10239605 3300025981 Bacteria 1401
212 Ga0207658_10080441 3300025986 Bacteria 2496
213 Ga0207677_10301702 3300026023 Bacteria 1323
214 Ga0207703_10089128 3300026035 Bacteria 2590
215 Ga0207678_10031996 3300026067 Bacteria 4585
216 Ga0207678_11068626 3300026067 Bacteria 715
217 Ga0207708_10022601 3300026075 Bacteria 4749
218 Ga0207708_10726137 3300026075 Unclassified 851
219 Ga0207641_10051505 3300026088 Bacteria 3487
220 Ga0207648_10064050 3300026089 Bacteria 3204
221 Ga0207648_10567826 3300026089 Bacteria 1043
222 Ga0207676_10238783 3300026095 Bacteria 1629
223 Ga0207675_100096918 3300026118 Bacteria 2777
224 Ga0207683_10008330 3300026121 Bacteria 8868
225 Ga0207683_10045229 3300026121 Bacteria 3849
226 Ga0207683_10190051 3300026121 Unclassified 1864
227 Ga0207683_10242295 3300026121 Bacteria 1645
228 Ga0207683_10658827 3300026121 Bacteria 970
229 Ga0207698_10175550 3300026142 Bacteria 1892
230 Ga0207428_10000910 3300027907 Bacteria 33053
231 Ga0207428_10024514 3300027907 Bacteria 5065
232 Ga0207428_10158964 3300027907 Unclassified 1717
233 Ga0207428_10187223 3300027907 Bacteria 1561
234 Ga0207428_10217470 3300027907 Bacteria 1433
235 Ga0268265_10090781 3300028380 Bacteria 2441
236 Ga0268265_10096380 3300028380 Bacteria 2377
237 Ga0268264_11346121 3300028381 Bacteria 724
238 Ga0307408_100049598 3300031548 Unclassified 3015
239 Ga0307408_100102592 3300031548 Bacteria 2182
240 Ga0307408_100102989 3300031548 Bacteria 2178
241 Ga0307408_100115695 3300031548 Unclassified 2068
242 Ga0307408_100128326 3300031548 Bacteria 1975
243 Ga0307405_10358482 3300031731 Bacteria 1127
244 Ga0307405_10642811 3300031731 Bacteria 871
245 Ga0307413_10077913 3300031824 Unclassified 2113
246 Ga0307413_10736982 3300031824 Bacteria 822
247 Ga0307413_10745733 3300031824 Bacteria 818
248 Ga0307406_10120496 3300031901 Bacteria 1823
249 Ga0307407_10110435 3300031903 Unclassified 1725
250 Ga0307407_10131494 3300031903 Unclassified 1602
251 Ga0307412_10025968 3300031911 Bacteria 3635
252 Ga0307412_10124834 3300031911 Unclassified 1860
253 Ga0307412_10310024 3300031911 Unclassified 1251
254 Ga0307412_10328713 3300031911 Bacteria 1219
255 Ga0307412_10348073 3300031911 Bacteria 1189
256 Ga0307409_100057971 3300031995 Bacteria 3005
257 Ga0307409_100133799 3300031995 Unclassified 2124
258 Ga0307409_100349326 3300031995 Unclassified 1395
259 Ga0307409_100376864 3300031995 Bacteria 1347
260 Ga0307409_100647244 3300031995 Bacteria 1050
261 Ga0307416_100031305 3300032002 Unclassified 4003
262 Ga0307416_100040783 3300032002 Unclassified 3610
263 Ga0307416_100517695 3300032002 Bacteria 1260
264 Ga0307416_101121043 3300032002 Bacteria 892
265 Ga0307416_101318703 3300032002 Bacteria 828
266 Ga0307411_10142875 3300032005 Unclassified 1767
267 Ga0307411_10145209 3300032005 Unclassified 1755
268 Ga0307411_10203783 3300032005 Bacteria 1522
269 Ga0307415_100248183 3300032126 Bacteria 1444
270 Ga0307415_100353086 3300032126 Bacteria 1238
271 Ga0307415_100384906 3300032126 Bacteria 1192
272 Ga0373940_0107397 3300035088 Bacteria 853
273 Ga0373939_0021105 3300035114 Bacteria 1779
274 Ga0373960_0008481 3300035121 Bacteria 2464
275 Ga0373943_0273353 3300035170 Unclassified 954
276 Ga0373931_0324709 3300035691 Bacteria 957
277 Ga0373931_0485077 3300035691 Unclassified 795
278 Ga0373947_0270137 3300035725 Bacteria 1129
279 Ga0373937_0166563 3300036401 Bacteria 2067
280 Ga0439461_0033821 3300041410 Bacteria 1077
281 Ga0439461_0067522 3300041410 Bacteria 823
282 Ga0439445_0045653 3300042004 Bacteria 1173
283 Ga0439449_0140333 3300042007 Bacteria 899
284 Ga0439450_015879 3300042008 Bacteria 1549
285 Ga0450923_014189 3300042125 Bacteria 1476
286 Ga0450896_015251 3300042133 Bacteria 1100
287 Ga0439446_0028816 3300042156 Unclassified 1600
288 Ga0439434_0085012 3300042435 Bacteria 1007
289 Ga0439435_0046427 3300042436 Unclassified 1230
290 Ga0439464_0024894 3300042439 Unclassified 1656
291 Ga0439460_0207777 3300042461 Bacteria 668
292 Ga0451577_0056951 3300042876 Unclassified 3486
293 Ga0451576_0175169 3300045051 Bacteria 2239
294 Ga0451576_0202753 3300045051 Bacteria 2072
295 Ga0451576_0553888 3300045051 Unclassified 1208
296 Ga0466967_0828101 3300045976 Unclassified 919
297 Ga0466967_1337599 3300045976 Unclassified 713
298 Ga0495653_0358246 3300046463 Bacteria 937
299 Ga0495580_0132851 3300046472 Bacteria 1726
300 Ga0495608_0231746 3300046511 Unclassified 1156
301 Ga0495644_0011536 3300046523 Bacteria 3402
302 Ga0495663_0035373 3300046525 Bacteria 1500
303 Ga0495609_0041805 3300046538 Bacteria 2059
304 Ga0495621_0040947 3300046539 Unclassified 1625
305 Ga0495621_0118024 3300046539 Unclassified 1023
306 Ga0495656_0030258 3300046615 Unclassified 2187
307 Ga0495634_0320160 3300046642 Bacteria 934
308 Ga0495635_0063640 3300046663 Bacteria 2533
309 Ga0495659_0006578 3300046664 Bacteria 3669
310 Ga0495669_0044301 3300046684 Unclassified 1982
311 Ga0495589_0215235 3300046794 Unclassified 904
312 Ga0495636_0180815 3300047318 Unclassified 957
313 Ga0495684_0284814 3300047471 Bacteria 1191
314 Ga0496100_0287378 3300048903 Bacteria 1228
315 Ga0496101_0482813 3300048904 Unclassified 979
316 Ga0496101_0543489 3300048904 Bacteria 918
317 Ga0496102_0115688 3300048905 Bacteria 2502
318 Ga0496102_0196905 3300048905 Bacteria 1899
319 Ga0496104_0000390 3300048907 Bacteria 38304
320 Ga0496105_0141621 3300048908 Bacteria 1979
321 Ga0496106_0032863 3300048909 Bacteria 3869
322 Ga0496106_0377243 3300048909 Bacteria 1140
323 Ga0496107_0385473 3300048910 Bacteria 1042
324 Ga0496108_0000991 3300048911 Bacteria 22120
325 Ga0496109_0001039 3300048912 Bacteria 22972
326 Ga0496109_0205891 3300048912 Unclassified 1850
327 Ga0496109_0514857 3300048912 Bacteria 1129
328 Ga0496110_0000315 3300048913 Bacteria 31988
329 Ga0496111_0006449 3300048914 Bacteria 7620
330 Ga0496112_0000363 3300048915 Bacteria 29575
331 Ga0496112_0067125 3300048915 Bacteria 3540
332 Ga0496113_0076026 3300048916 Bacteria 2564
333 Ga0496113_0503131 3300048916 Bacteria 973
334 Ga0496114_0247526 3300048917 Bacteria 1568
335 Ga0501291_022699 3300049514 Bacteria 1009
336 Ga0501296_013115 3300049519 Bacteria 1007
337 Ga0501031_0058070 3300049568 Bacteria 2521
338 Ga0501031_0094322 3300049568 Bacteria 1953
339 Ga0501036_0100745 3300049572 Bacteria 2443
340 Ga0501038_0093881 3300049574 Unclassified 2509
341 Ga0501039_0078964 3300049575 Unclassified 2560
342 Ga0501040_0077367 3300049576 Unclassified 2301
343 Ga0501040_0203434 3300049576 Bacteria 1406
344 Ga0501040_0427635 3300049576 Unclassified 952
345 Ga0501041_0047549 3300049577 Bacteria 2612
346 Ga0501041_0186835 3300049577 Unclassified 1298
347 Ga0501042_0035061 3300049578 Unclassified 3560
348 Ga0501042_0082909 3300049578 Bacteria 2299
349 Ga0501042_0609466 3300049578 Bacteria 794
350 Ga0501046_0070207 3300049580 Unclassified 2724
351 Ga0501048_0034092 3300049582 Unclassified 3676
352 Ga0501048_0164473 3300049582 Bacteria 1571
353 Ga0501048_0603154 3300049582 Unclassified 788
354 Ga0501070_0354634 3300049586 Bacteria 1190
355 Ga0501071_0008132 3300049587 Bacteria 6918
356 Ga0501071_0034298 3300049587 Unclassified 3611
357 Ga0501071_0144280 3300049587 Unclassified 1774
358 Ga0501072_0233312 3300049588 Bacteria 1466
359 Ga0501074_0029791 3300049590 Bacteria 3955
360 Ga0501074_0033551 3300049590 Bacteria 3721
361 Ga0501075_0024047 3300049591 Bacteria 4461
362 Ga0501075_0027608 3300049591 Bacteria 4184
363 Ga0501075_0071022 3300049591 Bacteria 2631
364 Ga0501075_0121988 3300049591 Bacteria 1984
365 Ga0501076_0019601 3300049592 Bacteria 5172
366 Ga0501076_0026697 3300049592 Bacteria 4476
367 Ga0501076_0490243 3300049592 Unclassified 1013
368 Ga0501077_0019283 3300049593 Bacteria 4313
369 Ga0501208_046449 3300049655 Bacteria 817
370 Ga0501235_137021 3300049669 Bacteria 624
371 Ga0501249_062214 3300049679 Unclassified 866
372 Ga0501079_0046366 3300049741 Bacteria 3354
373 Ga0501079_0081591 3300049741 Bacteria 2501
374 Ga0501079_0148183 3300049741 Bacteria 1829
375 Ga0501079_0237192 3300049741 Unclassified 1425
376 Ga0501079_0770398 3300049741 Bacteria 757
377 Ga0501080_0134830 3300049742 Bacteria 2285
378 Ga0501080_0136721 3300049742 Bacteria 2268
379 Ga0501080_0902099 3300049742 Unclassified 770
380 Ga0501081_0010980 3300049743 Bacteria 5921
381 Ga0501081_0395493 3300049743 Unclassified 1023
382 Ga0501081_0657982 3300049743 Bacteria 785
383 Ga0501083_0159930 3300049744 Bacteria 1474
384 Ga0501268_122858 3300049765 Unclassified 577
385 Ga0501275_020875 3300049772 Unclassified 803
386 Ga0501035_0524400 3300049822 Unclassified 973
387 Ga0501045_0003415 3300049824 Bacteria 10867
388 Ga0501045_0051125 3300049824 Bacteria 3016
389 Ga0501045_0092679 3300049824 Bacteria 2234
390 Ga0501045_0110324 3300049824 Unclassified 2040
391 nmdc:mga00v17_56313_c1 3300050491 Bacteria 2403
392 nmdc:mga0yw44_32511_c1 3300050492 Bacteria 3041
393 nmdc:mga06z11_79203_c1 3300050494 Bacteria 1758
394 nmdc:mga05p37_1042567_c1 3300050507 Unclassified 864
395 nmdc:mga05p37_11091_c1 3300050507 Bacteria 10708
396 nmdc:mga05p37_145902_c1 3300050507 Unclassified 2898
397 nmdc:mga05p37_154614_c1 3300050507 Unclassified 2804
398 nmdc:mga05p37_22421_c1 3300050507 Bacteria 7659
399 nmdc:mga05p37_22647_c1 3300050507 Bacteria 7619
400 nmdc:mga05p37_339551_c1 3300050507 Bacteria 1772
401 nmdc:mga05p37_44147_c1 3300050507 Bacteria 5484
402 nmdc:mga05p37_71585_c1 3300050507 Bacteria 4265
403 nmdc:mga09592_120245_c1 3300050508 Bacteria 2256
404 nmdc:mga09592_244732_c1 3300050508 Unclassified 1554
405 nmdc:mga09592_7620_c1 3300050508 Bacteria 8803
406 nmdc:mga0qj67_122147_c1 3300050509 Bacteria 2107
407 nmdc:mga0qj67_28851_c1 3300050509 Bacteria 4308
408 nmdc:mga0qj67_58885_c1 3300050509 Bacteria 3046
409 nmdc:mga06r32_12230_c1 3300050510 Bacteria 7740
410 nmdc:mga06r32_22038_c1 3300050510 Bacteria 5884
411 nmdc:mga06r32_256460_c1 3300050510 Bacteria 1737
412 nmdc:mga08y16_123046_c1 3300050511 Unclassified 2699
413 nmdc:mga08y16_16119_c1 3300050511 Bacteria 7859
414 nmdc:mga08y16_19670_c1 3300050511 Bacteria 7119
415 nmdc:mga08y16_245410_c1 3300050511 Bacteria 1850
416 nmdc:mga08y16_25038_c1 3300050511 Bacteria 6296
417 nmdc:mga08y16_468791_c1 3300050511 Bacteria 1282
418 nmdc:mga08y16_966664_c1 3300050511 Bacteria 834
419 nmdc:mga0n895_1330_c1 3300050512 Bacteria 18298
420 nmdc:mga0n895_191693_c1 3300050512 Bacteria 2075
421 nmdc:mga0n895_2005_c1 3300050512 Bacteria 15635
422 nmdc:mga0n895_266664_c1 3300050512 Bacteria 1737
423 nmdc:mga0rr50_12488_c1 3300050513 Bacteria 5493
424 nmdc:mga0rr50_16259_c1 3300050513 Bacteria 4936
425 nmdc:mga0rr50_258663_c1 3300050513 Bacteria 1448
426 nmdc:mga0rr50_41717_c1 3300050513 Unclassified 3346
427 nmdc:mga08x19_528436_c1 3300050514 Bacteria 834
428 nmdc:mga0a205_20789_c1 3300050515 Bacteria 3342
429 nmdc:mga0a205_214903_c1 3300050515 Bacteria 1810
430 nmdc:mga0a205_2919_c1 3300050515 Bacteria 15134
431 nmdc:mga0a205_53420_c1 3300050515 Bacteria 3900
432 nmdc:mga0a205_81190_c1 3300050515 Unclassified 3132
433 Ga0495619_0062751 3300053085 Unclassified 2474
434 Ga0500628_039279 3300053129 Unclassified 1072
435 Ga0501084_0030779 3300054114 Unclassified 4487
436 Ga0501084_0046951 3300054114 Bacteria 3617
437 Ga0501084_0055312 3300054114 Unclassified 3320
438 Ga0501084_0075696 3300054114 Unclassified 2820
439 Ga0590071_003826 3300059421 Bacteria 3694
440 Ga0590074_009758 3300059423 Bacteria 1601
441 Ga0590075_060559 3300059424 Bacteria 975
442 Ga0590077_000040 3300059426 Bacteria 29723
443 Ga0501082_0046023 3300060353 Bacteria 3762
444 Ga0530510_0156888 3300061734 Bacteria 1682
445 Ga0530510_0626945 3300061734 Bacteria 818
446 Ga0070665_100642598
447 2214786057
448 Ga0065712_10074785
449 Ga0065715_10048383
450 Ga0065715_10173758
451 Ga0065715_10208986
452 Ga0065715_10264094
453 Ga0065707_10032015
454 Ga0065707_10374446
455 Ga0070658_10329648
456 Ga0070676_10144066
457 Ga0070676_10150747
458 Ga0070683_100000670
459 Ga0070670_100002296
460 Ga0070670_100003090
461 Ga0070670_100004654
462 Ga0070670_100068029
463 Ga0070677_10053195
464 Ga0068869_100025749
465 Ga0068869_100089480
466 Ga0070666_10048375
467 Ga0070666_10208267
468 Ga0068868_100311574
469 Ga0070689_100396231
470 Ga0070689_101421106
471 Ga0070687_100117810
472 Ga0070661_100619519
473 Ga0070669_100000449
474 Ga0070675_100055464
475 Ga0070675_100061139
476 Ga0070675_100522919
477 Ga0070671_100061632
478 Ga0070671_100077271
479 Ga0070671_100730358
480 Ga0070674_100024454
481 Ga0070674_100029202
482 Ga0070674_100642522
483 Ga0070673_100024294
484 Ga0070673_100093886
485 Ga0070688_100173455
486 Ga0070659_100711559
487 Ga0070667_100057408
488 Ga0070667_100106655
489 Ga0070667_100476109
490 Ga0070711_100079958
491 Ga0070700_100050708
492 Ga0070700_100362057
493 Ga0070694_100608425
494 Ga0070663_100670702
495 Ga0070678_100046798
496 Ga0070678_100257580
497 Ga0070662_100087639
498 Ga0070662_100122545
499 Ga0070662_100148892
500 Ga0068867_100015355
501 Ga0070679_100111337
502 Ga0070684_100000191
503 Ga0070684_100684862
504 Ga0070672_100032915
505 Ga0070672_100051259
506 Ga0070695_100351866
507 Ga0070693_100239817
508 Ga0070665_100204681
509 Ga0070665_100588509
510 Ga0070704_100131625
511 Ga0070704_100909079
512 Ga0068855_100412234
513 Ga0070664_100000081
514 Ga0070664_100069087
515 Ga0070664_100481544
516 Ga0068854_100192808
517 Ga0068856_100655562
518 Ga0070702_100149496
519 Ga0068852_100396532
520 Ga0068852_100832621
521 Ga0068859_100430740
522 Ga0068859_100570646
523 Ga0068864_100282274
524 Ga0068864_100829388
525 Ga0068851_10125984
526 Ga0068870_10063416
527 Ga0068863_100080780
528 Ga0068863_100139641
529 Ga0068863_100509791
530 Ga0068858_100153155
531 Ga0068858_101235088
532 Ga0068862_100158302
533 Ga0075365_10055131
534 Ga0075364_10019126
535 Ga0075432_10250924
536 Ga0075367_10101650
537 Ga0075366_10065063
538 Ga0075428_100003841
539 Ga0075428_100011643
540 Ga0075428_100023217
541 Ga0075428_100034865
542 Ga0075430_100009436
543 Ga0075430_100021072
544 Ga0075430_100078565
545 Ga0075431_100002132
546 Ga0075431_100252551
547 Ga0075433_10050471
548 Ga0075433_10078237
549 Ga0075433_10256367
550 Ga0075433_10703557
551 Ga0075434_100001297
552 Ga0075434_100012662
553 Ga0075434_100132673
554 Ga0075434_100688513
555 Ga0075429_100001542
556 Ga0075429_100039382
557 Ga0068865_100176890
558 Ga0068865_100601031
559 Ga0068865_100713621
560 Ga0097620_100430751
561 Ga0097620_100570660
562 Ga0075435_100017323
563 Ga0075435_100211782
564 Ga0105240_10189595
565 Ga0105240_10234125
566 Ga0105240_10293633
567 Ga0111539_10002305
568 Ga0111539_10004654
569 Ga0111539_10014793
570 Ga0111539_10067014
571 Ga0111539_10071951
572 Ga0111539_10494423
573 Ga0111539_10777502
574 Ga0111539_10898331
575 Ga0105245_10615507
576 Ga0114129_10000365
577 Ga0114129_10006470
578 Ga0114129_10018853
579 Ga0114129_10020577
580 Ga0114129_10021009
581 Ga0114129_10156229
582 Ga0114129_10357450
583 Ga0114129_10485026
584 Ga0114129_10853010
585 Ga0105241_10041099
586 Ga0105242_10065891
587 Ga0105248_10268641
588 Ga0105238_10745097
589 Ga0105249_10002636
590 Ga0105249_10337502
591 Ga0105239_10473846
592 Ga0105246_10104433
593 Ga0105246_10117954
594 Ga0105246_10504853
595 Ga0157378_10202747
596 Ga0157378_10888047
597 Ga0157372_10351180
598 Ga0163163_10357753
599 Ga0163163_10564036
600 Ga0157380_10421308
601 Ga0157380_10630125
602 Ga0157380_11166025
603 Ga0157377_10421838
604 Ga0157379_10060229
605 Ga0157376_10346024
606 Ga0206353_10707237
607 Ga0207697_10007648
608 Ga0207697_10045382
609 Ga0207656_10204696
610 Ga0207682_10054718
611 Ga0207682_10136805
612 Ga0207642_10414064
613 Ga0207688_10000492
614 Ga0207688_10082138
615 Ga0207680_10175904
616 Ga0207645_10007438
617 Ga0207645_10073463
618 Ga0207643_10054148
619 Ga0207705_10123977
620 Ga0207707_10777254
621 Ga0207663_10119855
622 Ga0207660_10172855
623 Ga0207662_10047604
624 Ga0207649_10262411
625 Ga0207652_10091763
626 Ga0207681_10001836
627 Ga0207681_10300834
628 Ga0207650_10017335
629 Ga0207650_10029259
630 Ga0207659_10061144
631 Ga0207659_10341894
632 Ga0207644_10001308
633 Ga0207644_10180132
634 Ga0207706_10275725
635 Ga0207686_10138636
636 Ga0207670_10208271
637 Ga0207669_10038524
638 Ga0207669_10054629
639 Ga0207669_10387486
640 Ga0207704_10765503
641 Ga0207691_10008238
642 Ga0207691_10013408
643 Ga0207691_10571318
644 Ga0207691_10632699
645 Ga0207711_10053672
646 Ga0207689_10020674
647 Ga0207661_10033392
648 Ga0207679_10022187
649 Ga0207679_10067889
650 Ga0207679_10365907
651 Ga0207679_10968622
652 Ga0207651_10211791
653 Ga0207712_10013927
654 Ga0207712_10943257
655 Ga0207640_10018478
656 Ga0207640_10239605
657 Ga0207658_10080441
658 Ga0207677_10301702
659 Ga0207703_10089128
660 Ga0207678_10031996
661 Ga0207678_11068626
662 Ga0207708_10022601
663 Ga0207708_10726137
664 Ga0207641_10051505
665 Ga0207648_10064050
666 Ga0207648_10567826
667 Ga0207676_10238783
668 Ga0207675_100096918
669 Ga0207683_10008330
670 Ga0207683_10045229
671 Ga0207683_10190051
672 Ga0207683_10242295
673 Ga0207683_10658827
674 Ga0207698_10175550
675 Ga0207428_10000910
676 Ga0207428_10024514
677 Ga0207428_10158964
678 Ga0207428_10187223
679 Ga0207428_10217470
680 Ga0268265_10090781
681 Ga0268265_10096380
682 Ga0268264_11346121
683 Ga0307408_100049598
684 Ga0307408_100102592
685 Ga0307408_100102989
686 Ga0307408_100115695
687 Ga0307408_100128326
688 Ga0307405_10358482
689 Ga0307405_10642811
690 Ga0307413_10077913
691 Ga0307413_10736982
692 Ga0307413_10745733
693 Ga0307406_10120496
694 Ga0307407_10110435
695 Ga0307407_10131494
696 Ga0307412_10025968
697 Ga0307412_10124834
698 Ga0307412_10310024
699 Ga0307412_10328713
700 Ga0307412_10348073
701 Ga0307409_100057971
702 Ga0307409_100133799
703 Ga0307409_100349326
704 Ga0307409_100376864
705 Ga0307409_100647244
706 Ga0307416_100031305
707 Ga0307416_100040783
708 Ga0307416_100517695
709 Ga0307416_101121043
710 Ga0307416_101318703
711 Ga0307411_10142875
712 Ga0307411_10145209
713 Ga0307411_10203783
714 Ga0307415_100248183
715 Ga0307415_100353086
716 Ga0307415_100384906
717 Ga0373940_0107397
718 Ga0373939_0021105
719 Ga0373960_0008481
720 Ga0373943_0273353
721 Ga0373931_0324709
722 Ga0373931_0485077
723 Ga0373947_0270137
724 Ga0373937_0166563
725 Ga0439461_0033821
726 Ga0439461_0067522
727 Ga0439445_0045653
728 Ga0439449_0140333
729 Ga0439450_015879
730 Ga0450923_014189
731 Ga0450896_015251
732 Ga0439446_0028816
733 Ga0439434_0085012
734 Ga0439435_0046427
735 Ga0439464_0024894
736 Ga0439460_0207777
737 Ga0451577_0056951
738 Ga0451576_0175169
739 Ga0451576_0202753
740 Ga0451576_0553888
741 Ga0466967_0828101
742 Ga0466967_1337599
743 Ga0495653_0358246
744 Ga0495580_0132851
745 Ga0495608_0231746
746 Ga0495644_0011536
747 Ga0495663_0035373
748 Ga0495609_0041805
749 Ga0495621_0040947
750 Ga0495621_0118024
751 Ga0495656_0030258
752 Ga0495634_0320160
753 Ga0495635_0063640
754 Ga0495659_0006578
755 Ga0495669_0044301
756 Ga0495589_0215235
757 Ga0495636_0180815
758 Ga0495684_0284814
759 Ga0496100_0287378
760 Ga0496101_0482813
761 Ga0496101_0543489
762 Ga0496102_0115688
763 Ga0496102_0196905
764 Ga0496104_0000390
765 Ga0496105_0141621
766 Ga0496106_0032863
767 Ga0496106_0377243
768 Ga0496107_0385473
769 Ga0496108_0000991
770 Ga0496109_0001039
771 Ga0496109_0205891
772 Ga0496109_0514857
773 Ga0496110_0000315
774 Ga0496111_0006449
775 Ga0496112_0000363
776 Ga0496112_0067125
777 Ga0496113_0076026
778 Ga0496113_0503131
779 Ga0496114_0247526
780 Ga0501291_022699
781 Ga0501296_013115
782 Ga0501031_0058070
783 Ga0501031_0094322
784 Ga0501036_0100745
785 Ga0501038_0093881
786 Ga0501039_0078964
787 Ga0501040_0077367
788 Ga0501040_0203434
789 Ga0501040_0427635
790 Ga0501041_0047549
791 Ga0501041_0186835
792 Ga0501042_0035061
793 Ga0501042_0082909
794 Ga0501042_0609466
795 Ga0501046_0070207
796 Ga0501048_0034092
797 Ga0501048_0164473
798 Ga0501048_0603154
799 Ga0501070_0354634
800 Ga0501071_0008132
801 Ga0501071_0034298
802 Ga0501071_0144280
803 Ga0501072_0233312
804 Ga0501074_0029791
805 Ga0501074_0033551
806 Ga0501075_0024047
807 Ga0501075_0027608
808 Ga0501075_0071022
809 Ga0501075_0121988
810 Ga0501076_0019601
811 Ga0501076_0026697
812 Ga0501076_0490243
813 Ga0501077_0019283
814 Ga0501208_046449
815 Ga0501235_137021
816 Ga0501249_062214
817 Ga0501079_0046366
818 Ga0501079_0081591
819 Ga0501079_0148183
820 Ga0501079_0237192
821 Ga0501079_0770398
822 Ga0501080_0134830
823 Ga0501080_0136721
824 Ga0501080_0902099
825 Ga0501081_0010980
826 Ga0501081_0395493
827 Ga0501081_0657982
828 Ga0501083_0159930
829 Ga0501268_122858
830 Ga0501275_020875
831 Ga0501035_0524400
832 Ga0501045_0003415
833 Ga0501045_0051125
834 Ga0501045_0092679
835 Ga0501045_0110324
836 nmdc:mga00v17_56313_c1
837 nmdc:mga0yw44_32511_c1
838 nmdc:mga06z11_79203_c1
839 nmdc:mga05p37_1042567_c1
840 nmdc:mga05p37_11091_c1
841 nmdc:mga05p37_145902_c1
842 nmdc:mga05p37_154614_c1
843 nmdc:mga05p37_22421_c1
844 nmdc:mga05p37_22647_c1
845 nmdc:mga05p37_339551_c1
846 nmdc:mga05p37_44147_c1
847 nmdc:mga05p37_71585_c1
848 nmdc:mga09592_120245_c1
849 nmdc:mga09592_244732_c1
850 nmdc:mga09592_7620_c1
851 nmdc:mga0qj67_122147_c1
852 nmdc:mga0qj67_28851_c1
853 nmdc:mga0qj67_58885_c1
854 nmdc:mga06r32_12230_c1
855 nmdc:mga06r32_22038_c1
856 nmdc:mga06r32_256460_c1
857 nmdc:mga08y16_123046_c1
858 nmdc:mga08y16_16119_c1
859 nmdc:mga08y16_19670_c1
860 nmdc:mga08y16_245410_c1
861 nmdc:mga08y16_25038_c1
862 nmdc:mga08y16_468791_c1
863 nmdc:mga08y16_966664_c1
864 nmdc:mga0n895_1330_c1
865 nmdc:mga0n895_191693_c1
866 nmdc:mga0n895_2005_c1
867 nmdc:mga0n895_266664_c1
868 nmdc:mga0rr50_12488_c1
869 nmdc:mga0rr50_16259_c1
870 nmdc:mga0rr50_258663_c1
871 nmdc:mga0rr50_41717_c1
872 nmdc:mga08x19_528436_c1
873 nmdc:mga0a205_20789_c1
874 nmdc:mga0a205_214903_c1
875 nmdc:mga0a205_2919_c1
876 nmdc:mga0a205_53420_c1
877 nmdc:mga0a205_81190_c1
878 Ga0495619_0062751
879 Ga0500628_039279
880 Ga0501084_0030779
881 Ga0501084_0046951
882 Ga0501084_0055312
883 Ga0501084_0075696
884 Ga0590071_003826
885 Ga0590074_009758
886 Ga0590075_060559
887 Ga0590077_000040
888 Ga0501082_0046023
889 Ga0530510_0156888
890 Ga0530510_0626945

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04542

Sigma70_r2

Sigma-70 region 2

73

141

0.97

PF08281

Sigma70_r4_2

Sigma-70, region 4

171

224

0.96

PF07638

Sigma70_ECF

ECF sigma factor

52

229

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o8x-assembly1.cif.gz_A "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9611 138 190
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9564 138 190
4lup-assembly2.cif.gz_C crystal structure of the complex formed by region of e. coli sigmae bound to its -10 element non template strand 0.9398 22 111
3hug-assembly2.cif.gz_E crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.93 134 196
2h27-assembly2.cif.gz_D crystal structure of escherichia coli sigmae region 4 bound to its-35 element dna 0.9296 138 195
ID Description Score Start End Superfamily
2o8xA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9611 138 190 1.10.10.10
2o8xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9564 138 190 1.10.10.10
af_P9WGH7_10_94_1.10.1740.10 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.951 24 103 1.10.1740.10
3vfzA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9484 141 192 1.10.10.10
2o8xC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9464 138 190 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1F3LJ98-F1-model_v4 RNA polymerase sigma factor 0.8085 19 192 GO:0003677
GO:0006352
GO:0016987
AF-A0A7W8R338-F1-model_v4 RNA polymerase sigma-70 factor (ECF subfamily) 0.7976 18 195 GO:0003677
GO:0006352
GO:0016987
AF-A0A0M3CDP5-F1-model_v4 deleted 0.7799 19 193
AF-A0A2U0ZYJ6-F1-model_v4 deleted 0.7653 18 197
AF-A0A512RPI0-F1-model_v4 DNA-directed RNA polymerase sigma-70 factor 0.7627 14 194 GO:0000428
GO:0003677
GO:0006352
GO:0016987

Map