F445448

General Info

Members Datasets Scaffolds Average Seq Length
445 268 890 105

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100242578|Ga0070698_1002425782
Length 123
Sequence VRGVDIPAVYLEHLGMSADFKRGHLDLLILSVLARGPLHGYAAIAALRDRSGGLFDLAEGTVYPALHRLERVGLIASEWERASGRKRCRYALTKTGHAALARQTTQWRRWSGGLNMVLGWSGK

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
145 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
146 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
147 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
148 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
149 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
165 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
166 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
167 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
168 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
169 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
170 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
175 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
176 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
189 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
190 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
193 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
194 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
198 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
199 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
200 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
201 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
202 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
207 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
210 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
213 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
214 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
215 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
220 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
221 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
224 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
225 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
264 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
265 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
266 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.89
Rhizosphere 88.09
Stem 0
Stem Tuber 0
Unclassified 16.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100242578 3300005471 Bacteria 1735
2 Ga0070658_11618391 3300005327 Bacteria 561
3 Ga0070683_100014804 3300005329 Bacteria 6835
4 Ga0070683_100206107 3300005329 Bacteria 1868
5 Ga0070690_100371982 3300005330 Bacteria 1043
6 Ga0070670_101142706 3300005331 Bacteria 711
7 Ga0068869_100017791 3300005334 Bacteria 4828
8 Ga0070680_100214667 3300005336 Bacteria 1623
9 Ga0070682_100024463 3300005337 Bacteria 3594
10 Ga0068868_100274730 3300005338 Bacteria 1424
11 Ga0070660_100011443 3300005339 Bacteria 6305
12 Ga0070689_100056537 3300005340 Bacteria 3043
13 Ga0070689_100506438 3300005340 Bacteria 1035
14 Ga0070691_10035274 3300005341 Bacteria 2355
15 Ga0070661_100122232 3300005344 Bacteria 1951
16 Ga0070661_101247046 3300005344 Bacteria 623
17 Ga0070669_101656173 3300005353 Unclassified 557
18 Ga0070675_100043550 3300005354 Bacteria 3669
19 Ga0070671_100730911 3300005355 Bacteria 860
20 Ga0070673_100182674 3300005364 Bacteria 1796
21 Ga0070673_100634849 3300005364 Unclassified 976
22 Ga0070688_100136236 3300005365 Unclassified 1663
23 Ga0070688_100209485 3300005365 Bacteria 1368
24 Ga0070659_100612005 3300005366 Bacteria 937
25 Ga0070667_100243879 3300005367 Bacteria 1605
26 Ga0070667_100851485 3300005367 Bacteria 848
27 Ga0070703_10038477 3300005406 Bacteria 1479
28 Ga0070714_100340017 3300005435 Bacteria 1407
29 Ga0070714_100827429 3300005435 Bacteria 897
30 Ga0070713_101849476 3300005436 Unclassified 586
31 Ga0070710_10454778 3300005437 Bacteria 869
32 Ga0070701_10857964 3300005438 Bacteria 624
33 Ga0070701_10976890 3300005438 Unclassified 589
34 Ga0070711_100383130 3300005439 Bacteria 1137
35 Ga0070711_100887359 3300005439 Bacteria 760
36 Ga0070711_100955256 3300005439 Bacteria 734
37 Ga0070711_101805243 3300005439 Bacteria 537
38 Ga0070700_100525076 3300005441 Unclassified 915
39 Ga0070708_101145629 3300005445 Bacteria 728
40 Ga0070678_100243661 3300005456 Bacteria 1504
41 Ga0070678_100714825 3300005456 Bacteria 904
42 Ga0070662_100691972 3300005457 Bacteria 862
43 Ga0070681_11697287 3300005458 Bacteria 558
44 Ga0068867_100847455 3300005459 Bacteria 819
45 Ga0070685_10435427 3300005466 Bacteria 915
46 Ga0070685_10623299 3300005466 Bacteria 779
47 Ga0070684_100090621 3300005535 Bacteria 2719
48 Ga0070684_101637243 3300005535 Bacteria 607
49 Ga0068853_100177259 3300005539 Bacteria 1932
50 Ga0068853_100787043 3300005539 Unclassified 910
51 Ga0068853_101810248 3300005539 Bacteria 592
52 Ga0070672_100689148 3300005543 Bacteria 894
53 Ga0070686_100166511 3300005544 Bacteria 1556
54 Ga0070686_100203406 3300005544 Unclassified 1421
55 Ga0070695_100478992 3300005545 Bacteria 959
56 Ga0070696_100429436 3300005546 Bacteria 1039
57 Ga0070693_100036853 3300005547 Bacteria 2722
58 Ga0070665_101076159 3300005548 Bacteria 816
59 Ga0070704_101135194 3300005549 Bacteria 711
60 Ga0068855_101015824 3300005563 Bacteria 871
61 Ga0070664_100715305 3300005564 Bacteria 934
62 Ga0070664_100897600 3300005564 Bacteria 831
63 Ga0070664_102261519 3300005564 Bacteria 516
64 Ga0068857_100038584 3300005577 Bacteria 4230
65 Ga0068854_100317823 3300005578 Bacteria 1264
66 Ga0068856_100004824 3300005614 Bacteria 13366
67 Ga0070702_100024021 3300005615 Bacteria 3246
68 Ga0068852_100616180 3300005616 Bacteria 1091
69 Ga0068852_100892105 3300005616 Unclassified 906
70 Ga0068859_100537601 3300005617 Bacteria 1263
71 Ga0068864_100291430 3300005618 Bacteria 1526
72 Ga0068866_10018861 3300005718 Bacteria 3129
73 Ga0068866_10528390 3300005718 Unclassified 785
74 Ga0068861_100136491 3300005719 Bacteria 1997
75 Ga0068861_100269446 3300005719 Bacteria 1461
76 Ga0068861_100321208 3300005719 Bacteria 1348
77 Ga0068863_100282055 3300005841 Bacteria 1610
78 Ga0068858_100346306 3300005842 Bacteria 1423
79 Ga0068860_100221012 3300005843 Bacteria 1839
80 Ga0068860_101084117 3300005843 Unclassified 820
81 Ga0081455_10001958 3300005937 Bacteria 24724
82 Ga0081455_10038490 3300005937 Bacteria 4235
83 Ga0081539_10001335 3300005985 Bacteria 42960
84 Ga0070717_10402681 3300006028 Bacteria 1229
85 Ga0070717_10777684 3300006028 Bacteria 870
86 Ga0070716_100083892 3300006173 Bacteria 1909
87 Ga0070712_100193602 3300006175 Bacteria 1593
88 Ga0070712_100798879 3300006175 Bacteria 809
89 Ga0070712_101569907 3300006175 Bacteria 575
90 Ga0068871_100169120 3300006358 Bacteria 1872
91 Ga0075430_100261305 3300006846 Bacteria 1434
92 Ga0075434_100001098 3300006871 Bacteria 22182
93 Ga0075429_100242477 3300006880 Bacteria 1579
94 Ga0068865_100311032 3300006881 Bacteria 1264
95 Ga0075436_100014593 3300006914 Bacteria 5384
96 Ga0097620_100537574 3300006931 Bacteria 1263
97 Ga0075435_100013491 3300007076 Bacteria 6080
98 Ga0075435_100517416 3300007076 Bacteria 1032
99 Ga0105245_10148865 3300009098 Bacteria 2212
100 Ga0105245_10213779 3300009098 Bacteria 1857
101 Ga0105245_10263414 3300009098 Bacteria 1678
102 Ga0105245_10723872 3300009098 Bacteria 1029
103 Ga0105247_10029724 3300009101 Bacteria 3312
104 Ga0114129_10333810 3300009147 Bacteria 2012
105 Ga0105243_10007737 3300009148 Bacteria 8262
106 Ga0105243_10157943 3300009148 Bacteria 1952
107 Ga0105243_10929672 3300009148 Bacteria 867
108 Ga0105241_10615228 3300009174 Bacteria 983
109 Ga0105242_10004600 3300009176 Bacteria 10695
110 Ga0105242_10064040 3300009176 Bacteria 3029
111 Ga0105248_10092363 3300009177 Bacteria 3409
112 Ga0105248_10754413 3300009177 Bacteria 1098
113 Ga0105237_11567022 3300009545 Bacteria 666
114 Ga0105238_10106683 3300009551 Bacteria 2783
115 Ga0105249_10243764 3300009553 Bacteria 1778
116 Ga0105249_13586917 3300009553 Unclassified 500
117 Ga0105239_10242882 3300010375 Bacteria 2021
118 Ga0105246_10005561 3300011119 Bacteria 7683
119 Ga0105246_11628393 3300011119 Unclassified 611
120 Ga0157374_10011853 3300013296 Bacteria 7563
121 Ga0157378_10324102 3300013297 Unclassified 1497
122 Ga0157378_10498292 3300013297 Bacteria 1216
123 Ga0163162_10109619 3300013306 Bacteria 2858
124 Ga0157372_10804468 3300013307 Bacteria 1092
125 Ga0157375_10169707 3300013308 Bacteria 2329
126 Ga0157375_13626900 3300013308 Bacteria 513
127 Ga0163163_10067164 3300014325 Bacteria 3564
128 Ga0163163_12405881 3300014325 Unclassified 585
129 Ga0157380_11525643 3300014326 Bacteria 722
130 Ga0182008_10205076 3300014497 Bacteria 1004
131 Ga0157377_10244954 3300014745 Bacteria 1159
132 Ga0157377_10527650 3300014745 Unclassified 830
133 Ga0157377_10972888 3300014745 Bacteria 640
134 Ga0157379_10065585 3300014968 Bacteria 3246
135 Ga0157376_10272270 3300014969 Bacteria 1591
136 Ga0157376_10426079 3300014969 Bacteria 1289
137 Ga0163161_11123798 3300017792 Bacteria 676
138 Ga0207653_10256158 3300025885 Bacteria 672
139 Ga0207692_10591589 3300025898 Bacteria 712
140 Ga0207642_10336242 3300025899 Unclassified 886
141 Ga0207642_10848028 3300025899 Unclassified 583
142 Ga0207710_10017031 3300025900 Bacteria 3079
143 Ga0207688_10019661 3300025901 Bacteria 3681
144 Ga0207688_10226757 3300025901 Unclassified 1127
145 Ga0207680_10367776 3300025903 Bacteria 1012
146 Ga0207699_10112024 3300025906 Bacteria 1750
147 Ga0207705_11100701 3300025909 Bacteria 612
148 Ga0207654_10061197 3300025911 Bacteria 2202
149 Ga0207707_11295194 3300025912 Bacteria 586
150 Ga0207671_10485940 3300025914 Bacteria 984
151 Ga0207671_10990002 3300025914 Bacteria 663
152 Ga0207693_10383723 3300025915 Bacteria 1099
153 Ga0207693_10429113 3300025915 Bacteria 1033
154 Ga0207663_10731261 3300025916 Unclassified 785
155 Ga0207663_10779156 3300025916 Bacteria 761
156 Ga0207663_11151256 3300025916 Bacteria 624
157 Ga0207662_10035000 3300025918 Bacteria 2932
158 Ga0207657_10006452 3300025919 Bacteria 12155
159 Ga0207657_11507247 3300025919 Unclassified 502
160 Ga0207649_11179829 3300025920 Bacteria 605
161 Ga0207694_10558344 3300025924 Bacteria 961
162 Ga0207650_10919927 3300025925 Bacteria 743
163 Ga0207659_10015553 3300025926 Bacteria 4934
164 Ga0207687_10062195 3300025927 Bacteria 2639
165 Ga0207687_10077354 3300025927 Bacteria 2393
166 Ga0207700_10382285 3300025928 Bacteria 1231
167 Ga0207700_10633722 3300025928 Bacteria 953
168 Ga0207664_10720456 3300025929 Bacteria 897
169 Ga0207644_10490449 3300025931 Unclassified 1013
170 Ga0207690_10194406 3300025932 Bacteria 1536
171 Ga0207690_10569824 3300025932 Bacteria 922
172 Ga0207706_10098192 3300025933 Bacteria 2576
173 Ga0207686_10090337 3300025934 Archaea 2020
174 Ga0207709_10336429 3300025935 Bacteria 1135
175 Ga0207709_11541110 3300025935 Unclassified 552
176 Ga0207709_11712778 3300025935 Unclassified 523
177 Ga0207670_10035361 3300025936 Bacteria 3238
178 Ga0207670_11815351 3300025936 Bacteria 518
179 Ga0207704_10234867 3300025938 Bacteria 1366
180 Ga0207704_10504738 3300025938 Unclassified 975
181 Ga0207704_10640435 3300025938 Unclassified 874
182 Ga0207665_10017247 3300025939 Bacteria 4743
183 Ga0207711_10505558 3300025941 Bacteria 1126
184 Ga0207711_10679595 3300025941 Bacteria 960
185 Ga0207689_10023840 3300025942 Bacteria 5134
186 Ga0207661_10042763 3300025944 Bacteria 3573
187 Ga0207679_10132354 3300025945 Unclassified 2003
188 Ga0207679_11437767 3300025945 Bacteria 633
189 Ga0207667_10617259 3300025949 Bacteria 1092
190 Ga0207712_10189257 3300025961 Bacteria 1623
191 Ga0207712_11266136 3300025961 Bacteria 659
192 Ga0207668_10247586 3300025972 Bacteria 1446
193 Ga0207668_10807734 3300025972 Bacteria 831
194 Ga0207640_10196694 3300025981 Bacteria 1524
195 Ga0207658_11077013 3300025986 Bacteria 734
196 Ga0207677_10280796 3300026023 Unclassified 1367
197 Ga0207677_10456192 3300026023 Bacteria 1096
198 Ga0207703_10314567 3300026035 Bacteria 1432
199 Ga0207703_10720672 3300026035 Bacteria 949
200 Ga0207702_10023825 3300026078 Bacteria 5078
201 Ga0207641_10148052 3300026088 Bacteria 2125
202 Ga0207641_11261548 3300026088 Unclassified 739
203 Ga0207648_10004177 3300026089 Bacteria 14926
204 Ga0207676_10132867 3300026095 Bacteria 2119
205 Ga0207674_10008088 3300026116 Bacteria 12192
206 Ga0207675_102477269 3300026118 Unclassified 530
207 Ga0207683_10071762 3300026121 Bacteria 3061
208 Ga0207683_10750112 3300026121 Bacteria 906
209 Ga0207698_10303385 3300026142 Bacteria 1487
210 Ga0207698_10684321 3300026142 Unclassified 1019
211 Ga0268264_10182984 3300028381 Bacteria 1905
212 Ga0307515_10307154 3300028794 Unclassified 1265
213 Ga0373948_0062174 3300034817 Bacteria 822
214 Ga0373926_0115387 3300035083 Bacteria 1010
215 Ga0373944_0012174 3300035089 Bacteria 2367
216 Ga0373953_0049682 3300035117 Bacteria 1693
217 Ga0373954_0664371 3300035118 Bacteria 517
218 Ga0373943_0026839 3300035170 Unclassified 2701
219 Ga0373946_0009647 3300035171 Bacteria 3562
220 Ga0373955_0087215 3300035172 Unclassified 1773
221 Ga0373924_0021839 3300035410 Bacteria 2498
222 Ga0373931_0508732 3300035691 Bacteria 778
223 Ga0373935_0105294 3300035692 Bacteria 1865
224 Ga0373935_0121531 3300035692 Bacteria 1745
225 Ga0373947_0019909 3300035725 Bacteria 3873
226 Ga0373947_0024465 3300035725 Bacteria 3519
227 Ga0373937_0678344 3300036401 Unclassified 976
228 Ga0373925_0032754 3300037068 Bacteria 3826
229 Ga0373925_0732004 3300037068 Bacteria 815
230 Ga0395900_0136623 3300037418 Bacteria 2512
231 Ga0395898_0584689 3300037466 Bacteria 1059
232 Ga0395898_0722331 3300037466 Bacteria 938
233 Ga0436364_0538701 3300037853 Bacteria 2562
234 Ga0436364_1548415 3300037853 Bacteria 798
235 Ga0395901_0085431 3300038443 Bacteria 3299
236 Ga0395901_0404118 3300038443 Bacteria 1403
237 Ga0395901_0538963 3300038443 Unclassified 1184
238 Ga0436365_0540670 3300039437 Bacteria 1020
239 Ga0436365_1927478 3300039437 Bacteria 542
240 Ga0436360_0367638 3300039438 Bacteria 696
241 Ga0436360_1042244 3300039438 Bacteria 2396
242 Ga0451791_0028386 3300041451 Unclassified 649
243 Ga0451793_0598440 3300041452 Bacteria 1480
244 Ga0451800_0554801 3300041459 Bacteria 716
245 Ga0451800_0902753 3300041459 Unclassified 652
246 Ga0451800_1660513 3300041459 Bacteria 597
247 Ga0451853_0491700 3300041512 Bacteria 626
248 Ga0451853_1406054 3300041512 Unclassified 1476
249 Ga0451853_1512758 3300041512 Bacteria 612
250 Ga0451853_3020805 3300041512 Bacteria 2087
251 Ga0466972_0388994 3300044658 Unclassified 653
252 Ga0466972_0423892 3300044658 Unclassified 624
253 Ga0466965_0376457 3300044683 Bacteria 781
254 Ga0466966_0075630 3300044684 Bacteria 2104
255 Ga0466966_0121772 3300044684 Unclassified 1602
256 Ga0466966_0178409 3300044684 Bacteria 1289
257 Ga0466961_0021290 3300044693 Bacteria 4174
258 Ga0466961_0106937 3300044693 Bacteria 1761
259 Ga0466961_0159882 3300044693 Bacteria 1404
260 Ga0466961_0453765 3300044693 Bacteria 776
261 Ga0466961_0784201 3300044693 Bacteria 569
262 Ga0466963_0006485 3300044694 Bacteria 6925
263 Ga0466963_0009386 3300044694 Bacteria 5893
264 Ga0466963_0125653 3300044694 Bacteria 1768
265 Ga0466963_0130678 3300044694 Bacteria 1734
266 Ga0466963_0342260 3300044694 Bacteria 1053
267 Ga0466963_0553779 3300044694 Unclassified 812
268 Ga0466964_0769208 3300044706 Unclassified 542
269 Ga0466971_0013210 3300044719 Bacteria 3625
270 Ga0466971_0051030 3300044719 Bacteria 1862
271 Ga0466971_0312911 3300044719 Bacteria 756
272 Ga0466970_0691069 3300044765 Bacteria 595
273 Ga0466957_0103567 3300044842 Bacteria 1797
274 Ga0466957_0143242 3300044842 Bacteria 1541
275 Ga0466957_0214394 3300044842 Bacteria 1269
276 Ga0466959_0067681 3300045049 Bacteria 2589
277 Ga0466959_0082068 3300045049 Bacteria 2323
278 Ga0466959_0124131 3300045049 Bacteria 1833
279 Ga0466959_0882090 3300045049 Bacteria 597
280 Ga0466958_0036634 3300045836 Bacteria 2937
281 Ga0466958_0047921 3300045836 Bacteria 2580
282 Ga0466958_0107658 3300045836 Bacteria 1739
283 Ga0466958_0424349 3300045836 Unclassified 860
284 Ga0466967_0032794 3300045976 Bacteria 4390
285 Ga0466967_0042536 3300045976 Bacteria 3927
286 Ga0466967_0280753 3300045976 Bacteria 1598
287 Ga0466967_0858812 3300045976 Bacteria 902
288 Ga0466967_1217106 3300045976 Bacteria 750
289 Ga0495592_0424555 3300046454 Bacteria 838
290 Ga0495603_0066235 3300046455 Bacteria 2127
291 Ga0495603_0130825 3300046455 Bacteria 1461
292 Ga0495629_0331330 3300046459 Unclassified 1040
293 Ga0495629_0530730 3300046459 Bacteria 791
294 Ga0495641_0109354 3300046461 Bacteria 1233
295 Ga0495641_0122960 3300046461 Bacteria 1158
296 Ga0495651_0171878 3300046462 Bacteria 1542
297 Ga0495653_0218364 3300046463 Bacteria 1283
298 Ga0495580_0004988 3300046472 Bacteria 11081
299 Ga0495582_0068536 3300046473 Bacteria 1960
300 Ga0495582_0216142 3300046473 Bacteria 1096
301 Ga0495639_0098029 3300046475 Bacteria 1381
302 Ga0495662_0045382 3300046476 Bacteria 2121
303 Ga0495664_0063599 3300046477 Bacteria 2199
304 Ga0495594_0116237 3300046499 Bacteria 1510
305 Ga0495608_0925049 3300046511 Unclassified 509
306 Ga0495618_0146483 3300046514 Bacteria 1509
307 Ga0495628_0365293 3300046516 Bacteria 1059
308 Ga0495630_0290852 3300046517 Bacteria 1248
309 Ga0495666_0011517 3300046526 Bacteria 4410
310 Ga0495652_0545835 3300046529 Bacteria 798
311 Ga0495665_0004476 3300046531 Bacteria 7539
312 Ga0495640_0111913 3300046533 Unclassified 1783
313 Ga0495640_0124402 3300046533 Bacteria 1673
314 Ga0495586_0053352 3300046535 Bacteria 2190
315 Ga0495587_0057944 3300046536 Bacteria 2276
316 Ga0495587_0668687 3300046536 Bacteria 570
317 Ga0495667_0003138 3300046559 Bacteria 11084
318 Ga0495634_0020996 3300046642 Bacteria 4624
319 Ga0495635_0088710 3300046663 Bacteria 2116
320 Ga0495635_0088826 3300046663 Bacteria 2114
321 Ga0495659_0212584 3300046664 Bacteria 796
322 Ga0495588_0628365 3300046674 Bacteria 562
323 Ga0495599_0458159 3300046678 Bacteria 754
324 Ga0495646_0186869 3300046680 Bacteria 1134
325 Ga0495647_0015584 3300046681 Unclassified 2665
326 Ga0495647_0179587 3300046681 Bacteria 920
327 Ga0495658_0043219 3300046683 Bacteria 2519
328 Ga0495658_0051590 3300046683 Bacteria 2330
329 Ga0495658_0434472 3300046683 Unclassified 838
330 Ga0495624_0043330 3300046690 Bacteria 2871
331 Ga0495624_0213044 3300046690 Unclassified 1171
332 Ga0495670_0344256 3300046691 Bacteria 802
333 Ga0495600_0075090 3300046809 Bacteria 2207
334 Ga0495581_0009567 3300047315 Bacteria 5604
335 Ga0495581_0167412 3300047315 Bacteria 1285
336 Ga0495674_0027372 3300047319 Bacteria 5210
337 Ga0495674_0046290 3300047319 Bacteria 3861
338 Ga0495676_0072164 3300047321 Bacteria 2652
339 Ga0495676_0122479 3300047321 Bacteria 1890
340 Ga0495680_0591146 3300047322 Bacteria 744
341 Ga0495675_0115188 3300047444 Unclassified 1676
342 Ga0495684_0001638 3300047471 Bacteria 17976
343 Ga0495593_0036864 3300047673 Unclassified 2648
344 Ga0495602_0612531 3300048088 Archaea 747
345 Ga0495602_0692291 3300048088 Bacteria 692
346 Ga0495614_0095828 3300048089 Bacteria 1293
347 Ga0496100_0216535 3300048903 Bacteria 1403
348 Ga0496100_0588116 3300048903 Bacteria 863
349 Ga0496100_0678464 3300048903 Bacteria 803
350 Ga0496101_0175034 3300048904 Archaea 1650
351 Ga0496101_0635491 3300048904 Bacteria 843
352 Ga0496101_1129063 3300048904 Unclassified 615
353 Ga0496102_0423162 3300048905 Unclassified 1251
354 Ga0496102_0514324 3300048905 Bacteria 1120
355 Ga0496102_0909000 3300048905 Bacteria 802
356 Ga0496103_0737757 3300048906 Unclassified 623
357 Ga0496104_0240270 3300048907 Bacteria 1723
358 Ga0496104_0281528 3300048907 Unclassified 1576
359 Ga0496105_0243855 3300048908 Bacteria 1457
360 Ga0496105_0463059 3300048908 Unclassified 999
361 Ga0496106_0089319 3300048909 Bacteria 2376
362 Ga0496106_0367564 3300048909 Bacteria 1156
363 Ga0496106_0723297 3300048909 Bacteria 792
364 Ga0496108_0006411 3300048911 Bacteria 9540
365 Ga0496108_0241618 3300048911 Unclassified 1571
366 Ga0496108_1383175 3300048911 Bacteria 589
367 Ga0496109_0176057 3300048912 Bacteria 2008
368 Ga0496109_0187101 3300048912 Unclassified 1946
369 Ga0496109_0198845 3300048912 Bacteria 1884
370 Ga0496110_0063637 3300048913 Bacteria 3259
371 Ga0496110_0670885 3300048913 Unclassified 937
372 Ga0496110_1604484 3300048913 Bacteria 561
373 Ga0496111_0024437 3300048914 Bacteria 4254
374 Ga0496112_0060218 3300048915 Bacteria 3741
375 Ga0496112_0121067 3300048915 Bacteria 2586
376 Ga0496112_0571480 3300048915 Bacteria 1063
377 Ga0496113_0201409 3300048916 Bacteria 1582
378 Ga0496113_0429260 3300048916 Bacteria 1062
379 Ga0496113_1383609 3300048916 Bacteria 545
380 Ga0496114_0059078 3300048917 Bacteria 3203
381 Ga0496114_0171433 3300048917 Bacteria 1891
382 Ga0496114_1319196 3300048917 Unclassified 609
383 Ga0496115_0019529 3300048918 Bacteria 5216
384 Ga0496115_0430112 3300048918 Bacteria 1068
385 Ga0496115_1004310 3300048918 Bacteria 637
386 Ga0501031_0027962 3300049568 Bacteria 3675
387 Ga0501031_0542453 3300049568 Unclassified 749
388 Ga0501031_0854400 3300049568 Unclassified 583
389 Ga0501032_0050274 3300049569 Bacteria 2811
390 Ga0501033_0004884 3300049570 Bacteria 10677
391 Ga0501033_0116775 3300049570 Bacteria 1938
392 Ga0501033_0131576 3300049570 Bacteria 1812
393 Ga0501034_0064576 3300049571 Bacteria 3674
394 Ga0501034_0101959 3300049571 Bacteria 2863
395 Ga0501034_0261213 3300049571 Bacteria 1674
396 Ga0501034_0700267 3300049571 Bacteria 911
397 Ga0501036_0133206 3300049572 Bacteria 2097
398 Ga0501036_0134134 3300049572 Bacteria 2089
399 Ga0501036_0264193 3300049572 Unclassified 1441
400 Ga0501037_0070232 3300049573 Bacteria 2548
401 Ga0501037_0099130 3300049573 Bacteria 2104
402 Ga0501038_0068104 3300049574 Bacteria 3026
403 Ga0501038_0416403 3300049574 Bacteria 1037
404 Ga0501039_0044096 3300049575 Bacteria 3444
405 Ga0501039_0257392 3300049575 Bacteria 1372
406 Ga0501042_0073236 3300049578 Bacteria 2450
407 Ga0501043_0044487 3300049579 Bacteria 3491
408 Ga0501043_0123606 3300049579 Bacteria 2029
409 Ga0501043_0126915 3300049579 Bacteria 2000
410 Ga0501046_0161736 3300049580 Unclassified 1683
411 Ga0501046_0230822 3300049580 Bacteria 1367
412 Ga0501046_0798374 3300049580 Bacteria 661
413 Ga0501047_0029477 3300049581 Bacteria 5290
414 Ga0501047_0242501 3300049581 Unclassified 1652
415 Ga0501048_0002568 3300049582 Bacteria 13908
416 Ga0501069_0242591 3300049585 Bacteria 1050
417 Ga0501070_0110346 3300049586 Bacteria 2273
418 Ga0501070_0483813 3300049586 Unclassified 995
419 Ga0501073_0010517 3300049589 Bacteria 6778
420 Ga0501073_0113394 3300049589 Bacteria 1880
421 Ga0501074_0798026 3300049590 Unclassified 665
422 Ga0501080_0106668 3300049742 Bacteria 2596
423 Ga0501080_0180264 3300049742 Bacteria 1944
424 Ga0501035_0026641 3300049822 Bacteria 5288
425 Ga0501035_0148821 3300049822 Bacteria 2032
426 Ga0501035_0162808 3300049822 Unclassified 1930
427 Ga0501035_0181441 3300049822 Bacteria 1813
428 Ga0501044_0127755 3300049823 Bacteria 2538
429 Ga0501044_0177489 3300049823 Bacteria 2098
430 Ga0501044_0199697 3300049823 Bacteria 1958
431 Ga0501045_0608348 3300049824 Unclassified 809
432 nmdc:mga0n895_1483_c1 3300050512 Bacteria 17595
433 nmdc:mga0rr50_1358521_c1 3300050513 Unclassified 602
434 nmdc:mga0rr50_16956_c1 3300050513 Bacteria 4851
435 nmdc:mga08x19_9967_c1 3300050514 Bacteria 5696
436 Ga0495601_0004605 3300053077 Bacteria 7979
437 Ga0495601_0083924 3300053077 Bacteria 2046
438 Ga0495612_0440703 3300053078 Bacteria 594
439 Ga0495595_0079109 3300053084 Bacteria 1563
440 Ga0495619_0076679 3300053085 Bacteria 2244
441 Ga0495619_0102571 3300053085 Bacteria 1948
442 Ga0495619_0764791 3300053085 Unclassified 654
443 Ga0501084_0176464 3300054114 Bacteria 1804
444 Ga0501084_1140749 3300054114 Unclassified 654
445 Ga0466962_0016550 3300061719 Bacteria 3556
446 Ga0070698_100242578
447 Ga0070658_11618391
448 Ga0070683_100014804
449 Ga0070683_100206107
450 Ga0070690_100371982
451 Ga0070670_101142706
452 Ga0068869_100017791
453 Ga0070680_100214667
454 Ga0070682_100024463
455 Ga0068868_100274730
456 Ga0070660_100011443
457 Ga0070689_100056537
458 Ga0070689_100506438
459 Ga0070691_10035274
460 Ga0070661_100122232
461 Ga0070661_101247046
462 Ga0070669_101656173
463 Ga0070675_100043550
464 Ga0070671_100730911
465 Ga0070673_100182674
466 Ga0070673_100634849
467 Ga0070688_100136236
468 Ga0070688_100209485
469 Ga0070659_100612005
470 Ga0070667_100243879
471 Ga0070667_100851485
472 Ga0070703_10038477
473 Ga0070714_100340017
474 Ga0070714_100827429
475 Ga0070713_101849476
476 Ga0070710_10454778
477 Ga0070701_10857964
478 Ga0070701_10976890
479 Ga0070711_100383130
480 Ga0070711_100887359
481 Ga0070711_100955256
482 Ga0070711_101805243
483 Ga0070700_100525076
484 Ga0070708_101145629
485 Ga0070678_100243661
486 Ga0070678_100714825
487 Ga0070662_100691972
488 Ga0070681_11697287
489 Ga0068867_100847455
490 Ga0070685_10435427
491 Ga0070685_10623299
492 Ga0070684_100090621
493 Ga0070684_101637243
494 Ga0068853_100177259
495 Ga0068853_100787043
496 Ga0068853_101810248
497 Ga0070672_100689148
498 Ga0070686_100166511
499 Ga0070686_100203406
500 Ga0070695_100478992
501 Ga0070696_100429436
502 Ga0070693_100036853
503 Ga0070665_101076159
504 Ga0070704_101135194
505 Ga0068855_101015824
506 Ga0070664_100715305
507 Ga0070664_100897600
508 Ga0070664_102261519
509 Ga0068857_100038584
510 Ga0068854_100317823
511 Ga0068856_100004824
512 Ga0070702_100024021
513 Ga0068852_100616180
514 Ga0068852_100892105
515 Ga0068859_100537601
516 Ga0068864_100291430
517 Ga0068866_10018861
518 Ga0068866_10528390
519 Ga0068861_100136491
520 Ga0068861_100269446
521 Ga0068861_100321208
522 Ga0068863_100282055
523 Ga0068858_100346306
524 Ga0068860_100221012
525 Ga0068860_101084117
526 Ga0081455_10001958
527 Ga0081455_10038490
528 Ga0081539_10001335
529 Ga0070717_10402681
530 Ga0070717_10777684
531 Ga0070716_100083892
532 Ga0070712_100193602
533 Ga0070712_100798879
534 Ga0070712_101569907
535 Ga0068871_100169120
536 Ga0075430_100261305
537 Ga0075434_100001098
538 Ga0075429_100242477
539 Ga0068865_100311032
540 Ga0075436_100014593
541 Ga0097620_100537574
542 Ga0075435_100013491
543 Ga0075435_100517416
544 Ga0105245_10148865
545 Ga0105245_10213779
546 Ga0105245_10263414
547 Ga0105245_10723872
548 Ga0105247_10029724
549 Ga0114129_10333810
550 Ga0105243_10007737
551 Ga0105243_10157943
552 Ga0105243_10929672
553 Ga0105241_10615228
554 Ga0105242_10004600
555 Ga0105242_10064040
556 Ga0105248_10092363
557 Ga0105248_10754413
558 Ga0105237_11567022
559 Ga0105238_10106683
560 Ga0105249_10243764
561 Ga0105249_13586917
562 Ga0105239_10242882
563 Ga0105246_10005561
564 Ga0105246_11628393
565 Ga0157374_10011853
566 Ga0157378_10324102
567 Ga0157378_10498292
568 Ga0163162_10109619
569 Ga0157372_10804468
570 Ga0157375_10169707
571 Ga0157375_13626900
572 Ga0163163_10067164
573 Ga0163163_12405881
574 Ga0157380_11525643
575 Ga0182008_10205076
576 Ga0157377_10244954
577 Ga0157377_10527650
578 Ga0157377_10972888
579 Ga0157379_10065585
580 Ga0157376_10272270
581 Ga0157376_10426079
582 Ga0163161_11123798
583 Ga0207653_10256158
584 Ga0207692_10591589
585 Ga0207642_10336242
586 Ga0207642_10848028
587 Ga0207710_10017031
588 Ga0207688_10019661
589 Ga0207688_10226757
590 Ga0207680_10367776
591 Ga0207699_10112024
592 Ga0207705_11100701
593 Ga0207654_10061197
594 Ga0207707_11295194
595 Ga0207671_10485940
596 Ga0207671_10990002
597 Ga0207693_10383723
598 Ga0207693_10429113
599 Ga0207663_10731261
600 Ga0207663_10779156
601 Ga0207663_11151256
602 Ga0207662_10035000
603 Ga0207657_10006452
604 Ga0207657_11507247
605 Ga0207649_11179829
606 Ga0207694_10558344
607 Ga0207650_10919927
608 Ga0207659_10015553
609 Ga0207687_10062195
610 Ga0207687_10077354
611 Ga0207700_10382285
612 Ga0207700_10633722
613 Ga0207664_10720456
614 Ga0207644_10490449
615 Ga0207690_10194406
616 Ga0207690_10569824
617 Ga0207706_10098192
618 Ga0207686_10090337
619 Ga0207709_10336429
620 Ga0207709_11541110
621 Ga0207709_11712778
622 Ga0207670_10035361
623 Ga0207670_11815351
624 Ga0207704_10234867
625 Ga0207704_10504738
626 Ga0207704_10640435
627 Ga0207665_10017247
628 Ga0207711_10505558
629 Ga0207711_10679595
630 Ga0207689_10023840
631 Ga0207661_10042763
632 Ga0207679_10132354
633 Ga0207679_11437767
634 Ga0207667_10617259
635 Ga0207712_10189257
636 Ga0207712_11266136
637 Ga0207668_10247586
638 Ga0207668_10807734
639 Ga0207640_10196694
640 Ga0207658_11077013
641 Ga0207677_10280796
642 Ga0207677_10456192
643 Ga0207703_10314567
644 Ga0207703_10720672
645 Ga0207702_10023825
646 Ga0207641_10148052
647 Ga0207641_11261548
648 Ga0207648_10004177
649 Ga0207676_10132867
650 Ga0207674_10008088
651 Ga0207675_102477269
652 Ga0207683_10071762
653 Ga0207683_10750112
654 Ga0207698_10303385
655 Ga0207698_10684321
656 Ga0268264_10182984
657 Ga0307515_10307154
658 Ga0373948_0062174
659 Ga0373926_0115387
660 Ga0373944_0012174
661 Ga0373953_0049682
662 Ga0373954_0664371
663 Ga0373943_0026839
664 Ga0373946_0009647
665 Ga0373955_0087215
666 Ga0373924_0021839
667 Ga0373931_0508732
668 Ga0373935_0105294
669 Ga0373935_0121531
670 Ga0373947_0019909
671 Ga0373947_0024465
672 Ga0373937_0678344
673 Ga0373925_0032754
674 Ga0373925_0732004
675 Ga0395900_0136623
676 Ga0395898_0584689
677 Ga0395898_0722331
678 Ga0436364_0538701
679 Ga0436364_1548415
680 Ga0395901_0085431
681 Ga0395901_0404118
682 Ga0395901_0538963
683 Ga0436365_0540670
684 Ga0436365_1927478
685 Ga0436360_0367638
686 Ga0436360_1042244
687 Ga0451791_0028386
688 Ga0451793_0598440
689 Ga0451800_0554801
690 Ga0451800_0902753
691 Ga0451800_1660513
692 Ga0451853_0491700
693 Ga0451853_1406054
694 Ga0451853_1512758
695 Ga0451853_3020805
696 Ga0466972_0388994
697 Ga0466972_0423892
698 Ga0466965_0376457
699 Ga0466966_0075630
700 Ga0466966_0121772
701 Ga0466966_0178409
702 Ga0466961_0021290
703 Ga0466961_0106937
704 Ga0466961_0159882
705 Ga0466961_0453765
706 Ga0466961_0784201
707 Ga0466963_0006485
708 Ga0466963_0009386
709 Ga0466963_0125653
710 Ga0466963_0130678
711 Ga0466963_0342260
712 Ga0466963_0553779
713 Ga0466964_0769208
714 Ga0466971_0013210
715 Ga0466971_0051030
716 Ga0466971_0312911
717 Ga0466970_0691069
718 Ga0466957_0103567
719 Ga0466957_0143242
720 Ga0466957_0214394
721 Ga0466959_0067681
722 Ga0466959_0082068
723 Ga0466959_0124131
724 Ga0466959_0882090
725 Ga0466958_0036634
726 Ga0466958_0047921
727 Ga0466958_0107658
728 Ga0466958_0424349
729 Ga0466967_0032794
730 Ga0466967_0042536
731 Ga0466967_0280753
732 Ga0466967_0858812
733 Ga0466967_1217106
734 Ga0495592_0424555
735 Ga0495603_0066235
736 Ga0495603_0130825
737 Ga0495629_0331330
738 Ga0495629_0530730
739 Ga0495641_0109354
740 Ga0495641_0122960
741 Ga0495651_0171878
742 Ga0495653_0218364
743 Ga0495580_0004988
744 Ga0495582_0068536
745 Ga0495582_0216142
746 Ga0495639_0098029
747 Ga0495662_0045382
748 Ga0495664_0063599
749 Ga0495594_0116237
750 Ga0495608_0925049
751 Ga0495618_0146483
752 Ga0495628_0365293
753 Ga0495630_0290852
754 Ga0495666_0011517
755 Ga0495652_0545835
756 Ga0495665_0004476
757 Ga0495640_0111913
758 Ga0495640_0124402
759 Ga0495586_0053352
760 Ga0495587_0057944
761 Ga0495587_0668687
762 Ga0495667_0003138
763 Ga0495634_0020996
764 Ga0495635_0088710
765 Ga0495635_0088826
766 Ga0495659_0212584
767 Ga0495588_0628365
768 Ga0495599_0458159
769 Ga0495646_0186869
770 Ga0495647_0015584
771 Ga0495647_0179587
772 Ga0495658_0043219
773 Ga0495658_0051590
774 Ga0495658_0434472
775 Ga0495624_0043330
776 Ga0495624_0213044
777 Ga0495670_0344256
778 Ga0495600_0075090
779 Ga0495581_0009567
780 Ga0495581_0167412
781 Ga0495674_0027372
782 Ga0495674_0046290
783 Ga0495676_0072164
784 Ga0495676_0122479
785 Ga0495680_0591146
786 Ga0495675_0115188
787 Ga0495684_0001638
788 Ga0495593_0036864
789 Ga0495602_0612531
790 Ga0495602_0692291
791 Ga0495614_0095828
792 Ga0496100_0216535
793 Ga0496100_0588116
794 Ga0496100_0678464
795 Ga0496101_0175034
796 Ga0496101_0635491
797 Ga0496101_1129063
798 Ga0496102_0423162
799 Ga0496102_0514324
800 Ga0496102_0909000
801 Ga0496103_0737757
802 Ga0496104_0240270
803 Ga0496104_0281528
804 Ga0496105_0243855
805 Ga0496105_0463059
806 Ga0496106_0089319
807 Ga0496106_0367564
808 Ga0496106_0723297
809 Ga0496108_0006411
810 Ga0496108_0241618
811 Ga0496108_1383175
812 Ga0496109_0176057
813 Ga0496109_0187101
814 Ga0496109_0198845
815 Ga0496110_0063637
816 Ga0496110_0670885
817 Ga0496110_1604484
818 Ga0496111_0024437
819 Ga0496112_0060218
820 Ga0496112_0121067
821 Ga0496112_0571480
822 Ga0496113_0201409
823 Ga0496113_0429260
824 Ga0496113_1383609
825 Ga0496114_0059078
826 Ga0496114_0171433
827 Ga0496114_1319196
828 Ga0496115_0019529
829 Ga0496115_0430112
830 Ga0496115_1004310
831 Ga0501031_0027962
832 Ga0501031_0542453
833 Ga0501031_0854400
834 Ga0501032_0050274
835 Ga0501033_0004884
836 Ga0501033_0116775
837 Ga0501033_0131576
838 Ga0501034_0064576
839 Ga0501034_0101959
840 Ga0501034_0261213
841 Ga0501034_0700267
842 Ga0501036_0133206
843 Ga0501036_0134134
844 Ga0501036_0264193
845 Ga0501037_0070232
846 Ga0501037_0099130
847 Ga0501038_0068104
848 Ga0501038_0416403
849 Ga0501039_0044096
850 Ga0501039_0257392
851 Ga0501042_0073236
852 Ga0501043_0044487
853 Ga0501043_0123606
854 Ga0501043_0126915
855 Ga0501046_0161736
856 Ga0501046_0230822
857 Ga0501046_0798374
858 Ga0501047_0029477
859 Ga0501047_0242501
860 Ga0501048_0002568
861 Ga0501069_0242591
862 Ga0501070_0110346
863 Ga0501070_0483813
864 Ga0501073_0010517
865 Ga0501073_0113394
866 Ga0501074_0798026
867 Ga0501080_0106668
868 Ga0501080_0180264
869 Ga0501035_0026641
870 Ga0501035_0148821
871 Ga0501035_0162808
872 Ga0501035_0181441
873 Ga0501044_0127755
874 Ga0501044_0177489
875 Ga0501044_0199697
876 Ga0501045_0608348
877 nmdc:mga0n895_1483_c1
878 nmdc:mga0rr50_1358521_c1
879 nmdc:mga0rr50_16956_c1
880 nmdc:mga08x19_9967_c1
881 Ga0495601_0004605
882 Ga0495601_0083924
883 Ga0495612_0440703
884 Ga0495595_0079109
885 Ga0495619_0076679
886 Ga0495619_0102571
887 Ga0495619_0764791
888 Ga0501084_0176464
889 Ga0501084_1140749
890 Ga0466962_0016550

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

29

102

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dym-assembly1.cif.gz_A-2 crystal structure of a padr family transcription regulator from hypervirulent clostridium difficile r20291 - cdpadr_0991 to 1.89 angstrom resolution 0.9043 10 103
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.903 10 103
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.8957 1 100
6pcp-assembly2.cif.gz_C mechanism for regulation of dna binding of bordetella bronchiseptica bpsr by 6-hydroxynicotinic acid 0.8935 10 87
5zhv-assembly1.cif.gz_B crystal structure of the padr-family transcriptional regulator rv3488 of mycobacterium tuberculosis h37rv in complex with zinc ion 0.8876 4 96
ID Description Score Start End Superfamily
af_P64588_52_154_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9151 1 91 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9069 10 87 1.10.10.10
5dymA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9042 10 103 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8797 3 103 1.10.10.10
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8783 10 102 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7D7A3C7-F1-model_v4 PadR family transcriptional regulator 0.9796 10 105
AF-A0A7W1QDS0-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9786 1 104
AF-A0A800C6M0-F1-model_v4 PadR family transcriptional regulator 0.9775 11 89
AF-B5CPV7-F1-model_v4 Transcriptional regulator, PadR family 0.9768 11 104
AF-A0A7V8NIE9-F1-model_v4 PadR family transcriptional regulator 0.9764 11 103

Map