F445449

General Info

Members Datasets Scaffolds Average Seq Length
445 217 890 175

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100215818|Ga0070699_1002158181
Length 192
Sequence MSDEYKSERALEHEPGLLAVEPGGDDPREFSDTLEPLDGEAIAAQRSPESQYCVFRAGRERFCLSVLLVEEVVDWPPITRVPLGPSFLMGVFNLRGSIVPLVDIAFTEGRRAGLSPRHVVVAALLDNAHPTCLRFGIAADEVIGTYTAADDALLDQMPSDVPHCRGMLRHDDRLALVLDLPRMIEVFPVPVI

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
75 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
76 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
124 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
125 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
126 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
127 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
128 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
130 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
131 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
132 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
163 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
182 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
187 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
210 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
211 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
212 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.43
Metatranscriptomes 1.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.94
Rhizosphere 94.16
Stem 0
Stem Tuber 0
Unclassified 35.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100215818 3300005518 Unclassified 1709
2 MBSR1b_contig_6683619 2162886012 Bacteria 1011
3 Ga0070658_10902467 3300005327 Unclassified 768
4 Ga0070683_100262711 3300005329 Unclassified 1642
5 Ga0070690_100220661 3300005330 Bacteria 1328
6 Ga0070670_100062528 3300005331 Bacteria 3196
7 Ga0070671_100233131 3300005355 Unclassified 1562
8 Ga0070659_100560368 3300005366 Unclassified 979
9 Ga0070667_100499068 3300005367 Bacteria 1115
10 Ga0070703_10001114 3300005406 Bacteria 8337
11 Ga0070709_10004747 3300005434 Bacteria 7339
12 Ga0070709_10134780 3300005434 Bacteria 1690
13 Ga0070709_10177566 3300005434 Unclassified 1493
14 Ga0070709_10200535 3300005434 Unclassified 1413
15 Ga0070709_10537372 3300005434 Unclassified 893
16 Ga0070709_10538301 3300005434 Unclassified 892
17 Ga0070709_10673598 3300005434 Unclassified 803
18 Ga0070714_100116738 3300005435 Bacteria 2369
19 Ga0070714_100760617 3300005435 Unclassified 937
20 Ga0070713_100000739 3300005436 Bacteria 20944
21 Ga0070713_100004311 3300005436 Bacteria 9534
22 Ga0070713_100064833 3300005436 Unclassified 3067
23 Ga0070713_100188707 3300005436 Bacteria 1856
24 Ga0070713_100188889 3300005436 Bacteria 1855
25 Ga0070713_100458808 3300005436 Bacteria 1198
26 Ga0070713_100606603 3300005436 Bacteria 1040
27 Ga0070713_100661876 3300005436 Unclassified 995
28 Ga0070710_10358730 3300005437 Bacteria 967
29 Ga0070710_10517791 3300005437 Bacteria 819
30 Ga0070711_100016956 3300005439 Unclassified 4632
31 Ga0070711_100032242 3300005439 Bacteria 3482
32 Ga0070711_100091112 3300005439 Unclassified 2197
33 Ga0070711_100156627 3300005439 Bacteria 1723
34 Ga0070711_100241110 3300005439 Bacteria 1414
35 Ga0070711_101186908 3300005439 Unclassified 660
36 Ga0070705_100001481 3300005440 Bacteria 12417
37 Ga0070705_100274088 3300005440 Unclassified 1196
38 Ga0070700_100708799 3300005441 Unclassified 801
39 Ga0070694_100042892 3300005444 Unclassified 3023
40 Ga0070694_100252160 3300005444 Bacteria 1335
41 Ga0070708_100001228 3300005445 Bacteria 19731
42 Ga0070708_100012182 3300005445 Bacteria 7011
43 Ga0070708_100387391 3300005445 Unclassified 1318
44 Ga0070678_100543501 3300005456 Unclassified 1030
45 Ga0068867_101066042 3300005459 Bacteria 736
46 Ga0070706_100005421 3300005467 Bacteria 12149
47 Ga0070706_100181628 3300005467 Bacteria 1964
48 Ga0070706_100432188 3300005467 Unclassified 1225
49 Ga0070707_100009899 3300005468 Bacteria 8874
50 Ga0070707_100052759 3300005468 Unclassified 3899
51 Ga0070707_100159439 3300005468 Unclassified 2198
52 Ga0070707_100253749 3300005468 Bacteria 1712
53 Ga0070707_100322931 3300005468 Bacteria 1500
54 Ga0070707_101361600 3300005468 Bacteria 676
55 Ga0070698_100011516 3300005471 Bacteria 9387
56 Ga0070698_100013182 3300005471 Bacteria 8746
57 Ga0070698_100245613 3300005471 Unclassified 1723
58 Ga0070699_100007937 3300005518 Bacteria 9219
59 Ga0070699_100163207 3300005518 Unclassified 1972
60 Ga0070699_100476942 3300005518 Bacteria 1132
61 Ga0070679_100026004 3300005530 Bacteria 5744
62 Ga0070679_100201351 3300005530 Bacteria 1957
63 Ga0070679_101232776 3300005530 Unclassified 693
64 Ga0070684_100153050 3300005535 Unclassified 2090
65 Ga0070697_100000298 3300005536 Bacteria 39662
66 Ga0070697_100024317 3300005536 Bacteria 4822
67 Ga0070697_100046380 3300005536 Bacteria 3522
68 Ga0070697_100163013 3300005536 Unclassified 1884
69 Ga0070697_100907040 3300005536 Bacteria 782
70 Ga0068853_100891124 3300005539 Unclassified 854
71 Ga0070695_100001240 3300005545 Bacteria 14031
72 Ga0070696_100000331 3300005546 Bacteria 28813
73 Ga0070693_100000020 3300005547 Bacteria 59763
74 Ga0070693_100264681 3300005547 Bacteria 1145
75 Ga0070665_100001001 3300005548 Bacteria 35846
76 Ga0070704_100000909 3300005549 Bacteria 14859
77 Ga0070704_100133285 3300005549 Unclassified 1929
78 Ga0068855_100786774 3300005563 Unclassified 1012
79 Ga0068857_100052374 3300005577 Bacteria 3622
80 Ga0068856_100305763 3300005614 Unclassified 1608
81 Ga0068864_100053055 3300005618 Bacteria 3496
82 Ga0068866_10036988 3300005718 Bacteria 2395
83 Ga0068863_100001570 3300005841 Bacteria 22600
84 Ga0068863_100017143 3300005841 Bacteria 6946
85 Ga0068858_100644346 3300005842 Bacteria 1029
86 Ga0068860_100158532 3300005843 Unclassified 2181
87 Ga0068860_100632948 3300005843 Bacteria 1077
88 Ga0081540_1135958 3300005983 Bacteria 995
89 Ga0070717_10105825 3300006028 Unclassified 2395
90 Ga0070717_10256623 3300006028 Unclassified 1546
91 Ga0070717_10346031 3300006028 Unclassified 1328
92 Ga0070717_10356675 3300006028 Unclassified 1308
93 Ga0070717_10909023 3300006028 Unclassified 801
94 Ga0070715_10041485 3300006163 Bacteria 1929
95 Ga0070715_10115763 3300006163 Unclassified 1271
96 Ga0070715_10155810 3300006163 Bacteria 1124
97 Ga0070716_100006438 3300006173 Bacteria 5737
98 Ga0070716_100024798 3300006173 Bacteria 3194
99 Ga0070716_100078032 3300006173 Unclassified 1967
100 Ga0070716_100117529 3300006173 Unclassified 1659
101 Ga0070716_100133489 3300006173 Bacteria 1573
102 Ga0070716_100222042 3300006173 Unclassified 1270
103 Ga0070716_100640141 3300006173 Unclassified 805
104 Ga0070712_100020001 3300006175 Bacteria 4377
105 Ga0070712_100026969 3300006175 Bacteria 3832
106 Ga0070712_100259094 3300006175 Unclassified 1393
107 Ga0070712_100327983 3300006175 Unclassified 1246
108 Ga0070712_100439876 3300006175 Unclassified 1084
109 Ga0097621_100022450 3300006237 Bacteria 4899
110 Ga0075433_10518792 3300006852 Bacteria 1048
111 Ga0075433_10534127 3300006852 Unclassified 1031
112 Ga0075434_100023117 3300006871 Bacteria 6054
113 Ga0075434_100106251 3300006871 Bacteria 2817
114 Ga0075434_100178317 3300006871 Bacteria 2144
115 Ga0075434_100238105 3300006871 Unclassified 1840
116 Ga0068865_100349699 3300006881 Bacteria 1197
117 Ga0075436_100001967 3300006914 Bacteria 14161
118 Ga0075436_100035357 3300006914 Bacteria 3447
119 Ga0075436_100119474 3300006914 Bacteria 1843
120 Ga0075436_100405396 3300006914 Bacteria 988
121 Ga0075436_100589683 3300006914 Bacteria 818
122 Ga0075435_100086148 3300007076 Bacteria 2586
123 Ga0099794_10001741 3300007265 Bacteria 7730
124 Ga0099794_10017386 3300007265 Bacteria 3204
125 Ga0099794_10018531 3300007265 Bacteria 3123
126 Ga0099794_10070900 3300007265 Unclassified 1707
127 Ga0099794_10081737 3300007265 Unclassified 1594
128 Ga0099794_10093691 3300007265 Unclassified 1493
129 Ga0099794_10196026 3300007265 Unclassified 1034
130 Ga0099795_10003858 3300007788 Bacteria 3777
131 Ga0099795_10010751 3300007788 Unclassified 2709
132 Ga0099795_10011162 3300007788 Unclassified 2674
133 Ga0105240_10006795 3300009093 Bacteria 16736
134 Ga0105245_10129215 3300009098 Bacteria 2368
135 Ga0105247_10080010 3300009101 Unclassified 2057
136 Ga0105247_10710765 3300009101 Unclassified 757
137 Ga0105242_10408456 3300009176 Bacteria 1269
138 Ga0105242_10758410 3300009176 Unclassified 956
139 Ga0105248_10024351 3300009177 Bacteria 6732
140 Ga0105248_10040516 3300009177 Bacteria 5222
141 Ga0105248_11744904 3300009177 Unclassified 706
142 Ga0105237_10285205 3300009545 Bacteria 1654
143 Ga0105238_10311064 3300009551 Bacteria 1560
144 Ga0105238_11473548 3300009551 Unclassified 709
145 Ga0099796_10062205 3300010159 Bacteria 1326
146 Ga0099796_10132036 3300010159 Unclassified 969
147 Ga0105239_10067448 3300010375 Bacteria 3930
148 Ga0157370_10502513 3300013104 Unclassified 1113
149 Ga0157369_10626143 3300013105 Unclassified 1110
150 Ga0157374_10078007 3300013296 Bacteria 3136
151 Ga0157374_11088509 3300013296 Unclassified 819
152 Ga0157378_10000180 3300013297 Bacteria 60342
153 Ga0157378_10081746 3300013297 Bacteria 2920
154 Ga0163162_10014118 3300013306 Bacteria 7805
155 Ga0157372_10032519 3300013307 Bacteria 5721
156 Ga0157372_10264099 3300013307 Unclassified 1999
157 Ga0157372_10837468 3300013307 Bacteria 1068
158 Ga0163163_10002469 3300014325 Bacteria 15630
159 Ga0163163_10002705 3300014325 Bacteria 14974
160 Ga0157379_10047809 3300014968 Unclassified 3818
161 Ga0157379_10206812 3300014968 Bacteria 1776
162 Ga0157376_10000898 3300014969 Bacteria 19457
163 Ga0157376_11215732 3300014969 Bacteria 782
164 Ga0213876_10034843 3300021384 Bacteria 2655
165 Ga0224571_101525 3300022734 Unclassified 1453
166 Ga0224572_1016722 3300024225 Bacteria 1407
167 Ga0224572_1042129 3300024225 Unclassified 859
168 Ga0228598_1000256 3300024227 Bacteria 10236
169 Ga0228598_1007567 3300024227 Unclassified 2209
170 Ga0228598_1024596 3300024227 Bacteria 1185
171 Ga0207653_10001278 3300025885 Bacteria 8194
172 Ga0207710_10113132 3300025900 Unclassified 1290
173 Ga0207685_10093460 3300025905 Bacteria 1271
174 Ga0207699_10003359 3300025906 Bacteria 7624
175 Ga0207699_10005996 3300025906 Bacteria 5849
176 Ga0207699_10057460 3300025906 Bacteria 2323
177 Ga0207699_10100938 3300025906 Bacteria 1831
178 Ga0207699_10147080 3300025906 Unclassified 1555
179 Ga0207699_10219401 3300025906 Unclassified 1297
180 Ga0207699_10963418 3300025906 Unclassified 630
181 Ga0207684_10005080 3300025910 Bacteria 12269
182 Ga0207684_10047600 3300025910 Bacteria 3636
183 Ga0207684_10507502 3300025910 Bacteria 1033
184 Ga0207695_10065742 3300025913 Bacteria 3728
185 Ga0207693_10156130 3300025915 Unclassified 1795
186 Ga0207693_10167097 3300025915 Unclassified 1732
187 Ga0207693_10319421 3300025915 Unclassified 1215
188 Ga0207693_10534434 3300025915 Unclassified 915
189 Ga0207663_10021607 3300025916 Bacteria 3666
190 Ga0207663_10039175 3300025916 Bacteria 2870
191 Ga0207663_10066982 3300025916 Unclassified 2301
192 Ga0207663_10142269 3300025916 Unclassified 1672
193 Ga0207663_10893215 3300025916 Unclassified 710
194 Ga0207663_10899733 3300025916 Unclassified 708
195 Ga0207646_10000274 3300025922 Bacteria 70391
196 Ga0207646_10098711 3300025922 Bacteria 2617
197 Ga0207646_10133965 3300025922 Unclassified 2231
198 Ga0207646_10282589 3300025922 Bacteria 1500
199 Ga0207650_10761852 3300025925 Bacteria 819
200 Ga0207700_10054718 3300025928 Unclassified 2997
201 Ga0207700_10064419 3300025928 Unclassified 2792
202 Ga0207700_10128972 3300025928 Bacteria 2062
203 Ga0207700_10279076 3300025928 Bacteria 1437
204 Ga0207664_10156538 3300025929 Unclassified 1940
205 Ga0207664_10342676 3300025929 Bacteria 1322
206 Ga0207664_10528478 3300025929 Bacteria 1057
207 Ga0207664_10807003 3300025929 Unclassified 844
208 Ga0207704_10542688 3300025938 Unclassified 944
209 Ga0207665_10000285 3300025939 Bacteria 35244
210 Ga0207665_10000736 3300025939 Bacteria 22027
211 Ga0207665_10012797 3300025939 Bacteria 5518
212 Ga0207665_10042135 3300025939 Bacteria 3051
213 Ga0207665_10043608 3300025939 Bacteria 2999
214 Ga0207665_10056783 3300025939 Bacteria 2643
215 Ga0207665_10059278 3300025939 Bacteria 2590
216 Ga0207665_10157761 3300025939 Bacteria 1630
217 Ga0207665_10256636 3300025939 Unclassified 1294
218 Ga0207711_10087889 3300025941 Bacteria 2728
219 Ga0207661_10326737 3300025944 Unclassified 1380
220 Ga0207667_10217332 3300025949 Unclassified 1958
221 Ga0207658_10458713 3300025986 Bacteria 1129
222 Ga0207677_10328364 3300026023 Bacteria 1274
223 Ga0207703_10282111 3300026035 Bacteria 1509
224 Ga0207703_10811924 3300026035 Unclassified 893
225 Ga0207639_11469481 3300026041 Bacteria 640
226 Ga0207702_10545203 3300026078 Unclassified 1134
227 Ga0207641_10000892 3300026088 Bacteria 31121
228 Ga0207641_10066416 3300026088 Unclassified 3087
229 Ga0207648_10750938 3300026089 Bacteria 906
230 Ga0207676_10017820 3300026095 Bacteria 5153
231 Ga0207674_10070936 3300026116 Bacteria 3502
232 Ga0207683_10145516 3300026121 Bacteria 2137
233 Ga0209179_1015972 3300027512 Bacteria 1402
234 Ga0209588_1001745 3300027671 Bacteria 5756
235 Ga0209588_1004162 3300027671 Unclassified 4059
236 Ga0209588_1004676 3300027671 Unclassified 3882
237 Ga0209588_1013483 3300027671 Bacteria 2492
238 Ga0209588_1019540 3300027671 Unclassified 2115
239 Ga0209588_1030354 3300027671 Bacteria 1726
240 Ga0209588_1089559 3300027671 Unclassified 991
241 Ga0209588_1111618 3300027671 Unclassified 878
242 Ga0265354_1000234 3300028016 Bacteria 10030
243 Ga0268266_10000383 3300028379 Bacteria 67390
244 Ga0268264_10152910 3300028381 Bacteria 2071
245 Ga0265319_1018196 3300028563 Bacteria 2654
246 Ga0265338_10010175 3300028800 Bacteria 11087
247 Ga0265338_10043615 3300028800 Bacteria 4156
248 Ga0265338_10233894 3300028800 Bacteria 1365
249 Ga0265338_10602352 3300028800 Unclassified 765
250 Ga0265762_1009264 3300030760 Bacteria 1754
251 Ga0265770_1003128 3300030878 Bacteria 2247
252 Ga0265760_10002378 3300031090 Bacteria 5500
253 Ga0265760_10003058 3300031090 Bacteria 4883
254 Ga0265760_10015502 3300031090 Bacteria 2184
255 Ga0265760_10021986 3300031090 Bacteria 1847
256 Ga0265760_10100629 3300031090 Unclassified 913
257 Ga0265325_10020830 3300031241 Bacteria 3609
258 Ga0265325_10094273 3300031241 Bacteria 1472
259 Ga0307408_100074647 3300031548 Bacteria 2517
260 Ga0265313_10007829 3300031595 Bacteria 7214
261 Ga0307410_10007510 3300031852 Bacteria 5973
262 Ga0307406_10027836 3300031901 Bacteria 3410
263 Ga0307412_10773138 3300031911 Bacteria 831
264 Ga0307409_100128965 3300031995 Bacteria 2157
265 Ga0307409_100840687 3300031995 Unclassified 928
266 Ga0307414_10110419 3300032004 Unclassified 2092
267 Ga0307415_100012516 3300032126 Bacteria 4908
268 Ga0307510_10209077 3300033180 Unclassified 1476
269 Ga0373958_0125282 3300034819 Unclassified 624
270 Ga0373926_0004604 3300035083 Bacteria 4527
271 Ga0373934_0157834 3300035086 Unclassified 930
272 Ga0373944_0094627 3300035089 Unclassified 1002
273 Ga0373923_0066836 3300035111 Bacteria 1537
274 Ga0373923_0345228 3300035111 Unclassified 710
275 Ga0373945_0070111 3300035116 Bacteria 1325
276 Ga0373954_0211483 3300035118 Unclassified 953
277 Ga0373956_0079247 3300035119 Unclassified 1505
278 Ga0373957_0075491 3300035120 Unclassified 1324
279 Ga0373943_0073609 3300035170 Bacteria 1735
280 Ga0373943_0383494 3300035170 Unclassified 809
281 Ga0373946_0336452 3300035171 Unclassified 752
282 Ga0373955_0341582 3300035172 Unclassified 906
283 Ga0373924_0058529 3300035410 Unclassified 1609
284 Ga0373931_0070498 3300035691 Bacteria 1907
285 Ga0373931_0104110 3300035691 Bacteria 1600
286 Ga0373931_0133048 3300035691 Unclassified 1433
287 Ga0373935_0006925 3300035692 Bacteria 6766
288 Ga0373927_0013269 3300035695 Bacteria 5477
289 Ga0373933_0000116 3300035724 Bacteria 51474
290 Ga0373933_0195470 3300035724 Unclassified 1293
291 Ga0373947_0004986 3300035725 Bacteria 7772
292 Ga0373947_0012309 3300035725 Bacteria 4903
293 Ga0373947_0594253 3300035725 Unclassified 754
294 Ga0373937_0000001 3300036401 Bacteria 478903
295 Ga0373937_0014909 3300036401 Bacteria 6865
296 Ga0373937_0308066 3300036401 Bacteria 1497
297 Ga0373925_0080153 3300037068 Bacteria 2481
298 Ga0373925_0377963 3300037068 Bacteria 1153
299 Ga0395905_0034660 3300037471 Bacteria 4741
300 Ga0395905_0042627 3300037471 Bacteria 4258
301 Ga0395905_0117247 3300037471 Bacteria 2502
302 Ga0395905_0266151 3300037471 Bacteria 1600
303 Ga0395905_0680580 3300037471 Unclassified 931
304 Ga0436365_0286126 3300039437 Bacteria 1420
305 Ga0436365_0707009 3300039437 Unclassified 619
306 Ga0451577_0119095 3300042876 Bacteria 2365
307 Ga0466961_0086208 3300044693 Unclassified 1985
308 Ga0466963_0091094 3300044694 Bacteria 2076
309 Ga0453684_0808159 3300044712 Unclassified 1011
310 Ga0466957_0068387 3300044842 Bacteria 2193
311 Ga0466958_0055561 3300045836 Bacteria 2403
312 Ga0466958_0128000 3300045836 Bacteria 1593
313 Ga0466967_0000443 3300045976 Bacteria 19817
314 Ga0466967_0213114 3300045976 Bacteria 1833
315 Ga0466967_1331697 3300045976 Unclassified 715
316 Ga0466967_1865218 3300045976 Unclassified 598
317 Ga0495592_0551325 3300046454 Unclassified 709
318 Ga0495603_0008101 3300046455 Bacteria 6349
319 Ga0495603_0016213 3300046455 Bacteria 4508
320 Ga0495603_0029196 3300046455 Bacteria 3326
321 Ga0495629_0099462 3300046459 Unclassified 2029
322 Ga0495641_0058746 3300046461 Bacteria 1740
323 Ga0495641_0066826 3300046461 Unclassified 1617
324 Ga0495651_0000126 3300046462 Bacteria 56547
325 Ga0495651_0003935 3300046462 Bacteria 11354
326 Ga0495651_0029568 3300046462 Bacteria 4273
327 Ga0495653_0000818 3300046463 Bacteria 23898
328 Ga0495580_0000180 3300046472 Bacteria 47295
329 Ga0495580_0002134 3300046472 Bacteria 17341
330 Ga0495580_0002977 3300046472 Bacteria 14541
331 Ga0495580_0024147 3300046472 Bacteria 4456
332 Ga0495580_0043704 3300046472 Bacteria 3188
333 Ga0495580_0120671 3300046472 Unclassified 1820
334 Ga0495580_0124494 3300046472 Unclassified 1789
335 Ga0495580_0337427 3300046472 Unclassified 1023
336 Ga0495582_0001576 3300046473 Bacteria 12858
337 Ga0495582_0014224 3300046473 Bacteria 4377
338 Ga0495639_0002871 3300046475 Bacteria 7499
339 Ga0495639_0163550 3300046475 Bacteria 1078
340 Ga0495662_0146426 3300046476 Unclassified 1163
341 Ga0495664_0003137 3300046477 Bacteria 8976
342 Ga0495664_0054040 3300046477 Bacteria 2388
343 Ga0495594_0017413 3300046499 Bacteria 3797
344 Ga0495608_0005408 3300046511 Bacteria 9132
345 Ga0495608_0223219 3300046511 Unclassified 1181
346 Ga0495618_0278216 3300046514 Unclassified 1044
347 Ga0495628_0018986 3300046516 Bacteria 5688
348 Ga0495628_0229834 3300046516 Unclassified 1391
349 Ga0495630_0276618 3300046517 Unclassified 1282
350 Ga0495630_0488127 3300046517 Bacteria 944
351 Ga0495666_0025444 3300046526 Unclassified 2922
352 Ga0495666_0035964 3300046526 Bacteria 2412
353 Ga0495652_0003341 3300046529 Bacteria 15920
354 Ga0495652_0160462 3300046529 Bacteria 1746
355 Ga0495665_0013101 3300046531 Bacteria 4490
356 Ga0495640_0017956 3300046533 Bacteria 5259
357 Ga0495586_0000405 3300046535 Bacteria 26188
358 Ga0495587_0000087 3300046536 Bacteria 71152
359 Ga0495587_0006297 3300046536 Bacteria 7744
360 Ga0495587_0016945 3300046536 Bacteria 4531
361 Ga0495645_0025534 3300046543 Bacteria 4288
362 Ga0495645_0093171 3300046543 Bacteria 2150
363 Ga0495645_0179697 3300046543 Unclassified 1450
364 Ga0495667_0001854 3300046559 Bacteria 14023
365 Ga0495667_0037961 3300046559 Bacteria 3209
366 Ga0495667_0085588 3300046559 Unclassified 2046
367 Ga0495634_0062331 3300046642 Bacteria 2476
368 Ga0495635_0009757 3300046663 Bacteria 6710
369 Ga0495635_0092657 3300046663 Bacteria 2066
370 Ga0495635_0127018 3300046663 Bacteria 1739
371 Ga0495657_0018325 3300046675 Bacteria 5071
372 Ga0495623_0004839 3300046679 Bacteria 8832
373 Ga0495623_0038415 3300046679 Bacteria 3061
374 Ga0495646_0010050 3300046680 Bacteria 6018
375 Ga0495647_0040728 3300046681 Unclassified 1766
376 Ga0495658_0022033 3300046683 Bacteria 3365
377 Ga0495669_0001577 3300046684 Bacteria 9377
378 Ga0495669_0244118 3300046684 Unclassified 862
379 Ga0495613_0053129 3300046689 Bacteria 2982
380 Ga0495613_0062632 3300046689 Bacteria 2721
381 Ga0495624_0002046 3300046690 Bacteria 15356
382 Ga0495624_0012387 3300046690 Bacteria 5833
383 Ga0495581_0012137 3300047315 Bacteria 4987
384 Ga0495581_0019843 3300047315 Bacteria 3903
385 Ga0495604_0004735 3300047317 Bacteria 10779
386 Ga0495604_0025859 3300047317 Bacteria 4675
387 Ga0495674_0029942 3300047319 Bacteria 4953
388 Ga0495674_0081508 3300047319 Unclassified 2775
389 Ga0495674_0117694 3300047319 Bacteria 2247
390 Ga0495676_0048987 3300047321 Bacteria 3401
391 Ga0495680_0000253 3300047322 Bacteria 59346
392 Ga0495680_0052092 3300047322 Bacteria 3192
393 Ga0495680_0431592 3300047322 Unclassified 905
394 Ga0495675_0000227 3300047444 Bacteria 40596
395 Ga0495675_0004291 3300047444 Bacteria 8628
396 Ga0495675_0038394 3300047444 Unclassified 3049
397 Ga0495675_0507402 3300047444 Unclassified 692
398 Ga0495684_0001064 3300047471 Bacteria 22213
399 Ga0495684_0063801 3300047471 Bacteria 2800
400 Ga0495593_0001389 3300047673 Bacteria 14171
401 Ga0495593_0011904 3300047673 Bacteria 4989
402 Ga0495602_0000086 3300048088 Bacteria 90226
403 Ga0495602_0008554 3300048088 Bacteria 10687
404 Ga0495602_0097944 3300048088 Unclassified 2415
405 Ga0495614_0008332 3300048089 Bacteria 4614
406 Ga0495614_0044589 3300048089 Unclassified 1902
407 Ga0496100_0013974 3300048903 Bacteria 4649
408 Ga0496102_0008552 3300048905 Bacteria 8778
409 Ga0496102_1358297 3300048905 Unclassified 630
410 Ga0496104_0007570 3300048907 Bacteria 9609
411 Ga0496104_0278487 3300048907 Unclassified 1586
412 Ga0496104_0833124 3300048907 Unclassified 828
413 Ga0496105_0056116 3300048908 Bacteria 3252
414 Ga0496105_0059057 3300048908 Bacteria 3165
415 Ga0496107_0067014 3300048910 Bacteria 2604
416 Ga0496108_0566674 3300048911 Unclassified 990
417 Ga0496109_0042574 3300048912 Bacteria 4114
418 Ga0496109_1247426 3300048912 Unclassified 680
419 Ga0496110_0824673 3300048913 Unclassified 832
420 Ga0496110_1004622 3300048913 Unclassified 742
421 Ga0496112_0202940 3300048915 Bacteria 1941
422 Ga0496112_0240356 3300048915 Unclassified 1764
423 Ga0496113_0356145 3300048916 Bacteria 1174
424 Ga0496113_1166188 3300048916 Unclassified 602
425 Ga0496114_0007943 3300048917 Bacteria 8397
426 Ga0496114_0016164 3300048917 Bacteria 6007
427 Ga0496115_0014308 3300048918 Bacteria 6006
428 Ga0496115_0091110 3300048918 Unclassified 2491
429 Ga0501291_031660 3300049514 Unclassified 895
430 Ga0501296_032556 3300049519 Unclassified 708
431 Ga0501249_071392 3300049679 Unclassified 811
432 Ga0501234_011845 3300049707 Archaea 1365
433 nmdc:mga0n895_113855_c1 3300050512 Bacteria 2723
434 nmdc:mga0n895_123947_c1 3300050512 Bacteria 2606
435 nmdc:mga0n895_619722_c1 3300050512 Bacteria 1083
436 nmdc:mga0n895_94982_c1 3300050512 Bacteria 2986
437 nmdc:mga0rr50_177424_c1 3300050513 Bacteria 1740
438 nmdc:mga08x19_10431_c1 3300050514 Bacteria 5578
439 nmdc:mga08x19_130741_c1 3300050514 Bacteria 1688
440 nmdc:mga08x19_184749_c1 3300050514 Bacteria 988
441 nmdc:mga08x19_410009_c1 3300050514 Unclassified 951
442 nmdc:mga08x19_610675_c1 3300050514 Unclassified 773
443 nmdc:mga08x19_67277_c1 3300050514 Bacteria 2330
444 Ga0495601_0006435 3300053077 Bacteria 6870
445 Ga0495612_0000267 3300053078 Bacteria 21484
446 Ga0070699_100215818
447 MBSR1b_contig_6683619
448 Ga0070658_10902467
449 Ga0070683_100262711
450 Ga0070690_100220661
451 Ga0070670_100062528
452 Ga0070671_100233131
453 Ga0070659_100560368
454 Ga0070667_100499068
455 Ga0070703_10001114
456 Ga0070709_10004747
457 Ga0070709_10134780
458 Ga0070709_10177566
459 Ga0070709_10200535
460 Ga0070709_10537372
461 Ga0070709_10538301
462 Ga0070709_10673598
463 Ga0070714_100116738
464 Ga0070714_100760617
465 Ga0070713_100000739
466 Ga0070713_100004311
467 Ga0070713_100064833
468 Ga0070713_100188707
469 Ga0070713_100188889
470 Ga0070713_100458808
471 Ga0070713_100606603
472 Ga0070713_100661876
473 Ga0070710_10358730
474 Ga0070710_10517791
475 Ga0070711_100016956
476 Ga0070711_100032242
477 Ga0070711_100091112
478 Ga0070711_100156627
479 Ga0070711_100241110
480 Ga0070711_101186908
481 Ga0070705_100001481
482 Ga0070705_100274088
483 Ga0070700_100708799
484 Ga0070694_100042892
485 Ga0070694_100252160
486 Ga0070708_100001228
487 Ga0070708_100012182
488 Ga0070708_100387391
489 Ga0070678_100543501
490 Ga0068867_101066042
491 Ga0070706_100005421
492 Ga0070706_100181628
493 Ga0070706_100432188
494 Ga0070707_100009899
495 Ga0070707_100052759
496 Ga0070707_100159439
497 Ga0070707_100253749
498 Ga0070707_100322931
499 Ga0070707_101361600
500 Ga0070698_100011516
501 Ga0070698_100013182
502 Ga0070698_100245613
503 Ga0070699_100007937
504 Ga0070699_100163207
505 Ga0070699_100476942
506 Ga0070679_100026004
507 Ga0070679_100201351
508 Ga0070679_101232776
509 Ga0070684_100153050
510 Ga0070697_100000298
511 Ga0070697_100024317
512 Ga0070697_100046380
513 Ga0070697_100163013
514 Ga0070697_100907040
515 Ga0068853_100891124
516 Ga0070695_100001240
517 Ga0070696_100000331
518 Ga0070693_100000020
519 Ga0070693_100264681
520 Ga0070665_100001001
521 Ga0070704_100000909
522 Ga0070704_100133285
523 Ga0068855_100786774
524 Ga0068857_100052374
525 Ga0068856_100305763
526 Ga0068864_100053055
527 Ga0068866_10036988
528 Ga0068863_100001570
529 Ga0068863_100017143
530 Ga0068858_100644346
531 Ga0068860_100158532
532 Ga0068860_100632948
533 Ga0081540_1135958
534 Ga0070717_10105825
535 Ga0070717_10256623
536 Ga0070717_10346031
537 Ga0070717_10356675
538 Ga0070717_10909023
539 Ga0070715_10041485
540 Ga0070715_10115763
541 Ga0070715_10155810
542 Ga0070716_100006438
543 Ga0070716_100024798
544 Ga0070716_100078032
545 Ga0070716_100117529
546 Ga0070716_100133489
547 Ga0070716_100222042
548 Ga0070716_100640141
549 Ga0070712_100020001
550 Ga0070712_100026969
551 Ga0070712_100259094
552 Ga0070712_100327983
553 Ga0070712_100439876
554 Ga0097621_100022450
555 Ga0075433_10518792
556 Ga0075433_10534127
557 Ga0075434_100023117
558 Ga0075434_100106251
559 Ga0075434_100178317
560 Ga0075434_100238105
561 Ga0068865_100349699
562 Ga0075436_100001967
563 Ga0075436_100035357
564 Ga0075436_100119474
565 Ga0075436_100405396
566 Ga0075436_100589683
567 Ga0075435_100086148
568 Ga0099794_10001741
569 Ga0099794_10017386
570 Ga0099794_10018531
571 Ga0099794_10070900
572 Ga0099794_10081737
573 Ga0099794_10093691
574 Ga0099794_10196026
575 Ga0099795_10003858
576 Ga0099795_10010751
577 Ga0099795_10011162
578 Ga0105240_10006795
579 Ga0105245_10129215
580 Ga0105247_10080010
581 Ga0105247_10710765
582 Ga0105242_10408456
583 Ga0105242_10758410
584 Ga0105248_10024351
585 Ga0105248_10040516
586 Ga0105248_11744904
587 Ga0105237_10285205
588 Ga0105238_10311064
589 Ga0105238_11473548
590 Ga0099796_10062205
591 Ga0099796_10132036
592 Ga0105239_10067448
593 Ga0157370_10502513
594 Ga0157369_10626143
595 Ga0157374_10078007
596 Ga0157374_11088509
597 Ga0157378_10000180
598 Ga0157378_10081746
599 Ga0163162_10014118
600 Ga0157372_10032519
601 Ga0157372_10264099
602 Ga0157372_10837468
603 Ga0163163_10002469
604 Ga0163163_10002705
605 Ga0157379_10047809
606 Ga0157379_10206812
607 Ga0157376_10000898
608 Ga0157376_11215732
609 Ga0213876_10034843
610 Ga0224571_101525
611 Ga0224572_1016722
612 Ga0224572_1042129
613 Ga0228598_1000256
614 Ga0228598_1007567
615 Ga0228598_1024596
616 Ga0207653_10001278
617 Ga0207710_10113132
618 Ga0207685_10093460
619 Ga0207699_10003359
620 Ga0207699_10005996
621 Ga0207699_10057460
622 Ga0207699_10100938
623 Ga0207699_10147080
624 Ga0207699_10219401
625 Ga0207699_10963418
626 Ga0207684_10005080
627 Ga0207684_10047600
628 Ga0207684_10507502
629 Ga0207695_10065742
630 Ga0207693_10156130
631 Ga0207693_10167097
632 Ga0207693_10319421
633 Ga0207693_10534434
634 Ga0207663_10021607
635 Ga0207663_10039175
636 Ga0207663_10066982
637 Ga0207663_10142269
638 Ga0207663_10893215
639 Ga0207663_10899733
640 Ga0207646_10000274
641 Ga0207646_10098711
642 Ga0207646_10133965
643 Ga0207646_10282589
644 Ga0207650_10761852
645 Ga0207700_10054718
646 Ga0207700_10064419
647 Ga0207700_10128972
648 Ga0207700_10279076
649 Ga0207664_10156538
650 Ga0207664_10342676
651 Ga0207664_10528478
652 Ga0207664_10807003
653 Ga0207704_10542688
654 Ga0207665_10000285
655 Ga0207665_10000736
656 Ga0207665_10012797
657 Ga0207665_10042135
658 Ga0207665_10043608
659 Ga0207665_10056783
660 Ga0207665_10059278
661 Ga0207665_10157761
662 Ga0207665_10256636
663 Ga0207711_10087889
664 Ga0207661_10326737
665 Ga0207667_10217332
666 Ga0207658_10458713
667 Ga0207677_10328364
668 Ga0207703_10282111
669 Ga0207703_10811924
670 Ga0207639_11469481
671 Ga0207702_10545203
672 Ga0207641_10000892
673 Ga0207641_10066416
674 Ga0207648_10750938
675 Ga0207676_10017820
676 Ga0207674_10070936
677 Ga0207683_10145516
678 Ga0209179_1015972
679 Ga0209588_1001745
680 Ga0209588_1004162
681 Ga0209588_1004676
682 Ga0209588_1013483
683 Ga0209588_1019540
684 Ga0209588_1030354
685 Ga0209588_1089559
686 Ga0209588_1111618
687 Ga0265354_1000234
688 Ga0268266_10000383
689 Ga0268264_10152910
690 Ga0265319_1018196
691 Ga0265338_10010175
692 Ga0265338_10043615
693 Ga0265338_10233894
694 Ga0265338_10602352
695 Ga0265762_1009264
696 Ga0265770_1003128
697 Ga0265760_10002378
698 Ga0265760_10003058
699 Ga0265760_10015502
700 Ga0265760_10021986
701 Ga0265760_10100629
702 Ga0265325_10020830
703 Ga0265325_10094273
704 Ga0307408_100074647
705 Ga0265313_10007829
706 Ga0307410_10007510
707 Ga0307406_10027836
708 Ga0307412_10773138
709 Ga0307409_100128965
710 Ga0307409_100840687
711 Ga0307414_10110419
712 Ga0307415_100012516
713 Ga0307510_10209077
714 Ga0373958_0125282
715 Ga0373926_0004604
716 Ga0373934_0157834
717 Ga0373944_0094627
718 Ga0373923_0066836
719 Ga0373923_0345228
720 Ga0373945_0070111
721 Ga0373954_0211483
722 Ga0373956_0079247
723 Ga0373957_0075491
724 Ga0373943_0073609
725 Ga0373943_0383494
726 Ga0373946_0336452
727 Ga0373955_0341582
728 Ga0373924_0058529
729 Ga0373931_0070498
730 Ga0373931_0104110
731 Ga0373931_0133048
732 Ga0373935_0006925
733 Ga0373927_0013269
734 Ga0373933_0000116
735 Ga0373933_0195470
736 Ga0373947_0004986
737 Ga0373947_0012309
738 Ga0373947_0594253
739 Ga0373937_0000001
740 Ga0373937_0014909
741 Ga0373937_0308066
742 Ga0373925_0080153
743 Ga0373925_0377963
744 Ga0395905_0034660
745 Ga0395905_0042627
746 Ga0395905_0117247
747 Ga0395905_0266151
748 Ga0395905_0680580
749 Ga0436365_0286126
750 Ga0436365_0707009
751 Ga0451577_0119095
752 Ga0466961_0086208
753 Ga0466963_0091094
754 Ga0453684_0808159
755 Ga0466957_0068387
756 Ga0466958_0055561
757 Ga0466958_0128000
758 Ga0466967_0000443
759 Ga0466967_0213114
760 Ga0466967_1331697
761 Ga0466967_1865218
762 Ga0495592_0551325
763 Ga0495603_0008101
764 Ga0495603_0016213
765 Ga0495603_0029196
766 Ga0495629_0099462
767 Ga0495641_0058746
768 Ga0495641_0066826
769 Ga0495651_0000126
770 Ga0495651_0003935
771 Ga0495651_0029568
772 Ga0495653_0000818
773 Ga0495580_0000180
774 Ga0495580_0002134
775 Ga0495580_0002977
776 Ga0495580_0024147
777 Ga0495580_0043704
778 Ga0495580_0120671
779 Ga0495580_0124494
780 Ga0495580_0337427
781 Ga0495582_0001576
782 Ga0495582_0014224
783 Ga0495639_0002871
784 Ga0495639_0163550
785 Ga0495662_0146426
786 Ga0495664_0003137
787 Ga0495664_0054040
788 Ga0495594_0017413
789 Ga0495608_0005408
790 Ga0495608_0223219
791 Ga0495618_0278216
792 Ga0495628_0018986
793 Ga0495628_0229834
794 Ga0495630_0276618
795 Ga0495630_0488127
796 Ga0495666_0025444
797 Ga0495666_0035964
798 Ga0495652_0003341
799 Ga0495652_0160462
800 Ga0495665_0013101
801 Ga0495640_0017956
802 Ga0495586_0000405
803 Ga0495587_0000087
804 Ga0495587_0006297
805 Ga0495587_0016945
806 Ga0495645_0025534
807 Ga0495645_0093171
808 Ga0495645_0179697
809 Ga0495667_0001854
810 Ga0495667_0037961
811 Ga0495667_0085588
812 Ga0495634_0062331
813 Ga0495635_0009757
814 Ga0495635_0092657
815 Ga0495635_0127018
816 Ga0495657_0018325
817 Ga0495623_0004839
818 Ga0495623_0038415
819 Ga0495646_0010050
820 Ga0495647_0040728
821 Ga0495658_0022033
822 Ga0495669_0001577
823 Ga0495669_0244118
824 Ga0495613_0053129
825 Ga0495613_0062632
826 Ga0495624_0002046
827 Ga0495624_0012387
828 Ga0495581_0012137
829 Ga0495581_0019843
830 Ga0495604_0004735
831 Ga0495604_0025859
832 Ga0495674_0029942
833 Ga0495674_0081508
834 Ga0495674_0117694
835 Ga0495676_0048987
836 Ga0495680_0000253
837 Ga0495680_0052092
838 Ga0495680_0431592
839 Ga0495675_0000227
840 Ga0495675_0004291
841 Ga0495675_0038394
842 Ga0495675_0507402
843 Ga0495684_0001064
844 Ga0495684_0063801
845 Ga0495593_0001389
846 Ga0495593_0011904
847 Ga0495602_0000086
848 Ga0495602_0008554
849 Ga0495602_0097944
850 Ga0495614_0008332
851 Ga0495614_0044589
852 Ga0496100_0013974
853 Ga0496102_0008552
854 Ga0496102_1358297
855 Ga0496104_0007570
856 Ga0496104_0278487
857 Ga0496104_0833124
858 Ga0496105_0056116
859 Ga0496105_0059057
860 Ga0496107_0067014
861 Ga0496108_0566674
862 Ga0496109_0042574
863 Ga0496109_1247426
864 Ga0496110_0824673
865 Ga0496110_1004622
866 Ga0496112_0202940
867 Ga0496112_0240356
868 Ga0496113_0356145
869 Ga0496113_1166188
870 Ga0496114_0007943
871 Ga0496114_0016164
872 Ga0496115_0014308
873 Ga0496115_0091110
874 Ga0501291_031660
875 Ga0501296_032556
876 Ga0501249_071392
877 Ga0501234_011845
878 nmdc:mga0n895_113855_c1
879 nmdc:mga0n895_123947_c1
880 nmdc:mga0n895_619722_c1
881 nmdc:mga0n895_94982_c1
882 nmdc:mga0rr50_177424_c1
883 nmdc:mga08x19_10431_c1
884 nmdc:mga08x19_130741_c1
885 nmdc:mga08x19_184749_c1
886 nmdc:mga08x19_410009_c1
887 nmdc:mga08x19_610675_c1
888 nmdc:mga08x19_67277_c1
889 Ga0495601_0006435
890 Ga0495612_0000267

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01584

CheW

CheW-like domain

51

187

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qdl-assembly2.cif.gz_B crystal structure of scaffolding protein ttchew from thermoanaerobacter tengcongensis 0.7975 32 163
3ja6-assembly1.cif.gz_F cryo-electron tomography and all-atom molecular dynamics simulations reveal a novel kinase conformational switch in bacterial chemotaxis signaling 0.7919 32 168
4jpb-assembly1.cif.gz_W the structure of a ternary complex between chea domains p4 and p5 with chew and with an unzipped fragment of tm14, a chemoreceptor analog from thermotoga maritima. 0.7878 33 170
2qdl-assembly1.cif.gz_A crystal structure of scaffolding protein ttchew from thermoanaerobacter tengcongensis 0.7851 32 163
3ja6-assembly1.cif.gz_F cryo-electron tomography and all-atom molecular dynamics simulations reveal a novel kinase conformational switch in bacterial chemotaxis signaling 0.7618 32 168
ID Description Score Start End Superfamily
2qdlB01 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.7973 33 161 2.30.30.40
2qdlB01 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.7748 33 161 2.30.30.40
2ch4W02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.7202 52 123 2.40.50.180
1b3qB04 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.6783 53 122 2.40.50.180
2qdlB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.6713 53 123 2.40.50.180
ID Description Score Start End GO Terms
AF-A0A353YYY3-F1-model_v4 CheW-like domain-containing protein 0.8391 30 166 GO:0005829
GO:0006935
GO:0007165
AF-A0A848LMB0-F1-model_v4 Purine-binding chemotaxis protein CheW 0.8292 33 168 GO:0005829
GO:0006935
GO:0007165
AF-A0A2J6ID41-F1-model_v4 CheW-like domain-containing protein 0.8287 33 172 GO:0005829
GO:0006935
GO:0007165
AF-A0A2E6UDM5-F1-model_v4 deleted 0.8248 33 167
AF-A0A1G3MQB3-F1-model_v4 CheW-like domain-containing protein 0.8247 33 168 GO:0005829
GO:0006935
GO:0007165

Map