F445449
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 445 | 217 | 890 | 175 |
Family's Representative Sequence
| Representative Sequence | 3300005518|Ga0070699_100215818|Ga0070699_1002158181 |
| Length | 192 |
| Sequence | MSDEYKSERALEHEPGLLAVEPGGDDPREFSDTLEPLDGEAIAAQRSPESQYCVFRAGRERFCLSVLLVEEVVDWPPITRVPLGPSFLMGVFNLRGSIVPLVDIAFTEGRRAGLSPRHVVVAALLDNAHPTCLRFGIAADEVIGTYTAADDALLDQMPSDVPHCRGMLRHDDRLALVLDLPRMIEVFPVPVI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 43 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 49 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 50 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 51 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 52 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 53 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 54 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 55 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 63 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 74 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 75 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 76 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 77 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 107 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 110 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 111 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 113 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 114 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 115 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 116 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 117 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 118 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 119 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 120 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 121 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 122 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 123 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 124 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 125 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 126 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 127 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 128 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 129 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 130 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 131 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 132 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 133 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 134 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 135 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 136 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 137 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 138 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 139 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 140 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 141 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 142 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 143 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 144 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 145 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 146 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 147 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 148 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 149 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 150 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 151 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 152 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 153 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 199 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 200 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 201 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 202 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 205 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 206 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 207 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 208 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 209 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 210 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 211 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 212 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 213 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.43 |
| Metatranscriptomes | 1.57 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.94 |
| Rhizosphere | 94.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 35.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070699_100215818 | 3300005518 | Unclassified | 1709 |
| 2 | MBSR1b_contig_6683619 | 2162886012 | Bacteria | 1011 |
| 3 | Ga0070658_10902467 | 3300005327 | Unclassified | 768 |
| 4 | Ga0070683_100262711 | 3300005329 | Unclassified | 1642 |
| 5 | Ga0070690_100220661 | 3300005330 | Bacteria | 1328 |
| 6 | Ga0070670_100062528 | 3300005331 | Bacteria | 3196 |
| 7 | Ga0070671_100233131 | 3300005355 | Unclassified | 1562 |
| 8 | Ga0070659_100560368 | 3300005366 | Unclassified | 979 |
| 9 | Ga0070667_100499068 | 3300005367 | Bacteria | 1115 |
| 10 | Ga0070703_10001114 | 3300005406 | Bacteria | 8337 |
| 11 | Ga0070709_10004747 | 3300005434 | Bacteria | 7339 |
| 12 | Ga0070709_10134780 | 3300005434 | Bacteria | 1690 |
| 13 | Ga0070709_10177566 | 3300005434 | Unclassified | 1493 |
| 14 | Ga0070709_10200535 | 3300005434 | Unclassified | 1413 |
| 15 | Ga0070709_10537372 | 3300005434 | Unclassified | 893 |
| 16 | Ga0070709_10538301 | 3300005434 | Unclassified | 892 |
| 17 | Ga0070709_10673598 | 3300005434 | Unclassified | 803 |
| 18 | Ga0070714_100116738 | 3300005435 | Bacteria | 2369 |
| 19 | Ga0070714_100760617 | 3300005435 | Unclassified | 937 |
| 20 | Ga0070713_100000739 | 3300005436 | Bacteria | 20944 |
| 21 | Ga0070713_100004311 | 3300005436 | Bacteria | 9534 |
| 22 | Ga0070713_100064833 | 3300005436 | Unclassified | 3067 |
| 23 | Ga0070713_100188707 | 3300005436 | Bacteria | 1856 |
| 24 | Ga0070713_100188889 | 3300005436 | Bacteria | 1855 |
| 25 | Ga0070713_100458808 | 3300005436 | Bacteria | 1198 |
| 26 | Ga0070713_100606603 | 3300005436 | Bacteria | 1040 |
| 27 | Ga0070713_100661876 | 3300005436 | Unclassified | 995 |
| 28 | Ga0070710_10358730 | 3300005437 | Bacteria | 967 |
| 29 | Ga0070710_10517791 | 3300005437 | Bacteria | 819 |
| 30 | Ga0070711_100016956 | 3300005439 | Unclassified | 4632 |
| 31 | Ga0070711_100032242 | 3300005439 | Bacteria | 3482 |
| 32 | Ga0070711_100091112 | 3300005439 | Unclassified | 2197 |
| 33 | Ga0070711_100156627 | 3300005439 | Bacteria | 1723 |
| 34 | Ga0070711_100241110 | 3300005439 | Bacteria | 1414 |
| 35 | Ga0070711_101186908 | 3300005439 | Unclassified | 660 |
| 36 | Ga0070705_100001481 | 3300005440 | Bacteria | 12417 |
| 37 | Ga0070705_100274088 | 3300005440 | Unclassified | 1196 |
| 38 | Ga0070700_100708799 | 3300005441 | Unclassified | 801 |
| 39 | Ga0070694_100042892 | 3300005444 | Unclassified | 3023 |
| 40 | Ga0070694_100252160 | 3300005444 | Bacteria | 1335 |
| 41 | Ga0070708_100001228 | 3300005445 | Bacteria | 19731 |
| 42 | Ga0070708_100012182 | 3300005445 | Bacteria | 7011 |
| 43 | Ga0070708_100387391 | 3300005445 | Unclassified | 1318 |
| 44 | Ga0070678_100543501 | 3300005456 | Unclassified | 1030 |
| 45 | Ga0068867_101066042 | 3300005459 | Bacteria | 736 |
| 46 | Ga0070706_100005421 | 3300005467 | Bacteria | 12149 |
| 47 | Ga0070706_100181628 | 3300005467 | Bacteria | 1964 |
| 48 | Ga0070706_100432188 | 3300005467 | Unclassified | 1225 |
| 49 | Ga0070707_100009899 | 3300005468 | Bacteria | 8874 |
| 50 | Ga0070707_100052759 | 3300005468 | Unclassified | 3899 |
| 51 | Ga0070707_100159439 | 3300005468 | Unclassified | 2198 |
| 52 | Ga0070707_100253749 | 3300005468 | Bacteria | 1712 |
| 53 | Ga0070707_100322931 | 3300005468 | Bacteria | 1500 |
| 54 | Ga0070707_101361600 | 3300005468 | Bacteria | 676 |
| 55 | Ga0070698_100011516 | 3300005471 | Bacteria | 9387 |
| 56 | Ga0070698_100013182 | 3300005471 | Bacteria | 8746 |
| 57 | Ga0070698_100245613 | 3300005471 | Unclassified | 1723 |
| 58 | Ga0070699_100007937 | 3300005518 | Bacteria | 9219 |
| 59 | Ga0070699_100163207 | 3300005518 | Unclassified | 1972 |
| 60 | Ga0070699_100476942 | 3300005518 | Bacteria | 1132 |
| 61 | Ga0070679_100026004 | 3300005530 | Bacteria | 5744 |
| 62 | Ga0070679_100201351 | 3300005530 | Bacteria | 1957 |
| 63 | Ga0070679_101232776 | 3300005530 | Unclassified | 693 |
| 64 | Ga0070684_100153050 | 3300005535 | Unclassified | 2090 |
| 65 | Ga0070697_100000298 | 3300005536 | Bacteria | 39662 |
| 66 | Ga0070697_100024317 | 3300005536 | Bacteria | 4822 |
| 67 | Ga0070697_100046380 | 3300005536 | Bacteria | 3522 |
| 68 | Ga0070697_100163013 | 3300005536 | Unclassified | 1884 |
| 69 | Ga0070697_100907040 | 3300005536 | Bacteria | 782 |
| 70 | Ga0068853_100891124 | 3300005539 | Unclassified | 854 |
| 71 | Ga0070695_100001240 | 3300005545 | Bacteria | 14031 |
| 72 | Ga0070696_100000331 | 3300005546 | Bacteria | 28813 |
| 73 | Ga0070693_100000020 | 3300005547 | Bacteria | 59763 |
| 74 | Ga0070693_100264681 | 3300005547 | Bacteria | 1145 |
| 75 | Ga0070665_100001001 | 3300005548 | Bacteria | 35846 |
| 76 | Ga0070704_100000909 | 3300005549 | Bacteria | 14859 |
| 77 | Ga0070704_100133285 | 3300005549 | Unclassified | 1929 |
| 78 | Ga0068855_100786774 | 3300005563 | Unclassified | 1012 |
| 79 | Ga0068857_100052374 | 3300005577 | Bacteria | 3622 |
| 80 | Ga0068856_100305763 | 3300005614 | Unclassified | 1608 |
| 81 | Ga0068864_100053055 | 3300005618 | Bacteria | 3496 |
| 82 | Ga0068866_10036988 | 3300005718 | Bacteria | 2395 |
| 83 | Ga0068863_100001570 | 3300005841 | Bacteria | 22600 |
| 84 | Ga0068863_100017143 | 3300005841 | Bacteria | 6946 |
| 85 | Ga0068858_100644346 | 3300005842 | Bacteria | 1029 |
| 86 | Ga0068860_100158532 | 3300005843 | Unclassified | 2181 |
| 87 | Ga0068860_100632948 | 3300005843 | Bacteria | 1077 |
| 88 | Ga0081540_1135958 | 3300005983 | Bacteria | 995 |
| 89 | Ga0070717_10105825 | 3300006028 | Unclassified | 2395 |
| 90 | Ga0070717_10256623 | 3300006028 | Unclassified | 1546 |
| 91 | Ga0070717_10346031 | 3300006028 | Unclassified | 1328 |
| 92 | Ga0070717_10356675 | 3300006028 | Unclassified | 1308 |
| 93 | Ga0070717_10909023 | 3300006028 | Unclassified | 801 |
| 94 | Ga0070715_10041485 | 3300006163 | Bacteria | 1929 |
| 95 | Ga0070715_10115763 | 3300006163 | Unclassified | 1271 |
| 96 | Ga0070715_10155810 | 3300006163 | Bacteria | 1124 |
| 97 | Ga0070716_100006438 | 3300006173 | Bacteria | 5737 |
| 98 | Ga0070716_100024798 | 3300006173 | Bacteria | 3194 |
| 99 | Ga0070716_100078032 | 3300006173 | Unclassified | 1967 |
| 100 | Ga0070716_100117529 | 3300006173 | Unclassified | 1659 |
| 101 | Ga0070716_100133489 | 3300006173 | Bacteria | 1573 |
| 102 | Ga0070716_100222042 | 3300006173 | Unclassified | 1270 |
| 103 | Ga0070716_100640141 | 3300006173 | Unclassified | 805 |
| 104 | Ga0070712_100020001 | 3300006175 | Bacteria | 4377 |
| 105 | Ga0070712_100026969 | 3300006175 | Bacteria | 3832 |
| 106 | Ga0070712_100259094 | 3300006175 | Unclassified | 1393 |
| 107 | Ga0070712_100327983 | 3300006175 | Unclassified | 1246 |
| 108 | Ga0070712_100439876 | 3300006175 | Unclassified | 1084 |
| 109 | Ga0097621_100022450 | 3300006237 | Bacteria | 4899 |
| 110 | Ga0075433_10518792 | 3300006852 | Bacteria | 1048 |
| 111 | Ga0075433_10534127 | 3300006852 | Unclassified | 1031 |
| 112 | Ga0075434_100023117 | 3300006871 | Bacteria | 6054 |
| 113 | Ga0075434_100106251 | 3300006871 | Bacteria | 2817 |
| 114 | Ga0075434_100178317 | 3300006871 | Bacteria | 2144 |
| 115 | Ga0075434_100238105 | 3300006871 | Unclassified | 1840 |
| 116 | Ga0068865_100349699 | 3300006881 | Bacteria | 1197 |
| 117 | Ga0075436_100001967 | 3300006914 | Bacteria | 14161 |
| 118 | Ga0075436_100035357 | 3300006914 | Bacteria | 3447 |
| 119 | Ga0075436_100119474 | 3300006914 | Bacteria | 1843 |
| 120 | Ga0075436_100405396 | 3300006914 | Bacteria | 988 |
| 121 | Ga0075436_100589683 | 3300006914 | Bacteria | 818 |
| 122 | Ga0075435_100086148 | 3300007076 | Bacteria | 2586 |
| 123 | Ga0099794_10001741 | 3300007265 | Bacteria | 7730 |
| 124 | Ga0099794_10017386 | 3300007265 | Bacteria | 3204 |
| 125 | Ga0099794_10018531 | 3300007265 | Bacteria | 3123 |
| 126 | Ga0099794_10070900 | 3300007265 | Unclassified | 1707 |
| 127 | Ga0099794_10081737 | 3300007265 | Unclassified | 1594 |
| 128 | Ga0099794_10093691 | 3300007265 | Unclassified | 1493 |
| 129 | Ga0099794_10196026 | 3300007265 | Unclassified | 1034 |
| 130 | Ga0099795_10003858 | 3300007788 | Bacteria | 3777 |
| 131 | Ga0099795_10010751 | 3300007788 | Unclassified | 2709 |
| 132 | Ga0099795_10011162 | 3300007788 | Unclassified | 2674 |
| 133 | Ga0105240_10006795 | 3300009093 | Bacteria | 16736 |
| 134 | Ga0105245_10129215 | 3300009098 | Bacteria | 2368 |
| 135 | Ga0105247_10080010 | 3300009101 | Unclassified | 2057 |
| 136 | Ga0105247_10710765 | 3300009101 | Unclassified | 757 |
| 137 | Ga0105242_10408456 | 3300009176 | Bacteria | 1269 |
| 138 | Ga0105242_10758410 | 3300009176 | Unclassified | 956 |
| 139 | Ga0105248_10024351 | 3300009177 | Bacteria | 6732 |
| 140 | Ga0105248_10040516 | 3300009177 | Bacteria | 5222 |
| 141 | Ga0105248_11744904 | 3300009177 | Unclassified | 706 |
| 142 | Ga0105237_10285205 | 3300009545 | Bacteria | 1654 |
| 143 | Ga0105238_10311064 | 3300009551 | Bacteria | 1560 |
| 144 | Ga0105238_11473548 | 3300009551 | Unclassified | 709 |
| 145 | Ga0099796_10062205 | 3300010159 | Bacteria | 1326 |
| 146 | Ga0099796_10132036 | 3300010159 | Unclassified | 969 |
| 147 | Ga0105239_10067448 | 3300010375 | Bacteria | 3930 |
| 148 | Ga0157370_10502513 | 3300013104 | Unclassified | 1113 |
| 149 | Ga0157369_10626143 | 3300013105 | Unclassified | 1110 |
| 150 | Ga0157374_10078007 | 3300013296 | Bacteria | 3136 |
| 151 | Ga0157374_11088509 | 3300013296 | Unclassified | 819 |
| 152 | Ga0157378_10000180 | 3300013297 | Bacteria | 60342 |
| 153 | Ga0157378_10081746 | 3300013297 | Bacteria | 2920 |
| 154 | Ga0163162_10014118 | 3300013306 | Bacteria | 7805 |
| 155 | Ga0157372_10032519 | 3300013307 | Bacteria | 5721 |
| 156 | Ga0157372_10264099 | 3300013307 | Unclassified | 1999 |
| 157 | Ga0157372_10837468 | 3300013307 | Bacteria | 1068 |
| 158 | Ga0163163_10002469 | 3300014325 | Bacteria | 15630 |
| 159 | Ga0163163_10002705 | 3300014325 | Bacteria | 14974 |
| 160 | Ga0157379_10047809 | 3300014968 | Unclassified | 3818 |
| 161 | Ga0157379_10206812 | 3300014968 | Bacteria | 1776 |
| 162 | Ga0157376_10000898 | 3300014969 | Bacteria | 19457 |
| 163 | Ga0157376_11215732 | 3300014969 | Bacteria | 782 |
| 164 | Ga0213876_10034843 | 3300021384 | Bacteria | 2655 |
| 165 | Ga0224571_101525 | 3300022734 | Unclassified | 1453 |
| 166 | Ga0224572_1016722 | 3300024225 | Bacteria | 1407 |
| 167 | Ga0224572_1042129 | 3300024225 | Unclassified | 859 |
| 168 | Ga0228598_1000256 | 3300024227 | Bacteria | 10236 |
| 169 | Ga0228598_1007567 | 3300024227 | Unclassified | 2209 |
| 170 | Ga0228598_1024596 | 3300024227 | Bacteria | 1185 |
| 171 | Ga0207653_10001278 | 3300025885 | Bacteria | 8194 |
| 172 | Ga0207710_10113132 | 3300025900 | Unclassified | 1290 |
| 173 | Ga0207685_10093460 | 3300025905 | Bacteria | 1271 |
| 174 | Ga0207699_10003359 | 3300025906 | Bacteria | 7624 |
| 175 | Ga0207699_10005996 | 3300025906 | Bacteria | 5849 |
| 176 | Ga0207699_10057460 | 3300025906 | Bacteria | 2323 |
| 177 | Ga0207699_10100938 | 3300025906 | Bacteria | 1831 |
| 178 | Ga0207699_10147080 | 3300025906 | Unclassified | 1555 |
| 179 | Ga0207699_10219401 | 3300025906 | Unclassified | 1297 |
| 180 | Ga0207699_10963418 | 3300025906 | Unclassified | 630 |
| 181 | Ga0207684_10005080 | 3300025910 | Bacteria | 12269 |
| 182 | Ga0207684_10047600 | 3300025910 | Bacteria | 3636 |
| 183 | Ga0207684_10507502 | 3300025910 | Bacteria | 1033 |
| 184 | Ga0207695_10065742 | 3300025913 | Bacteria | 3728 |
| 185 | Ga0207693_10156130 | 3300025915 | Unclassified | 1795 |
| 186 | Ga0207693_10167097 | 3300025915 | Unclassified | 1732 |
| 187 | Ga0207693_10319421 | 3300025915 | Unclassified | 1215 |
| 188 | Ga0207693_10534434 | 3300025915 | Unclassified | 915 |
| 189 | Ga0207663_10021607 | 3300025916 | Bacteria | 3666 |
| 190 | Ga0207663_10039175 | 3300025916 | Bacteria | 2870 |
| 191 | Ga0207663_10066982 | 3300025916 | Unclassified | 2301 |
| 192 | Ga0207663_10142269 | 3300025916 | Unclassified | 1672 |
| 193 | Ga0207663_10893215 | 3300025916 | Unclassified | 710 |
| 194 | Ga0207663_10899733 | 3300025916 | Unclassified | 708 |
| 195 | Ga0207646_10000274 | 3300025922 | Bacteria | 70391 |
| 196 | Ga0207646_10098711 | 3300025922 | Bacteria | 2617 |
| 197 | Ga0207646_10133965 | 3300025922 | Unclassified | 2231 |
| 198 | Ga0207646_10282589 | 3300025922 | Bacteria | 1500 |
| 199 | Ga0207650_10761852 | 3300025925 | Bacteria | 819 |
| 200 | Ga0207700_10054718 | 3300025928 | Unclassified | 2997 |
| 201 | Ga0207700_10064419 | 3300025928 | Unclassified | 2792 |
| 202 | Ga0207700_10128972 | 3300025928 | Bacteria | 2062 |
| 203 | Ga0207700_10279076 | 3300025928 | Bacteria | 1437 |
| 204 | Ga0207664_10156538 | 3300025929 | Unclassified | 1940 |
| 205 | Ga0207664_10342676 | 3300025929 | Bacteria | 1322 |
| 206 | Ga0207664_10528478 | 3300025929 | Bacteria | 1057 |
| 207 | Ga0207664_10807003 | 3300025929 | Unclassified | 844 |
| 208 | Ga0207704_10542688 | 3300025938 | Unclassified | 944 |
| 209 | Ga0207665_10000285 | 3300025939 | Bacteria | 35244 |
| 210 | Ga0207665_10000736 | 3300025939 | Bacteria | 22027 |
| 211 | Ga0207665_10012797 | 3300025939 | Bacteria | 5518 |
| 212 | Ga0207665_10042135 | 3300025939 | Bacteria | 3051 |
| 213 | Ga0207665_10043608 | 3300025939 | Bacteria | 2999 |
| 214 | Ga0207665_10056783 | 3300025939 | Bacteria | 2643 |
| 215 | Ga0207665_10059278 | 3300025939 | Bacteria | 2590 |
| 216 | Ga0207665_10157761 | 3300025939 | Bacteria | 1630 |
| 217 | Ga0207665_10256636 | 3300025939 | Unclassified | 1294 |
| 218 | Ga0207711_10087889 | 3300025941 | Bacteria | 2728 |
| 219 | Ga0207661_10326737 | 3300025944 | Unclassified | 1380 |
| 220 | Ga0207667_10217332 | 3300025949 | Unclassified | 1958 |
| 221 | Ga0207658_10458713 | 3300025986 | Bacteria | 1129 |
| 222 | Ga0207677_10328364 | 3300026023 | Bacteria | 1274 |
| 223 | Ga0207703_10282111 | 3300026035 | Bacteria | 1509 |
| 224 | Ga0207703_10811924 | 3300026035 | Unclassified | 893 |
| 225 | Ga0207639_11469481 | 3300026041 | Bacteria | 640 |
| 226 | Ga0207702_10545203 | 3300026078 | Unclassified | 1134 |
| 227 | Ga0207641_10000892 | 3300026088 | Bacteria | 31121 |
| 228 | Ga0207641_10066416 | 3300026088 | Unclassified | 3087 |
| 229 | Ga0207648_10750938 | 3300026089 | Bacteria | 906 |
| 230 | Ga0207676_10017820 | 3300026095 | Bacteria | 5153 |
| 231 | Ga0207674_10070936 | 3300026116 | Bacteria | 3502 |
| 232 | Ga0207683_10145516 | 3300026121 | Bacteria | 2137 |
| 233 | Ga0209179_1015972 | 3300027512 | Bacteria | 1402 |
| 234 | Ga0209588_1001745 | 3300027671 | Bacteria | 5756 |
| 235 | Ga0209588_1004162 | 3300027671 | Unclassified | 4059 |
| 236 | Ga0209588_1004676 | 3300027671 | Unclassified | 3882 |
| 237 | Ga0209588_1013483 | 3300027671 | Bacteria | 2492 |
| 238 | Ga0209588_1019540 | 3300027671 | Unclassified | 2115 |
| 239 | Ga0209588_1030354 | 3300027671 | Bacteria | 1726 |
| 240 | Ga0209588_1089559 | 3300027671 | Unclassified | 991 |
| 241 | Ga0209588_1111618 | 3300027671 | Unclassified | 878 |
| 242 | Ga0265354_1000234 | 3300028016 | Bacteria | 10030 |
| 243 | Ga0268266_10000383 | 3300028379 | Bacteria | 67390 |
| 244 | Ga0268264_10152910 | 3300028381 | Bacteria | 2071 |
| 245 | Ga0265319_1018196 | 3300028563 | Bacteria | 2654 |
| 246 | Ga0265338_10010175 | 3300028800 | Bacteria | 11087 |
| 247 | Ga0265338_10043615 | 3300028800 | Bacteria | 4156 |
| 248 | Ga0265338_10233894 | 3300028800 | Bacteria | 1365 |
| 249 | Ga0265338_10602352 | 3300028800 | Unclassified | 765 |
| 250 | Ga0265762_1009264 | 3300030760 | Bacteria | 1754 |
| 251 | Ga0265770_1003128 | 3300030878 | Bacteria | 2247 |
| 252 | Ga0265760_10002378 | 3300031090 | Bacteria | 5500 |
| 253 | Ga0265760_10003058 | 3300031090 | Bacteria | 4883 |
| 254 | Ga0265760_10015502 | 3300031090 | Bacteria | 2184 |
| 255 | Ga0265760_10021986 | 3300031090 | Bacteria | 1847 |
| 256 | Ga0265760_10100629 | 3300031090 | Unclassified | 913 |
| 257 | Ga0265325_10020830 | 3300031241 | Bacteria | 3609 |
| 258 | Ga0265325_10094273 | 3300031241 | Bacteria | 1472 |
| 259 | Ga0307408_100074647 | 3300031548 | Bacteria | 2517 |
| 260 | Ga0265313_10007829 | 3300031595 | Bacteria | 7214 |
| 261 | Ga0307410_10007510 | 3300031852 | Bacteria | 5973 |
| 262 | Ga0307406_10027836 | 3300031901 | Bacteria | 3410 |
| 263 | Ga0307412_10773138 | 3300031911 | Bacteria | 831 |
| 264 | Ga0307409_100128965 | 3300031995 | Bacteria | 2157 |
| 265 | Ga0307409_100840687 | 3300031995 | Unclassified | 928 |
| 266 | Ga0307414_10110419 | 3300032004 | Unclassified | 2092 |
| 267 | Ga0307415_100012516 | 3300032126 | Bacteria | 4908 |
| 268 | Ga0307510_10209077 | 3300033180 | Unclassified | 1476 |
| 269 | Ga0373958_0125282 | 3300034819 | Unclassified | 624 |
| 270 | Ga0373926_0004604 | 3300035083 | Bacteria | 4527 |
| 271 | Ga0373934_0157834 | 3300035086 | Unclassified | 930 |
| 272 | Ga0373944_0094627 | 3300035089 | Unclassified | 1002 |
| 273 | Ga0373923_0066836 | 3300035111 | Bacteria | 1537 |
| 274 | Ga0373923_0345228 | 3300035111 | Unclassified | 710 |
| 275 | Ga0373945_0070111 | 3300035116 | Bacteria | 1325 |
| 276 | Ga0373954_0211483 | 3300035118 | Unclassified | 953 |
| 277 | Ga0373956_0079247 | 3300035119 | Unclassified | 1505 |
| 278 | Ga0373957_0075491 | 3300035120 | Unclassified | 1324 |
| 279 | Ga0373943_0073609 | 3300035170 | Bacteria | 1735 |
| 280 | Ga0373943_0383494 | 3300035170 | Unclassified | 809 |
| 281 | Ga0373946_0336452 | 3300035171 | Unclassified | 752 |
| 282 | Ga0373955_0341582 | 3300035172 | Unclassified | 906 |
| 283 | Ga0373924_0058529 | 3300035410 | Unclassified | 1609 |
| 284 | Ga0373931_0070498 | 3300035691 | Bacteria | 1907 |
| 285 | Ga0373931_0104110 | 3300035691 | Bacteria | 1600 |
| 286 | Ga0373931_0133048 | 3300035691 | Unclassified | 1433 |
| 287 | Ga0373935_0006925 | 3300035692 | Bacteria | 6766 |
| 288 | Ga0373927_0013269 | 3300035695 | Bacteria | 5477 |
| 289 | Ga0373933_0000116 | 3300035724 | Bacteria | 51474 |
| 290 | Ga0373933_0195470 | 3300035724 | Unclassified | 1293 |
| 291 | Ga0373947_0004986 | 3300035725 | Bacteria | 7772 |
| 292 | Ga0373947_0012309 | 3300035725 | Bacteria | 4903 |
| 293 | Ga0373947_0594253 | 3300035725 | Unclassified | 754 |
| 294 | Ga0373937_0000001 | 3300036401 | Bacteria | 478903 |
| 295 | Ga0373937_0014909 | 3300036401 | Bacteria | 6865 |
| 296 | Ga0373937_0308066 | 3300036401 | Bacteria | 1497 |
| 297 | Ga0373925_0080153 | 3300037068 | Bacteria | 2481 |
| 298 | Ga0373925_0377963 | 3300037068 | Bacteria | 1153 |
| 299 | Ga0395905_0034660 | 3300037471 | Bacteria | 4741 |
| 300 | Ga0395905_0042627 | 3300037471 | Bacteria | 4258 |
| 301 | Ga0395905_0117247 | 3300037471 | Bacteria | 2502 |
| 302 | Ga0395905_0266151 | 3300037471 | Bacteria | 1600 |
| 303 | Ga0395905_0680580 | 3300037471 | Unclassified | 931 |
| 304 | Ga0436365_0286126 | 3300039437 | Bacteria | 1420 |
| 305 | Ga0436365_0707009 | 3300039437 | Unclassified | 619 |
| 306 | Ga0451577_0119095 | 3300042876 | Bacteria | 2365 |
| 307 | Ga0466961_0086208 | 3300044693 | Unclassified | 1985 |
| 308 | Ga0466963_0091094 | 3300044694 | Bacteria | 2076 |
| 309 | Ga0453684_0808159 | 3300044712 | Unclassified | 1011 |
| 310 | Ga0466957_0068387 | 3300044842 | Bacteria | 2193 |
| 311 | Ga0466958_0055561 | 3300045836 | Bacteria | 2403 |
| 312 | Ga0466958_0128000 | 3300045836 | Bacteria | 1593 |
| 313 | Ga0466967_0000443 | 3300045976 | Bacteria | 19817 |
| 314 | Ga0466967_0213114 | 3300045976 | Bacteria | 1833 |
| 315 | Ga0466967_1331697 | 3300045976 | Unclassified | 715 |
| 316 | Ga0466967_1865218 | 3300045976 | Unclassified | 598 |
| 317 | Ga0495592_0551325 | 3300046454 | Unclassified | 709 |
| 318 | Ga0495603_0008101 | 3300046455 | Bacteria | 6349 |
| 319 | Ga0495603_0016213 | 3300046455 | Bacteria | 4508 |
| 320 | Ga0495603_0029196 | 3300046455 | Bacteria | 3326 |
| 321 | Ga0495629_0099462 | 3300046459 | Unclassified | 2029 |
| 322 | Ga0495641_0058746 | 3300046461 | Bacteria | 1740 |
| 323 | Ga0495641_0066826 | 3300046461 | Unclassified | 1617 |
| 324 | Ga0495651_0000126 | 3300046462 | Bacteria | 56547 |
| 325 | Ga0495651_0003935 | 3300046462 | Bacteria | 11354 |
| 326 | Ga0495651_0029568 | 3300046462 | Bacteria | 4273 |
| 327 | Ga0495653_0000818 | 3300046463 | Bacteria | 23898 |
| 328 | Ga0495580_0000180 | 3300046472 | Bacteria | 47295 |
| 329 | Ga0495580_0002134 | 3300046472 | Bacteria | 17341 |
| 330 | Ga0495580_0002977 | 3300046472 | Bacteria | 14541 |
| 331 | Ga0495580_0024147 | 3300046472 | Bacteria | 4456 |
| 332 | Ga0495580_0043704 | 3300046472 | Bacteria | 3188 |
| 333 | Ga0495580_0120671 | 3300046472 | Unclassified | 1820 |
| 334 | Ga0495580_0124494 | 3300046472 | Unclassified | 1789 |
| 335 | Ga0495580_0337427 | 3300046472 | Unclassified | 1023 |
| 336 | Ga0495582_0001576 | 3300046473 | Bacteria | 12858 |
| 337 | Ga0495582_0014224 | 3300046473 | Bacteria | 4377 |
| 338 | Ga0495639_0002871 | 3300046475 | Bacteria | 7499 |
| 339 | Ga0495639_0163550 | 3300046475 | Bacteria | 1078 |
| 340 | Ga0495662_0146426 | 3300046476 | Unclassified | 1163 |
| 341 | Ga0495664_0003137 | 3300046477 | Bacteria | 8976 |
| 342 | Ga0495664_0054040 | 3300046477 | Bacteria | 2388 |
| 343 | Ga0495594_0017413 | 3300046499 | Bacteria | 3797 |
| 344 | Ga0495608_0005408 | 3300046511 | Bacteria | 9132 |
| 345 | Ga0495608_0223219 | 3300046511 | Unclassified | 1181 |
| 346 | Ga0495618_0278216 | 3300046514 | Unclassified | 1044 |
| 347 | Ga0495628_0018986 | 3300046516 | Bacteria | 5688 |
| 348 | Ga0495628_0229834 | 3300046516 | Unclassified | 1391 |
| 349 | Ga0495630_0276618 | 3300046517 | Unclassified | 1282 |
| 350 | Ga0495630_0488127 | 3300046517 | Bacteria | 944 |
| 351 | Ga0495666_0025444 | 3300046526 | Unclassified | 2922 |
| 352 | Ga0495666_0035964 | 3300046526 | Bacteria | 2412 |
| 353 | Ga0495652_0003341 | 3300046529 | Bacteria | 15920 |
| 354 | Ga0495652_0160462 | 3300046529 | Bacteria | 1746 |
| 355 | Ga0495665_0013101 | 3300046531 | Bacteria | 4490 |
| 356 | Ga0495640_0017956 | 3300046533 | Bacteria | 5259 |
| 357 | Ga0495586_0000405 | 3300046535 | Bacteria | 26188 |
| 358 | Ga0495587_0000087 | 3300046536 | Bacteria | 71152 |
| 359 | Ga0495587_0006297 | 3300046536 | Bacteria | 7744 |
| 360 | Ga0495587_0016945 | 3300046536 | Bacteria | 4531 |
| 361 | Ga0495645_0025534 | 3300046543 | Bacteria | 4288 |
| 362 | Ga0495645_0093171 | 3300046543 | Bacteria | 2150 |
| 363 | Ga0495645_0179697 | 3300046543 | Unclassified | 1450 |
| 364 | Ga0495667_0001854 | 3300046559 | Bacteria | 14023 |
| 365 | Ga0495667_0037961 | 3300046559 | Bacteria | 3209 |
| 366 | Ga0495667_0085588 | 3300046559 | Unclassified | 2046 |
| 367 | Ga0495634_0062331 | 3300046642 | Bacteria | 2476 |
| 368 | Ga0495635_0009757 | 3300046663 | Bacteria | 6710 |
| 369 | Ga0495635_0092657 | 3300046663 | Bacteria | 2066 |
| 370 | Ga0495635_0127018 | 3300046663 | Bacteria | 1739 |
| 371 | Ga0495657_0018325 | 3300046675 | Bacteria | 5071 |
| 372 | Ga0495623_0004839 | 3300046679 | Bacteria | 8832 |
| 373 | Ga0495623_0038415 | 3300046679 | Bacteria | 3061 |
| 374 | Ga0495646_0010050 | 3300046680 | Bacteria | 6018 |
| 375 | Ga0495647_0040728 | 3300046681 | Unclassified | 1766 |
| 376 | Ga0495658_0022033 | 3300046683 | Bacteria | 3365 |
| 377 | Ga0495669_0001577 | 3300046684 | Bacteria | 9377 |
| 378 | Ga0495669_0244118 | 3300046684 | Unclassified | 862 |
| 379 | Ga0495613_0053129 | 3300046689 | Bacteria | 2982 |
| 380 | Ga0495613_0062632 | 3300046689 | Bacteria | 2721 |
| 381 | Ga0495624_0002046 | 3300046690 | Bacteria | 15356 |
| 382 | Ga0495624_0012387 | 3300046690 | Bacteria | 5833 |
| 383 | Ga0495581_0012137 | 3300047315 | Bacteria | 4987 |
| 384 | Ga0495581_0019843 | 3300047315 | Bacteria | 3903 |
| 385 | Ga0495604_0004735 | 3300047317 | Bacteria | 10779 |
| 386 | Ga0495604_0025859 | 3300047317 | Bacteria | 4675 |
| 387 | Ga0495674_0029942 | 3300047319 | Bacteria | 4953 |
| 388 | Ga0495674_0081508 | 3300047319 | Unclassified | 2775 |
| 389 | Ga0495674_0117694 | 3300047319 | Bacteria | 2247 |
| 390 | Ga0495676_0048987 | 3300047321 | Bacteria | 3401 |
| 391 | Ga0495680_0000253 | 3300047322 | Bacteria | 59346 |
| 392 | Ga0495680_0052092 | 3300047322 | Bacteria | 3192 |
| 393 | Ga0495680_0431592 | 3300047322 | Unclassified | 905 |
| 394 | Ga0495675_0000227 | 3300047444 | Bacteria | 40596 |
| 395 | Ga0495675_0004291 | 3300047444 | Bacteria | 8628 |
| 396 | Ga0495675_0038394 | 3300047444 | Unclassified | 3049 |
| 397 | Ga0495675_0507402 | 3300047444 | Unclassified | 692 |
| 398 | Ga0495684_0001064 | 3300047471 | Bacteria | 22213 |
| 399 | Ga0495684_0063801 | 3300047471 | Bacteria | 2800 |
| 400 | Ga0495593_0001389 | 3300047673 | Bacteria | 14171 |
| 401 | Ga0495593_0011904 | 3300047673 | Bacteria | 4989 |
| 402 | Ga0495602_0000086 | 3300048088 | Bacteria | 90226 |
| 403 | Ga0495602_0008554 | 3300048088 | Bacteria | 10687 |
| 404 | Ga0495602_0097944 | 3300048088 | Unclassified | 2415 |
| 405 | Ga0495614_0008332 | 3300048089 | Bacteria | 4614 |
| 406 | Ga0495614_0044589 | 3300048089 | Unclassified | 1902 |
| 407 | Ga0496100_0013974 | 3300048903 | Bacteria | 4649 |
| 408 | Ga0496102_0008552 | 3300048905 | Bacteria | 8778 |
| 409 | Ga0496102_1358297 | 3300048905 | Unclassified | 630 |
| 410 | Ga0496104_0007570 | 3300048907 | Bacteria | 9609 |
| 411 | Ga0496104_0278487 | 3300048907 | Unclassified | 1586 |
| 412 | Ga0496104_0833124 | 3300048907 | Unclassified | 828 |
| 413 | Ga0496105_0056116 | 3300048908 | Bacteria | 3252 |
| 414 | Ga0496105_0059057 | 3300048908 | Bacteria | 3165 |
| 415 | Ga0496107_0067014 | 3300048910 | Bacteria | 2604 |
| 416 | Ga0496108_0566674 | 3300048911 | Unclassified | 990 |
| 417 | Ga0496109_0042574 | 3300048912 | Bacteria | 4114 |
| 418 | Ga0496109_1247426 | 3300048912 | Unclassified | 680 |
| 419 | Ga0496110_0824673 | 3300048913 | Unclassified | 832 |
| 420 | Ga0496110_1004622 | 3300048913 | Unclassified | 742 |
| 421 | Ga0496112_0202940 | 3300048915 | Bacteria | 1941 |
| 422 | Ga0496112_0240356 | 3300048915 | Unclassified | 1764 |
| 423 | Ga0496113_0356145 | 3300048916 | Bacteria | 1174 |
| 424 | Ga0496113_1166188 | 3300048916 | Unclassified | 602 |
| 425 | Ga0496114_0007943 | 3300048917 | Bacteria | 8397 |
| 426 | Ga0496114_0016164 | 3300048917 | Bacteria | 6007 |
| 427 | Ga0496115_0014308 | 3300048918 | Bacteria | 6006 |
| 428 | Ga0496115_0091110 | 3300048918 | Unclassified | 2491 |
| 429 | Ga0501291_031660 | 3300049514 | Unclassified | 895 |
| 430 | Ga0501296_032556 | 3300049519 | Unclassified | 708 |
| 431 | Ga0501249_071392 | 3300049679 | Unclassified | 811 |
| 432 | Ga0501234_011845 | 3300049707 | Archaea | 1365 |
| 433 | nmdc:mga0n895_113855_c1 | 3300050512 | Bacteria | 2723 |
| 434 | nmdc:mga0n895_123947_c1 | 3300050512 | Bacteria | 2606 |
| 435 | nmdc:mga0n895_619722_c1 | 3300050512 | Bacteria | 1083 |
| 436 | nmdc:mga0n895_94982_c1 | 3300050512 | Bacteria | 2986 |
| 437 | nmdc:mga0rr50_177424_c1 | 3300050513 | Bacteria | 1740 |
| 438 | nmdc:mga08x19_10431_c1 | 3300050514 | Bacteria | 5578 |
| 439 | nmdc:mga08x19_130741_c1 | 3300050514 | Bacteria | 1688 |
| 440 | nmdc:mga08x19_184749_c1 | 3300050514 | Bacteria | 988 |
| 441 | nmdc:mga08x19_410009_c1 | 3300050514 | Unclassified | 951 |
| 442 | nmdc:mga08x19_610675_c1 | 3300050514 | Unclassified | 773 |
| 443 | nmdc:mga08x19_67277_c1 | 3300050514 | Bacteria | 2330 |
| 444 | Ga0495601_0006435 | 3300053077 | Bacteria | 6870 |
| 445 | Ga0495612_0000267 | 3300053078 | Bacteria | 21484 |
| 446 | Ga0070699_100215818 | |||
| 447 | MBSR1b_contig_6683619 | |||
| 448 | Ga0070658_10902467 | |||
| 449 | Ga0070683_100262711 | |||
| 450 | Ga0070690_100220661 | |||
| 451 | Ga0070670_100062528 | |||
| 452 | Ga0070671_100233131 | |||
| 453 | Ga0070659_100560368 | |||
| 454 | Ga0070667_100499068 | |||
| 455 | Ga0070703_10001114 | |||
| 456 | Ga0070709_10004747 | |||
| 457 | Ga0070709_10134780 | |||
| 458 | Ga0070709_10177566 | |||
| 459 | Ga0070709_10200535 | |||
| 460 | Ga0070709_10537372 | |||
| 461 | Ga0070709_10538301 | |||
| 462 | Ga0070709_10673598 | |||
| 463 | Ga0070714_100116738 | |||
| 464 | Ga0070714_100760617 | |||
| 465 | Ga0070713_100000739 | |||
| 466 | Ga0070713_100004311 | |||
| 467 | Ga0070713_100064833 | |||
| 468 | Ga0070713_100188707 | |||
| 469 | Ga0070713_100188889 | |||
| 470 | Ga0070713_100458808 | |||
| 471 | Ga0070713_100606603 | |||
| 472 | Ga0070713_100661876 | |||
| 473 | Ga0070710_10358730 | |||
| 474 | Ga0070710_10517791 | |||
| 475 | Ga0070711_100016956 | |||
| 476 | Ga0070711_100032242 | |||
| 477 | Ga0070711_100091112 | |||
| 478 | Ga0070711_100156627 | |||
| 479 | Ga0070711_100241110 | |||
| 480 | Ga0070711_101186908 | |||
| 481 | Ga0070705_100001481 | |||
| 482 | Ga0070705_100274088 | |||
| 483 | Ga0070700_100708799 | |||
| 484 | Ga0070694_100042892 | |||
| 485 | Ga0070694_100252160 | |||
| 486 | Ga0070708_100001228 | |||
| 487 | Ga0070708_100012182 | |||
| 488 | Ga0070708_100387391 | |||
| 489 | Ga0070678_100543501 | |||
| 490 | Ga0068867_101066042 | |||
| 491 | Ga0070706_100005421 | |||
| 492 | Ga0070706_100181628 | |||
| 493 | Ga0070706_100432188 | |||
| 494 | Ga0070707_100009899 | |||
| 495 | Ga0070707_100052759 | |||
| 496 | Ga0070707_100159439 | |||
| 497 | Ga0070707_100253749 | |||
| 498 | Ga0070707_100322931 | |||
| 499 | Ga0070707_101361600 | |||
| 500 | Ga0070698_100011516 | |||
| 501 | Ga0070698_100013182 | |||
| 502 | Ga0070698_100245613 | |||
| 503 | Ga0070699_100007937 | |||
| 504 | Ga0070699_100163207 | |||
| 505 | Ga0070699_100476942 | |||
| 506 | Ga0070679_100026004 | |||
| 507 | Ga0070679_100201351 | |||
| 508 | Ga0070679_101232776 | |||
| 509 | Ga0070684_100153050 | |||
| 510 | Ga0070697_100000298 | |||
| 511 | Ga0070697_100024317 | |||
| 512 | Ga0070697_100046380 | |||
| 513 | Ga0070697_100163013 | |||
| 514 | Ga0070697_100907040 | |||
| 515 | Ga0068853_100891124 | |||
| 516 | Ga0070695_100001240 | |||
| 517 | Ga0070696_100000331 | |||
| 518 | Ga0070693_100000020 | |||
| 519 | Ga0070693_100264681 | |||
| 520 | Ga0070665_100001001 | |||
| 521 | Ga0070704_100000909 | |||
| 522 | Ga0070704_100133285 | |||
| 523 | Ga0068855_100786774 | |||
| 524 | Ga0068857_100052374 | |||
| 525 | Ga0068856_100305763 | |||
| 526 | Ga0068864_100053055 | |||
| 527 | Ga0068866_10036988 | |||
| 528 | Ga0068863_100001570 | |||
| 529 | Ga0068863_100017143 | |||
| 530 | Ga0068858_100644346 | |||
| 531 | Ga0068860_100158532 | |||
| 532 | Ga0068860_100632948 | |||
| 533 | Ga0081540_1135958 | |||
| 534 | Ga0070717_10105825 | |||
| 535 | Ga0070717_10256623 | |||
| 536 | Ga0070717_10346031 | |||
| 537 | Ga0070717_10356675 | |||
| 538 | Ga0070717_10909023 | |||
| 539 | Ga0070715_10041485 | |||
| 540 | Ga0070715_10115763 | |||
| 541 | Ga0070715_10155810 | |||
| 542 | Ga0070716_100006438 | |||
| 543 | Ga0070716_100024798 | |||
| 544 | Ga0070716_100078032 | |||
| 545 | Ga0070716_100117529 | |||
| 546 | Ga0070716_100133489 | |||
| 547 | Ga0070716_100222042 | |||
| 548 | Ga0070716_100640141 | |||
| 549 | Ga0070712_100020001 | |||
| 550 | Ga0070712_100026969 | |||
| 551 | Ga0070712_100259094 | |||
| 552 | Ga0070712_100327983 | |||
| 553 | Ga0070712_100439876 | |||
| 554 | Ga0097621_100022450 | |||
| 555 | Ga0075433_10518792 | |||
| 556 | Ga0075433_10534127 | |||
| 557 | Ga0075434_100023117 | |||
| 558 | Ga0075434_100106251 | |||
| 559 | Ga0075434_100178317 | |||
| 560 | Ga0075434_100238105 | |||
| 561 | Ga0068865_100349699 | |||
| 562 | Ga0075436_100001967 | |||
| 563 | Ga0075436_100035357 | |||
| 564 | Ga0075436_100119474 | |||
| 565 | Ga0075436_100405396 | |||
| 566 | Ga0075436_100589683 | |||
| 567 | Ga0075435_100086148 | |||
| 568 | Ga0099794_10001741 | |||
| 569 | Ga0099794_10017386 | |||
| 570 | Ga0099794_10018531 | |||
| 571 | Ga0099794_10070900 | |||
| 572 | Ga0099794_10081737 | |||
| 573 | Ga0099794_10093691 | |||
| 574 | Ga0099794_10196026 | |||
| 575 | Ga0099795_10003858 | |||
| 576 | Ga0099795_10010751 | |||
| 577 | Ga0099795_10011162 | |||
| 578 | Ga0105240_10006795 | |||
| 579 | Ga0105245_10129215 | |||
| 580 | Ga0105247_10080010 | |||
| 581 | Ga0105247_10710765 | |||
| 582 | Ga0105242_10408456 | |||
| 583 | Ga0105242_10758410 | |||
| 584 | Ga0105248_10024351 | |||
| 585 | Ga0105248_10040516 | |||
| 586 | Ga0105248_11744904 | |||
| 587 | Ga0105237_10285205 | |||
| 588 | Ga0105238_10311064 | |||
| 589 | Ga0105238_11473548 | |||
| 590 | Ga0099796_10062205 | |||
| 591 | Ga0099796_10132036 | |||
| 592 | Ga0105239_10067448 | |||
| 593 | Ga0157370_10502513 | |||
| 594 | Ga0157369_10626143 | |||
| 595 | Ga0157374_10078007 | |||
| 596 | Ga0157374_11088509 | |||
| 597 | Ga0157378_10000180 | |||
| 598 | Ga0157378_10081746 | |||
| 599 | Ga0163162_10014118 | |||
| 600 | Ga0157372_10032519 | |||
| 601 | Ga0157372_10264099 | |||
| 602 | Ga0157372_10837468 | |||
| 603 | Ga0163163_10002469 | |||
| 604 | Ga0163163_10002705 | |||
| 605 | Ga0157379_10047809 | |||
| 606 | Ga0157379_10206812 | |||
| 607 | Ga0157376_10000898 | |||
| 608 | Ga0157376_11215732 | |||
| 609 | Ga0213876_10034843 | |||
| 610 | Ga0224571_101525 | |||
| 611 | Ga0224572_1016722 | |||
| 612 | Ga0224572_1042129 | |||
| 613 | Ga0228598_1000256 | |||
| 614 | Ga0228598_1007567 | |||
| 615 | Ga0228598_1024596 | |||
| 616 | Ga0207653_10001278 | |||
| 617 | Ga0207710_10113132 | |||
| 618 | Ga0207685_10093460 | |||
| 619 | Ga0207699_10003359 | |||
| 620 | Ga0207699_10005996 | |||
| 621 | Ga0207699_10057460 | |||
| 622 | Ga0207699_10100938 | |||
| 623 | Ga0207699_10147080 | |||
| 624 | Ga0207699_10219401 | |||
| 625 | Ga0207699_10963418 | |||
| 626 | Ga0207684_10005080 | |||
| 627 | Ga0207684_10047600 | |||
| 628 | Ga0207684_10507502 | |||
| 629 | Ga0207695_10065742 | |||
| 630 | Ga0207693_10156130 | |||
| 631 | Ga0207693_10167097 | |||
| 632 | Ga0207693_10319421 | |||
| 633 | Ga0207693_10534434 | |||
| 634 | Ga0207663_10021607 | |||
| 635 | Ga0207663_10039175 | |||
| 636 | Ga0207663_10066982 | |||
| 637 | Ga0207663_10142269 | |||
| 638 | Ga0207663_10893215 | |||
| 639 | Ga0207663_10899733 | |||
| 640 | Ga0207646_10000274 | |||
| 641 | Ga0207646_10098711 | |||
| 642 | Ga0207646_10133965 | |||
| 643 | Ga0207646_10282589 | |||
| 644 | Ga0207650_10761852 | |||
| 645 | Ga0207700_10054718 | |||
| 646 | Ga0207700_10064419 | |||
| 647 | Ga0207700_10128972 | |||
| 648 | Ga0207700_10279076 | |||
| 649 | Ga0207664_10156538 | |||
| 650 | Ga0207664_10342676 | |||
| 651 | Ga0207664_10528478 | |||
| 652 | Ga0207664_10807003 | |||
| 653 | Ga0207704_10542688 | |||
| 654 | Ga0207665_10000285 | |||
| 655 | Ga0207665_10000736 | |||
| 656 | Ga0207665_10012797 | |||
| 657 | Ga0207665_10042135 | |||
| 658 | Ga0207665_10043608 | |||
| 659 | Ga0207665_10056783 | |||
| 660 | Ga0207665_10059278 | |||
| 661 | Ga0207665_10157761 | |||
| 662 | Ga0207665_10256636 | |||
| 663 | Ga0207711_10087889 | |||
| 664 | Ga0207661_10326737 | |||
| 665 | Ga0207667_10217332 | |||
| 666 | Ga0207658_10458713 | |||
| 667 | Ga0207677_10328364 | |||
| 668 | Ga0207703_10282111 | |||
| 669 | Ga0207703_10811924 | |||
| 670 | Ga0207639_11469481 | |||
| 671 | Ga0207702_10545203 | |||
| 672 | Ga0207641_10000892 | |||
| 673 | Ga0207641_10066416 | |||
| 674 | Ga0207648_10750938 | |||
| 675 | Ga0207676_10017820 | |||
| 676 | Ga0207674_10070936 | |||
| 677 | Ga0207683_10145516 | |||
| 678 | Ga0209179_1015972 | |||
| 679 | Ga0209588_1001745 | |||
| 680 | Ga0209588_1004162 | |||
| 681 | Ga0209588_1004676 | |||
| 682 | Ga0209588_1013483 | |||
| 683 | Ga0209588_1019540 | |||
| 684 | Ga0209588_1030354 | |||
| 685 | Ga0209588_1089559 | |||
| 686 | Ga0209588_1111618 | |||
| 687 | Ga0265354_1000234 | |||
| 688 | Ga0268266_10000383 | |||
| 689 | Ga0268264_10152910 | |||
| 690 | Ga0265319_1018196 | |||
| 691 | Ga0265338_10010175 | |||
| 692 | Ga0265338_10043615 | |||
| 693 | Ga0265338_10233894 | |||
| 694 | Ga0265338_10602352 | |||
| 695 | Ga0265762_1009264 | |||
| 696 | Ga0265770_1003128 | |||
| 697 | Ga0265760_10002378 | |||
| 698 | Ga0265760_10003058 | |||
| 699 | Ga0265760_10015502 | |||
| 700 | Ga0265760_10021986 | |||
| 701 | Ga0265760_10100629 | |||
| 702 | Ga0265325_10020830 | |||
| 703 | Ga0265325_10094273 | |||
| 704 | Ga0307408_100074647 | |||
| 705 | Ga0265313_10007829 | |||
| 706 | Ga0307410_10007510 | |||
| 707 | Ga0307406_10027836 | |||
| 708 | Ga0307412_10773138 | |||
| 709 | Ga0307409_100128965 | |||
| 710 | Ga0307409_100840687 | |||
| 711 | Ga0307414_10110419 | |||
| 712 | Ga0307415_100012516 | |||
| 713 | Ga0307510_10209077 | |||
| 714 | Ga0373958_0125282 | |||
| 715 | Ga0373926_0004604 | |||
| 716 | Ga0373934_0157834 | |||
| 717 | Ga0373944_0094627 | |||
| 718 | Ga0373923_0066836 | |||
| 719 | Ga0373923_0345228 | |||
| 720 | Ga0373945_0070111 | |||
| 721 | Ga0373954_0211483 | |||
| 722 | Ga0373956_0079247 | |||
| 723 | Ga0373957_0075491 | |||
| 724 | Ga0373943_0073609 | |||
| 725 | Ga0373943_0383494 | |||
| 726 | Ga0373946_0336452 | |||
| 727 | Ga0373955_0341582 | |||
| 728 | Ga0373924_0058529 | |||
| 729 | Ga0373931_0070498 | |||
| 730 | Ga0373931_0104110 | |||
| 731 | Ga0373931_0133048 | |||
| 732 | Ga0373935_0006925 | |||
| 733 | Ga0373927_0013269 | |||
| 734 | Ga0373933_0000116 | |||
| 735 | Ga0373933_0195470 | |||
| 736 | Ga0373947_0004986 | |||
| 737 | Ga0373947_0012309 | |||
| 738 | Ga0373947_0594253 | |||
| 739 | Ga0373937_0000001 | |||
| 740 | Ga0373937_0014909 | |||
| 741 | Ga0373937_0308066 | |||
| 742 | Ga0373925_0080153 | |||
| 743 | Ga0373925_0377963 | |||
| 744 | Ga0395905_0034660 | |||
| 745 | Ga0395905_0042627 | |||
| 746 | Ga0395905_0117247 | |||
| 747 | Ga0395905_0266151 | |||
| 748 | Ga0395905_0680580 | |||
| 749 | Ga0436365_0286126 | |||
| 750 | Ga0436365_0707009 | |||
| 751 | Ga0451577_0119095 | |||
| 752 | Ga0466961_0086208 | |||
| 753 | Ga0466963_0091094 | |||
| 754 | Ga0453684_0808159 | |||
| 755 | Ga0466957_0068387 | |||
| 756 | Ga0466958_0055561 | |||
| 757 | Ga0466958_0128000 | |||
| 758 | Ga0466967_0000443 | |||
| 759 | Ga0466967_0213114 | |||
| 760 | Ga0466967_1331697 | |||
| 761 | Ga0466967_1865218 | |||
| 762 | Ga0495592_0551325 | |||
| 763 | Ga0495603_0008101 | |||
| 764 | Ga0495603_0016213 | |||
| 765 | Ga0495603_0029196 | |||
| 766 | Ga0495629_0099462 | |||
| 767 | Ga0495641_0058746 | |||
| 768 | Ga0495641_0066826 | |||
| 769 | Ga0495651_0000126 | |||
| 770 | Ga0495651_0003935 | |||
| 771 | Ga0495651_0029568 | |||
| 772 | Ga0495653_0000818 | |||
| 773 | Ga0495580_0000180 | |||
| 774 | Ga0495580_0002134 | |||
| 775 | Ga0495580_0002977 | |||
| 776 | Ga0495580_0024147 | |||
| 777 | Ga0495580_0043704 | |||
| 778 | Ga0495580_0120671 | |||
| 779 | Ga0495580_0124494 | |||
| 780 | Ga0495580_0337427 | |||
| 781 | Ga0495582_0001576 | |||
| 782 | Ga0495582_0014224 | |||
| 783 | Ga0495639_0002871 | |||
| 784 | Ga0495639_0163550 | |||
| 785 | Ga0495662_0146426 | |||
| 786 | Ga0495664_0003137 | |||
| 787 | Ga0495664_0054040 | |||
| 788 | Ga0495594_0017413 | |||
| 789 | Ga0495608_0005408 | |||
| 790 | Ga0495608_0223219 | |||
| 791 | Ga0495618_0278216 | |||
| 792 | Ga0495628_0018986 | |||
| 793 | Ga0495628_0229834 | |||
| 794 | Ga0495630_0276618 | |||
| 795 | Ga0495630_0488127 | |||
| 796 | Ga0495666_0025444 | |||
| 797 | Ga0495666_0035964 | |||
| 798 | Ga0495652_0003341 | |||
| 799 | Ga0495652_0160462 | |||
| 800 | Ga0495665_0013101 | |||
| 801 | Ga0495640_0017956 | |||
| 802 | Ga0495586_0000405 | |||
| 803 | Ga0495587_0000087 | |||
| 804 | Ga0495587_0006297 | |||
| 805 | Ga0495587_0016945 | |||
| 806 | Ga0495645_0025534 | |||
| 807 | Ga0495645_0093171 | |||
| 808 | Ga0495645_0179697 | |||
| 809 | Ga0495667_0001854 | |||
| 810 | Ga0495667_0037961 | |||
| 811 | Ga0495667_0085588 | |||
| 812 | Ga0495634_0062331 | |||
| 813 | Ga0495635_0009757 | |||
| 814 | Ga0495635_0092657 | |||
| 815 | Ga0495635_0127018 | |||
| 816 | Ga0495657_0018325 | |||
| 817 | Ga0495623_0004839 | |||
| 818 | Ga0495623_0038415 | |||
| 819 | Ga0495646_0010050 | |||
| 820 | Ga0495647_0040728 | |||
| 821 | Ga0495658_0022033 | |||
| 822 | Ga0495669_0001577 | |||
| 823 | Ga0495669_0244118 | |||
| 824 | Ga0495613_0053129 | |||
| 825 | Ga0495613_0062632 | |||
| 826 | Ga0495624_0002046 | |||
| 827 | Ga0495624_0012387 | |||
| 828 | Ga0495581_0012137 | |||
| 829 | Ga0495581_0019843 | |||
| 830 | Ga0495604_0004735 | |||
| 831 | Ga0495604_0025859 | |||
| 832 | Ga0495674_0029942 | |||
| 833 | Ga0495674_0081508 | |||
| 834 | Ga0495674_0117694 | |||
| 835 | Ga0495676_0048987 | |||
| 836 | Ga0495680_0000253 | |||
| 837 | Ga0495680_0052092 | |||
| 838 | Ga0495680_0431592 | |||
| 839 | Ga0495675_0000227 | |||
| 840 | Ga0495675_0004291 | |||
| 841 | Ga0495675_0038394 | |||
| 842 | Ga0495675_0507402 | |||
| 843 | Ga0495684_0001064 | |||
| 844 | Ga0495684_0063801 | |||
| 845 | Ga0495593_0001389 | |||
| 846 | Ga0495593_0011904 | |||
| 847 | Ga0495602_0000086 | |||
| 848 | Ga0495602_0008554 | |||
| 849 | Ga0495602_0097944 | |||
| 850 | Ga0495614_0008332 | |||
| 851 | Ga0495614_0044589 | |||
| 852 | Ga0496100_0013974 | |||
| 853 | Ga0496102_0008552 | |||
| 854 | Ga0496102_1358297 | |||
| 855 | Ga0496104_0007570 | |||
| 856 | Ga0496104_0278487 | |||
| 857 | Ga0496104_0833124 | |||
| 858 | Ga0496105_0056116 | |||
| 859 | Ga0496105_0059057 | |||
| 860 | Ga0496107_0067014 | |||
| 861 | Ga0496108_0566674 | |||
| 862 | Ga0496109_0042574 | |||
| 863 | Ga0496109_1247426 | |||
| 864 | Ga0496110_0824673 | |||
| 865 | Ga0496110_1004622 | |||
| 866 | Ga0496112_0202940 | |||
| 867 | Ga0496112_0240356 | |||
| 868 | Ga0496113_0356145 | |||
| 869 | Ga0496113_1166188 | |||
| 870 | Ga0496114_0007943 | |||
| 871 | Ga0496114_0016164 | |||
| 872 | Ga0496115_0014308 | |||
| 873 | Ga0496115_0091110 | |||
| 874 | Ga0501291_031660 | |||
| 875 | Ga0501296_032556 | |||
| 876 | Ga0501249_071392 | |||
| 877 | Ga0501234_011845 | |||
| 878 | nmdc:mga0n895_113855_c1 | |||
| 879 | nmdc:mga0n895_123947_c1 | |||
| 880 | nmdc:mga0n895_619722_c1 | |||
| 881 | nmdc:mga0n895_94982_c1 | |||
| 882 | nmdc:mga0rr50_177424_c1 | |||
| 883 | nmdc:mga08x19_10431_c1 | |||
| 884 | nmdc:mga08x19_130741_c1 | |||
| 885 | nmdc:mga08x19_184749_c1 | |||
| 886 | nmdc:mga08x19_410009_c1 | |||
| 887 | nmdc:mga08x19_610675_c1 | |||
| 888 | nmdc:mga08x19_67277_c1 | |||
| 889 | Ga0495601_0006435 | |||
| 890 | Ga0495612_0000267 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qdl-assembly2.cif.gz_B | crystal structure of scaffolding protein ttchew from thermoanaerobacter tengcongensis | 0.7975 | 32 | 163 |
| 3ja6-assembly1.cif.gz_F | cryo-electron tomography and all-atom molecular dynamics simulations reveal a novel kinase conformational switch in bacterial chemotaxis signaling | 0.7919 | 32 | 168 |
| 4jpb-assembly1.cif.gz_W | the structure of a ternary complex between chea domains p4 and p5 with chew and with an unzipped fragment of tm14, a chemoreceptor analog from thermotoga maritima. | 0.7878 | 33 | 170 |
| 2qdl-assembly1.cif.gz_A | crystal structure of scaffolding protein ttchew from thermoanaerobacter tengcongensis | 0.7851 | 32 | 163 |
| 3ja6-assembly1.cif.gz_F | cryo-electron tomography and all-atom molecular dynamics simulations reveal a novel kinase conformational switch in bacterial chemotaxis signaling | 0.7618 | 32 | 168 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2qdlB01 | Mainly Beta;Roll;SH3 type barrels.;SH3 Domains | 0.7973 | 33 | 161 | 2.30.30.40 |
| 2qdlB01 | Mainly Beta;Roll;SH3 type barrels.;SH3 Domains | 0.7748 | 33 | 161 | 2.30.30.40 |
| 2ch4W02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 | 0.7202 | 52 | 123 | 2.40.50.180 |
| 1b3qB04 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 | 0.6783 | 53 | 122 | 2.40.50.180 |
| 2qdlB02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 | 0.6713 | 53 | 123 | 2.40.50.180 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A353YYY3-F1-model_v4 | CheW-like domain-containing protein | 0.8391 | 30 | 166 |
GO:0005829
GO:0006935 GO:0007165 |
| AF-A0A848LMB0-F1-model_v4 | Purine-binding chemotaxis protein CheW | 0.8292 | 33 | 168 |
GO:0005829
GO:0006935 GO:0007165 |
| AF-A0A2J6ID41-F1-model_v4 | CheW-like domain-containing protein | 0.8287 | 33 | 172 |
GO:0005829
GO:0006935 GO:0007165 |
| AF-A0A2E6UDM5-F1-model_v4 | deleted | 0.8248 | 33 | 167 |
|
| AF-A0A1G3MQB3-F1-model_v4 | CheW-like domain-containing protein | 0.8247 | 33 | 168 |
GO:0005829
GO:0006935 GO:0007165 |