F445442

General Info

Members Datasets Scaffolds Average Seq Length
445 266 890 207

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_100876908|Ga0070678_1008769081
Length 232
Sequence MDHPTASRQSDADTLPPAAAALFELAEGIAGFMPADEGRALYDTAVGYLGDGTGVEIGTYCGKSTVMLGAAAKQTGGLVFTVDHHHGSEEHQAGWEYHDTTMVDPVTGLFDTLPALRHTLDAAGLDDHVVAIVGRSPVVARRWRIPLRFLFIDGGHTEEAANGDFDGWARWVDVGGALVIHDVFPDPADGGQAPFHIYRRALDTGDFREVRATGSMRVLERVSGRAGALGES

Samples

Sample ID Description Type Environment
1 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
169 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
170 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
171 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
172 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
173 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
174 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
175 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
176 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
177 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
178 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
179 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
183 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
184 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
199 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
218 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
219 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
220 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
233 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
238 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
244 2527291629 Frankia sp. BMG5.23 Isolate Nodule
245 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
246 2547132424 Nocardia nova SH22a Isolate Unclassified
247 2576861822 Frankia sp. CeD Isolate Nodule
248 2671180195 Frankia sp. CcI49 Isolate Nodule
249 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
250 2684623036 Frankia sp. CgIM4 Isolate Nodule
251 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
252 2710264753 Frankia sp. KB5 Isolate Nodule
253 2773857922 Frankia sp. CcI49 Isolate Nodule
254 2773857924 Frankia sp. CgIS1 Isolate Nodule
255 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
256 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
257 2891562705 Microbispora tritici MT50 Isolate Unclassified
258 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
259 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
260 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
261 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
262 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
263 8002775197 Frankia nepalensis CN7 Isolate Nodule
264 8002784119 Frankia sp. AgB1.9 Isolate Nodule
265 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
266 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.83
Metatranscriptomes 0
Isolates 5.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.52
Nodule 2.92
Rhizoplane 8.31
Rhizosphere 77.75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070678_100876908 3300005456 Bacteria 819
2 JGI24750J21931_1010530 3300002070 Bacteria 1206
3 JGI24744J21845_10001445 3300002077 Bacteria 4724
4 Ga0070676_10017555 3300005328 Bacteria 3959
5 Ga0070683_100735919 3300005329 Bacteria 945
6 Ga0070690_100004130 3300005330 Bacteria 8041
7 Ga0070690_100116611 3300005330 Bacteria 1788
8 Ga0068869_100013638 3300005334 Bacteria 5412
9 Ga0068869_100042319 3300005334 Bacteria 3265
10 Ga0068869_100525330 3300005334 Bacteria 991
11 Ga0070682_100002894 3300005337 Bacteria 9520
12 Ga0070682_100201699 3300005337 Bacteria 1403
13 Ga0068868_100006415 3300005338 Bacteria 8324
14 Ga0068868_100097382 3300005338 Bacteria 2377
15 Ga0070689_100005039 3300005340 Bacteria 8980
16 Ga0070691_10002367 3300005341 Bacteria 8368
17 Ga0070668_100002382 3300005347 Bacteria 13810
18 Ga0070668_100023009 3300005347 Bacteria 4711
19 Ga0070668_100311144 3300005347 Bacteria 1324
20 Ga0070669_100003187 3300005353 Bacteria 11795
21 Ga0070669_100108082 3300005353 Bacteria 2108
22 Ga0070675_100070827 3300005354 Bacteria 2891
23 Ga0070675_100472604 3300005354 Bacteria 1127
24 Ga0070671_100189307 3300005355 Bacteria 1744
25 Ga0070674_100023828 3300005356 Bacteria 3968
26 Ga0070674_100129721 3300005356 Bacteria 1878
27 Ga0070673_100194044 3300005364 Bacteria 1746
28 Ga0070688_100066114 3300005365 Bacteria 2300
29 Ga0070667_100000868 3300005367 Bacteria 28062
30 Ga0070667_100006015 3300005367 Bacteria 10082
31 Ga0070667_100026553 3300005367 Bacteria 4817
32 Ga0070703_10174838 3300005406 Bacteria 825
33 Ga0070709_10026390 3300005434 Bacteria 3443
34 Ga0070709_10132576 3300005434 Bacteria 1703
35 Ga0070714_100179920 3300005435 Bacteria 1923
36 Ga0070714_100476723 3300005435 Bacteria 1188
37 Ga0070714_100591818 3300005435 Bacteria 1065
38 Ga0070713_100042820 3300005436 Bacteria 3698
39 Ga0070710_10000420 3300005437 Bacteria 19961
40 Ga0070710_10022357 3300005437 Bacteria 3306
41 Ga0070701_10022399 3300005438 Bacteria 3029
42 Ga0070711_100007242 3300005439 Bacteria 6740
43 Ga0070711_100015362 3300005439 Bacteria 4846
44 Ga0070711_100030821 3300005439 Bacteria 3555
45 Ga0070705_100663127 3300005440 Bacteria 815
46 Ga0070700_100008010 3300005441 Bacteria 5740
47 Ga0070700_100117661 3300005441 Bacteria 1776
48 Ga0070694_100009049 3300005444 Bacteria 6102
49 Ga0070663_100128242 3300005455 Bacteria 1923
50 Ga0070678_100002296 3300005456 Bacteria 10418
51 Ga0070678_100068537 3300005456 Bacteria 2645
52 Ga0070662_100015871 3300005457 Bacteria 5052
53 Ga0068867_100001521 3300005459 Bacteria 16076
54 Ga0068867_100180383 3300005459 Bacteria 1678
55 Ga0070685_10063333 3300005466 Bacteria 2171
56 Ga0070707_100000127 3300005468 Bacteria 71273
57 Ga0070698_100001111 3300005471 Bacteria 29683
58 Ga0070679_100423190 3300005530 Bacteria 1277
59 Ga0070697_100432460 3300005536 Bacteria 1145
60 Ga0068853_100168475 3300005539 Bacteria 1980
61 Ga0070686_100105459 3300005544 Bacteria 1911
62 Ga0070686_100510197 3300005544 Bacteria 934
63 Ga0070695_100014597 3300005545 Bacteria 4736
64 Ga0070695_100113663 3300005545 Bacteria 1841
65 Ga0070696_100006186 3300005546 Bacteria 8002
66 Ga0070693_100006119 3300005547 Bacteria 5831
67 Ga0070693_100114435 3300005547 Bacteria 1664
68 Ga0070665_100007765 3300005548 Bacteria 10892
69 Ga0070665_100295029 3300005548 Bacteria 1624
70 Ga0070704_100001979 3300005549 Bacteria 11332
71 Ga0068855_100201417 3300005563 Bacteria 2241
72 Ga0068857_100379234 3300005577 Bacteria 1313
73 Ga0068854_100005710 3300005578 Bacteria 7861
74 Ga0068854_100191085 3300005578 Bacteria 1604
75 Ga0068856_100082906 3300005614 Bacteria 3183
76 Ga0068856_100253236 3300005614 Bacteria 1776
77 Ga0070702_100025720 3300005615 Bacteria 3156
78 Ga0068852_100050090 3300005616 Bacteria 3577
79 Ga0068859_100008532 3300005617 Bacteria 10366
80 Ga0068859_100010254 3300005617 Bacteria 9432
81 Ga0068859_100349460 3300005617 Bacteria 1573
82 Ga0068864_100001159 3300005618 Bacteria 21922
83 Ga0068866_10000350 3300005718 Bacteria 21668
84 Ga0068866_10149241 3300005718 Bacteria 1352
85 Ga0068861_100053185 3300005719 Bacteria 3080
86 Ga0068861_100171749 3300005719 Bacteria 1797
87 Ga0068851_10155709 3300005834 Bacteria 1252
88 Ga0068863_100002097 3300005841 Bacteria 19761
89 Ga0068863_101091339 3300005841 Bacteria 802
90 Ga0068858_100004624 3300005842 Bacteria 13472
91 Ga0068858_100999591 3300005842 Bacteria 820
92 Ga0068860_100000038 3300005843 Bacteria 232936
93 Ga0068860_100000819 3300005843 Bacteria 34822
94 Ga0068860_100836470 3300005843 Bacteria 935
95 Ga0068862_100000064 3300005844 Bacteria 124473
96 Ga0068862_100020953 3300005844 Bacteria 5462
97 Ga0081455_10049679 3300005937 Bacteria 3614
98 Ga0081455_10277792 3300005937 Bacteria 1211
99 Ga0070717_10009294 3300006028 Bacteria 7386
100 Ga0070717_10221277 3300006028 Bacteria 1664
101 Ga0070717_10438704 3300006028 Bacteria 1176
102 Ga0075365_10016319 3300006038 Bacteria 4515
103 Ga0075365_10022031 3300006038 Bacteria 3984
104 Ga0075365_10460875 3300006038 Bacteria 898
105 Ga0075368_10014714 3300006042 Bacteria 2894
106 Ga0075363_100000026 3300006048 Bacteria 30639
107 Ga0075363_100007557 3300006048 Bacteria 5007
108 Ga0075364_10004944 3300006051 Bacteria 7723
109 Ga0070716_100005191 3300006173 Bacteria 6296
110 Ga0070716_100010855 3300006173 Bacteria 4580
111 Ga0070712_100001563 3300006175 Bacteria 14001
112 Ga0070712_100007693 3300006175 Bacteria 6739
113 Ga0070712_100008365 3300006175 Bacteria 6506
114 Ga0075367_10002811 3300006178 Bacteria 8080
115 Ga0075369_10000539 3300006186 Bacteria 11962
116 Ga0075369_10009253 3300006186 Bacteria 3821
117 Ga0075369_10056094 3300006186 Bacteria 1712
118 Ga0097621_100561456 3300006237 Bacteria 1040
119 Ga0075370_10004033 3300006353 Bacteria 7058
120 Ga0075370_10006005 3300006353 Bacteria 6082
121 Ga0075370_10020939 3300006353 Bacteria 3581
122 Ga0075370_10021412 3300006353 Bacteria 3542
123 Ga0075370_10025081 3300006353 Bacteria 3296
124 Ga0075370_10052215 3300006353 Bacteria 2319
125 Ga0075428_100092168 3300006844 Bacteria 3304
126 Ga0075430_100002290 3300006846 Bacteria 15866
127 Ga0075431_100029054 3300006847 Bacteria 5688
128 Ga0075434_100100864 3300006871 Bacteria 2893
129 Ga0075429_100001611 3300006880 Bacteria 18624
130 Ga0075429_100141993 3300006880 Bacteria 2102
131 Ga0068865_100003691 3300006881 Bacteria 9201
132 Ga0068865_100102269 3300006881 Bacteria 2100
133 Ga0068865_100717480 3300006881 Bacteria 856
134 Ga0068865_100811040 3300006881 Bacteria 808
135 Ga0097620_100008532 3300006931 Bacteria 10366
136 Ga0097620_100010254 3300006931 Bacteria 9432
137 Ga0097620_100349462 3300006931 Bacteria 1573
138 Ga0105250_10060960 3300009092 Bacteria 1516
139 Ga0105250_10082750 3300009092 Bacteria 1302
140 Ga0105245_10003194 3300009098 Bacteria 14659
141 Ga0105245_10011842 3300009098 Bacteria 7587
142 Ga0105245_10142638 3300009098 Bacteria 2258
143 Ga0105247_10000021 3300009101 Bacteria 229443
144 Ga0105247_10005631 3300009101 Bacteria 7859
145 Ga0105247_10018907 3300009101 Bacteria 4137
146 Ga0114129_10004683 3300009147 Bacteria 19326
147 Ga0114129_11172093 3300009147 Bacteria 958
148 Ga0105243_10001183 3300009148 Bacteria 23550
149 Ga0105243_10770569 3300009148 Bacteria 945
150 Ga0105241_10276855 3300009174 Bacteria 1432
151 Ga0105242_10008274 3300009176 Bacteria 7992
152 Ga0105242_10011000 3300009176 Bacteria 6951
153 Ga0105248_10000777 3300009177 Bacteria 35858
154 Ga0105248_10017115 3300009177 Bacteria 7986
155 Ga0105248_10020788 3300009177 Bacteria 7272
156 Ga0105248_10512874 3300009177 Bacteria 1352
157 Ga0105248_10759807 3300009177 Bacteria 1094
158 Ga0105237_10026580 3300009545 Bacteria 5916
159 Ga0105237_10168997 3300009545 Bacteria 2186
160 Ga0105238_10380497 3300009551 Bacteria 1403
161 Ga0105249_10000334 3300009553 Bacteria 47607
162 Ga0105249_10008828 3300009553 Bacteria 8802
163 Ga0105249_10042831 3300009553 Bacteria 4118
164 Ga0105249_10050167 3300009553 Bacteria 3805
165 Ga0105239_10011133 3300010375 Bacteria 10040
166 Ga0105239_10637532 3300010375 Bacteria 1217
167 Ga0105246_10051660 3300011119 Bacteria 2824
168 Ga0157374_10006683 3300013296 Bacteria 9799
169 Ga0157378_10000812 3300013297 Bacteria 29018
170 Ga0163162_10022754 3300013306 Bacteria 6179
171 Ga0163162_10305821 3300013306 Bacteria 1722
172 Ga0163162_11207079 3300013306 Bacteria 858
173 Ga0157372_10028158 3300013307 Bacteria 6130
174 Ga0157372_10192285 3300013307 Bacteria 2364
175 Ga0157375_10028618 3300013308 Bacteria 5227
176 Ga0157375_10196727 3300013308 Bacteria 2171
177 Ga0157375_10937733 3300013308 Bacteria 1008
178 Ga0163163_10006468 3300014325 Bacteria 10249
179 Ga0163163_10031312 3300014325 Bacteria 5133
180 Ga0163163_11243574 3300014325 Bacteria 807
181 Ga0157380_10001247 3300014326 Bacteria 16520
182 Ga0157380_11362581 3300014326 Bacteria 759
183 Ga0157377_10025501 3300014745 Bacteria 3153
184 Ga0157379_10004209 3300014968 Bacteria 12286
185 Ga0157379_10019781 3300014968 Bacteria 5949
186 Ga0157379_10047179 3300014968 Bacteria 3842
187 Ga0157379_10126177 3300014968 Bacteria 2302
188 Ga0157376_10107230 3300014969 Bacteria 2452
189 Ga0157376_10339486 3300014969 Bacteria 1434
190 Ga0163161_10149484 3300017792 Bacteria 1774
191 Ga0207656_10208463 3300025321 Bacteria 946
192 Ga0207696_1044994 3300025711 Bacteria 1278
193 Ga0207692_10003131 3300025898 Bacteria 6416
194 Ga0207692_10018600 3300025898 Bacteria 3122
195 Ga0207642_10003183 3300025899 Bacteria 5150
196 Ga0207642_10047025 3300025899 Bacteria 1926
197 Ga0207710_10000027 3300025900 Bacteria 307001
198 Ga0207710_10000045 3300025900 Bacteria 210957
199 Ga0207710_10001642 3300025900 Bacteria 10919
200 Ga0207688_10001401 3300025901 Bacteria 12564
201 Ga0207680_10025367 3300025903 Bacteria 3269
202 Ga0207647_10030141 3300025904 Bacteria 3503
203 Ga0207685_10003531 3300025905 Bacteria 3819
204 Ga0207685_10005711 3300025905 Bacteria 3316
205 Ga0207699_10003454 3300025906 Bacteria 7535
206 Ga0207699_10020054 3300025906 Bacteria 3576
207 Ga0207645_10038084 3300025907 Bacteria 3085
208 Ga0207645_10071098 3300025907 Bacteria 2227
209 Ga0207684_10001704 3300025910 Bacteria 23348
210 Ga0207654_10050747 3300025911 Bacteria 2385
211 Ga0207671_10152634 3300025914 Bacteria 1785
212 Ga0207693_10001138 3300025915 Bacteria 23835
213 Ga0207693_10021273 3300025915 Bacteria 5155
214 Ga0207693_10030599 3300025915 Bacteria 4253
215 Ga0207663_10002081 3300025916 Bacteria 9532
216 Ga0207646_10000264 3300025922 Bacteria 71299
217 Ga0207681_10136431 3300025923 Bacteria 1821
218 Ga0207694_10720211 3300025924 Bacteria 842
219 Ga0207659_10119352 3300025926 Bacteria 2019
220 Ga0207687_10004995 3300025927 Bacteria 8786
221 Ga0207687_10189337 3300025927 Bacteria 1600
222 Ga0207687_10489784 3300025927 Bacteria 1025
223 Ga0207700_10001853 3300025928 Bacteria 11977
224 Ga0207700_10059058 3300025928 Bacteria 2900
225 Ga0207664_10002105 3300025929 Bacteria 13093
226 Ga0207664_10219773 3300025929 Bacteria 1647
227 Ga0207706_10043257 3300025933 Bacteria 3992
228 Ga0207706_10069018 3300025933 Bacteria 3109
229 Ga0207706_10617346 3300025933 Bacteria 930
230 Ga0207686_10019904 3300025934 Bacteria 3827
231 Ga0207686_10073363 3300025934 Bacteria 2208
232 Ga0207709_10067596 3300025935 Bacteria 2256
233 Ga0207709_10508989 3300025935 Bacteria 941
234 Ga0207670_10017494 3300025936 Bacteria 4333
235 Ga0207669_10002560 3300025937 Bacteria 7767
236 Ga0207704_10001134 3300025938 Bacteria 11852
237 Ga0207704_10510592 3300025938 Bacteria 970
238 Ga0207665_10006210 3300025939 Bacteria 7935
239 Ga0207665_10017038 3300025939 Bacteria 4773
240 Ga0207691_10020920 3300025940 Bacteria 6182
241 Ga0207711_10003965 3300025941 Bacteria 12733
242 Ga0207711_10006464 3300025941 Bacteria 9865
243 Ga0207711_10231147 3300025941 Bacteria 1694
244 Ga0207711_10583672 3300025941 Bacteria 1043
245 Ga0207689_10071137 3300025942 Bacteria 2857
246 Ga0207689_10131509 3300025942 Bacteria 2060
247 Ga0207651_10049739 3300025960 Bacteria 2842
248 Ga0207712_10000282 3300025961 Bacteria 48535
249 Ga0207712_10032862 3300025961 Bacteria 3504
250 Ga0207712_10307297 3300025961 Bacteria 1304
251 Ga0207640_10092502 3300025981 Bacteria 2098
252 Ga0207658_10000745 3300025986 Bacteria 28059
253 Ga0207658_10013912 3300025986 Bacteria 5507
254 Ga0207658_10043084 3300025986 Bacteria 3279
255 Ga0207658_10052436 3300025986 Bacteria 3010
256 Ga0207677_10002015 3300026023 Bacteria 10714
257 Ga0207677_10234555 3300026023 Bacteria 1480
258 Ga0207703_10003259 3300026035 Bacteria 13629
259 Ga0207703_10019552 3300026035 Bacteria 5293
260 Ga0207639_10010884 3300026041 Bacteria 6309
261 Ga0207678_10016589 3300026067 Bacteria 6469
262 Ga0207708_10000968 3300026075 Bacteria 21532
263 Ga0207708_10399597 3300026075 Bacteria 1136
264 Ga0207702_10508944 3300026078 Bacteria 1174
265 Ga0207641_10006741 3300026088 Bacteria 9622
266 Ga0207648_10006846 3300026089 Bacteria 11296
267 Ga0207676_10078110 3300026095 Bacteria 2680
268 Ga0207674_10136246 3300026116 Bacteria 2417
269 Ga0207675_100000092 3300026118 Bacteria 70351
270 Ga0207675_100038864 3300026118 Bacteria 4440
271 Ga0207675_100168271 3300026118 Bacteria 2094
272 Ga0207683_10000319 3300026121 Bacteria 43887
273 Ga0207683_10361001 3300026121 Bacteria 1334
274 Ga0207683_10480578 3300026121 Bacteria 1146
275 Ga0207698_10291055 3300026142 Bacteria 1516
276 Ga0268266_10115358 3300028379 Bacteria 2384
277 Ga0268265_10000028 3300028380 Bacteria 236467
278 Ga0268265_10007435 3300028380 Bacteria 7398
279 Ga0268265_10088918 3300028380 Bacteria 2462
280 Ga0268264_10000092 3300028381 Bacteria 232950
281 Ga0268264_10011564 3300028381 Bacteria 7288
282 Ga0268264_10112834 3300028381 Bacteria 2384
283 Ga0268264_10490281 3300028381 Bacteria 1197
284 Ga0307413_10025235 3300031824 Bacteria 3255
285 Ga0307413_10117350 3300031824 Bacteria 1795
286 Ga0307410_10005560 3300031852 Bacteria 6688
287 Ga0307409_100146001 3300031995 Bacteria 2046
288 Ga0307411_10852353 3300032005 Bacteria 806
289 Ga0373952_0011585 3300035092 Bacteria 1723
290 Ga0373943_0191245 3300035170 Bacteria 1129
291 Ga0373955_0004699 3300035172 Bacteria 6068
292 Ga0373962_0076589 3300035242 Bacteria 1009
293 Ga0373931_0012414 3300035691 Bacteria 4127
294 Ga0373931_0028996 3300035691 Bacteria 2838
295 Ga0373947_0246149 3300035725 Bacteria 1181
296 Ga0373925_0068691 3300037068 Bacteria 2676
297 Ga0436365_0098483 3300039437 Bacteria 13081
298 Ga0436365_1383150 3300039437 Bacteria 33041
299 Ga0436363_0933242 3300039450 Bacteria 2781
300 Ga0439466_0003904 3300041411 Bacteria 5752
301 Ga0439466_0050430 3300041411 Bacteria 1365
302 Ga0439465_0010140 3300041413 Bacteria 2961
303 Ga0439465_0018906 3300041413 Bacteria 2153
304 Ga0439465_0032455 3300041413 Bacteria 1667
305 Ga0439465_0178529 3300041413 Bacteria 767
306 Ga0451789_0098901 3300041443 Bacteria 975
307 Ga0439431_0062043 3300041997 Bacteria 985
308 Ga0439445_0020768 3300042004 Bacteria 1646
309 Ga0439434_0166972 3300042435 Bacteria 733
310 Ga0439435_0018134 3300042436 Bacteria 1788
311 Ga0466969_0051388 3300044656 Bacteria 2029
312 Ga0466972_0048628 3300044658 Bacteria 2049
313 Ga0466965_0006161 3300044683 Bacteria 5425
314 Ga0466966_0009380 3300044684 Bacteria 6478
315 Ga0466961_0011830 3300044693 Bacteria 5578
316 Ga0466961_0315264 3300044693 Bacteria 954
317 Ga0466963_0084859 3300044694 Bacteria 2149
318 Ga0466964_0005595 3300044706 Bacteria 4669
319 Ga0466964_0045202 3300044706 Bacteria 1792
320 Ga0466964_0454038 3300044706 Bacteria 680
321 Ga0466971_0003065 3300044719 Bacteria 7104
322 Ga0466968_0090939 3300044735 Bacteria 1352
323 Ga0466970_0019270 3300044765 Bacteria 3536
324 Ga0466957_0252319 3300044842 Bacteria 1173
325 Ga0466960_0001060 3300044901 Bacteria 9849
326 Ga0466960_0001351 3300044901 Bacteria 8911
327 Ga0466959_0028827 3300045049 Bacteria 4114
328 Ga0466959_0066097 3300045049 Bacteria 2623
329 Ga0466959_0079002 3300045049 Bacteria 2372
330 Ga0466958_0041801 3300045836 Bacteria 2759
331 Ga0466958_0450814 3300045836 Bacteria 833
332 Ga0466967_0003917 3300045976 Bacteria 9885
333 Ga0466967_0010650 3300045976 Bacteria 6912
334 Ga0466967_0015784 3300045976 Bacteria 5933
335 Ga0466967_0124979 3300045976 Bacteria 2382
336 Ga0466967_0310573 3300045976 Bacteria 1519
337 Ga0466967_1357185 3300045976 Bacteria 708
338 Ga0495603_0003036 3300046455 Bacteria 9948
339 Ga0495629_0032900 3300046459 Bacteria 3669
340 Ga0495638_0003105 3300046460 Bacteria 13159
341 Ga0495582_0044040 3300046473 Bacteria 2458
342 Ga0495628_0425133 3300046516 Bacteria 968
343 Ga0495658_0100106 3300046683 Bacteria 1729
344 Ga0495613_0145314 3300046689 Bacteria 1693
345 Ga0495649_0173765 3300046694 Bacteria 1126
346 Ga0495581_0063986 3300047315 Bacteria 2125
347 Ga0495674_0008065 3300047319 Bacteria 10054
348 Ga0495675_0476182 3300047444 Bacteria 720
349 Ga0496100_0007452 3300048903 Bacteria 6039
350 Ga0496100_0655029 3300048903 Bacteria 818
351 Ga0496101_0000751 3300048904 Bacteria 19209
352 Ga0496101_0001119 3300048904 Bacteria 15971
353 Ga0496101_0136543 3300048904 Bacteria 1867
354 Ga0496102_0000817 3300048905 Bacteria 30286
355 Ga0496102_0084860 3300048905 Bacteria 2924
356 Ga0496102_0109895 3300048905 Bacteria 2569
357 Ga0496102_0256754 3300048905 Bacteria 1648
358 Ga0496103_0001149 3300048906 Bacteria 18309
359 Ga0496103_0003448 3300048906 Bacteria 9668
360 Ga0496103_0044101 3300048906 Bacteria 2747
361 Ga0496103_0132486 3300048906 Bacteria 1592
362 Ga0496104_0006897 3300048907 Bacteria 10017
363 Ga0496105_0375565 3300048908 Bacteria 1132
364 Ga0496106_0002671 3300048909 Bacteria 13264
365 Ga0496106_0008670 3300048909 Bacteria 7525
366 Ga0496107_0013141 3300048910 Bacteria 5785
367 Ga0496107_0021696 3300048910 Bacteria 4538
368 Ga0496107_0069128 3300048910 Bacteria 2563
369 Ga0496108_0013865 3300048911 Bacteria 6574
370 Ga0496108_0101619 3300048911 Bacteria 2453
371 Ga0496109_0211431 3300048912 Bacteria 1824
372 Ga0496109_0250878 3300048912 Bacteria 1667
373 Ga0496109_0255750 3300048912 Bacteria 1649
374 Ga0496110_0066711 3300048913 Bacteria 3183
375 Ga0496110_0080045 3300048913 Bacteria 2910
376 Ga0496110_0754800 3300048913 Bacteria 876
377 Ga0496111_0027303 3300048914 Bacteria 4037
378 Ga0496112_0014924 3300048915 Bacteria 7229
379 Ga0496112_0025234 3300048915 Bacteria 5705
380 Ga0496112_0117263 3300048915 Bacteria 2632
381 Ga0496112_0652158 3300048915 Bacteria 982
382 Ga0496113_0624665 3300048916 Bacteria 862
383 Ga0496115_0010668 3300048918 Bacteria 6870
384 Ga0496117_0004933 3300048920 Bacteria 14334
385 Ga0496118_0007649 3300048921 Bacteria 11377
386 Ga0496119_0005340 3300048922 Bacteria 12363
387 Ga0496119_0007640 3300048922 Bacteria 9692
388 Ga0496120_0000785 3300048923 Bacteria 45892
389 Ga0496120_0059857 3300048923 Bacteria 2133
390 Ga0496121_0032255 3300048924 Bacteria 4766
391 Ga0496125_0051509 3300048928 Bacteria 3394
392 Ga0496126_0002448 3300048929 Bacteria 25056
393 Ga0496126_0023666 3300048929 Bacteria 5948
394 Ga0501032_0009160 3300049569 Bacteria 7183
395 Ga0501036_0027841 3300049572 Bacteria 4778
396 Ga0501037_0007152 3300049573 Bacteria 8158
397 Ga0501038_0010162 3300049574 Bacteria 8615
398 Ga0501039_0001964 3300049575 Bacteria 15256
399 Ga0501043_0002137 3300049579 Bacteria 16873
400 Ga0501070_0043407 3300049586 Bacteria 3741
401 Ga0501044_0157315 3300049823 Bacteria 2251
402 nmdc:mga00v17_6113_c1 3300050491 Bacteria 6375
403 nmdc:mga0yw44_204019_c1 3300050492 Bacteria 1306
404 nmdc:mga0yw44_418599_c1 3300050492 Bacteria 907
405 nmdc:mga0yw44_46304_c1 3300050492 Bacteria 2611
406 nmdc:mga0yw44_78617_c1 3300050492 Bacteria 2063
407 nmdc:mga07m45_25319_c1 3300050496 Bacteria 3254
408 nmdc:mga07m45_27257_c1 3300050496 Bacteria 3146
409 nmdc:mga07m45_3143_c1 3300050496 Bacteria 7916
410 nmdc:mga07m45_44020_c1 3300050496 Bacteria 2504
411 nmdc:mga05p37_139250_c1 3300050507 Bacteria 2974
412 nmdc:mga09592_12387_c1 3300050508 Bacteria 6946
413 nmdc:mga09592_208356_c1 3300050508 Bacteria 1693
414 nmdc:mga0qj67_37893_c1 3300050509 Bacteria 3780
415 nmdc:mga06r32_29633_c1 3300050510 Bacteria 5132
416 nmdc:mga08y16_341900_c1 3300050511 Bacteria 1538
417 nmdc:mga0n895_45572_c1 3300050512 Bacteria 4279
418 nmdc:mga0sz30_13285_c1 3300050516 Bacteria 3222
419 nmdc:mga0sz30_1760_c1 3300050516 Bacteria 7684
420 nmdc:mga0sz30_75693_c1 3300050516 Bacteria 1453
421 Ga0495619_0251067 3300053085 Bacteria 1226
422 Ga0466962_0019020 3300061719 Bacteria 3299
423 2528214557 2527291629 Bacteria 5267418
424 2546947261 2546825537 Bacteria 5389291
425 2548692600 2547132424 Bacteria 8348532
426 2579749506 2576861822 Bacteria 5004595
427 2671837525 2671180195 Bacteria 9757215
428 2686538042 2684623035 Bacteria 8032739
429 2686542308 2684623036 Bacteria 5199090
430 2689996320 2687453743 Bacteria 8361025
431 2710603958 2710264753 Bacteria 5455564
432 2774855681 2773857922 Bacteria 9757215
433 2774865607 2773857924 Bacteria 5256821
434 2842136085 2842134933 Bacteria 5847019
435 2856745555 2856741275 Bacteria 8096094
436 2891564121 2891562705 Bacteria 8039471
437 2895888029 2895880812 Bacteria 11255272
438 2902841334 2902837492 Bacteria 6697721
439 2919718171 2919713450 Bacteria 7431245
440 2929218532 2929212328 Bacteria 7708288
441 3002999698 3002998708 Bacteria 11715108
442 8002783605 8002775197 Bacteria 10728764
443 8002785219 8002784119 Bacteria 9788632
444 8054918016 8054913762 Bacteria 7713009
445 8055161250 8055157932 Bacteria 6429399
446 Ga0070678_100876908
447 JGI24750J21931_1010530
448 JGI24744J21845_10001445
449 Ga0070676_10017555
450 Ga0070683_100735919
451 Ga0070690_100004130
452 Ga0070690_100116611
453 Ga0068869_100013638
454 Ga0068869_100042319
455 Ga0068869_100525330
456 Ga0070682_100002894
457 Ga0070682_100201699
458 Ga0068868_100006415
459 Ga0068868_100097382
460 Ga0070689_100005039
461 Ga0070691_10002367
462 Ga0070668_100002382
463 Ga0070668_100023009
464 Ga0070668_100311144
465 Ga0070669_100003187
466 Ga0070669_100108082
467 Ga0070675_100070827
468 Ga0070675_100472604
469 Ga0070671_100189307
470 Ga0070674_100023828
471 Ga0070674_100129721
472 Ga0070673_100194044
473 Ga0070688_100066114
474 Ga0070667_100000868
475 Ga0070667_100006015
476 Ga0070667_100026553
477 Ga0070703_10174838
478 Ga0070709_10026390
479 Ga0070709_10132576
480 Ga0070714_100179920
481 Ga0070714_100476723
482 Ga0070714_100591818
483 Ga0070713_100042820
484 Ga0070710_10000420
485 Ga0070710_10022357
486 Ga0070701_10022399
487 Ga0070711_100007242
488 Ga0070711_100015362
489 Ga0070711_100030821
490 Ga0070705_100663127
491 Ga0070700_100008010
492 Ga0070700_100117661
493 Ga0070694_100009049
494 Ga0070663_100128242
495 Ga0070678_100002296
496 Ga0070678_100068537
497 Ga0070662_100015871
498 Ga0068867_100001521
499 Ga0068867_100180383
500 Ga0070685_10063333
501 Ga0070707_100000127
502 Ga0070698_100001111
503 Ga0070679_100423190
504 Ga0070697_100432460
505 Ga0068853_100168475
506 Ga0070686_100105459
507 Ga0070686_100510197
508 Ga0070695_100014597
509 Ga0070695_100113663
510 Ga0070696_100006186
511 Ga0070693_100006119
512 Ga0070693_100114435
513 Ga0070665_100007765
514 Ga0070665_100295029
515 Ga0070704_100001979
516 Ga0068855_100201417
517 Ga0068857_100379234
518 Ga0068854_100005710
519 Ga0068854_100191085
520 Ga0068856_100082906
521 Ga0068856_100253236
522 Ga0070702_100025720
523 Ga0068852_100050090
524 Ga0068859_100008532
525 Ga0068859_100010254
526 Ga0068859_100349460
527 Ga0068864_100001159
528 Ga0068866_10000350
529 Ga0068866_10149241
530 Ga0068861_100053185
531 Ga0068861_100171749
532 Ga0068851_10155709
533 Ga0068863_100002097
534 Ga0068863_101091339
535 Ga0068858_100004624
536 Ga0068858_100999591
537 Ga0068860_100000038
538 Ga0068860_100000819
539 Ga0068860_100836470
540 Ga0068862_100000064
541 Ga0068862_100020953
542 Ga0081455_10049679
543 Ga0081455_10277792
544 Ga0070717_10009294
545 Ga0070717_10221277
546 Ga0070717_10438704
547 Ga0075365_10016319
548 Ga0075365_10022031
549 Ga0075365_10460875
550 Ga0075368_10014714
551 Ga0075363_100000026
552 Ga0075363_100007557
553 Ga0075364_10004944
554 Ga0070716_100005191
555 Ga0070716_100010855
556 Ga0070712_100001563
557 Ga0070712_100007693
558 Ga0070712_100008365
559 Ga0075367_10002811
560 Ga0075369_10000539
561 Ga0075369_10009253
562 Ga0075369_10056094
563 Ga0097621_100561456
564 Ga0075370_10004033
565 Ga0075370_10006005
566 Ga0075370_10020939
567 Ga0075370_10021412
568 Ga0075370_10025081
569 Ga0075370_10052215
570 Ga0075428_100092168
571 Ga0075430_100002290
572 Ga0075431_100029054
573 Ga0075434_100100864
574 Ga0075429_100001611
575 Ga0075429_100141993
576 Ga0068865_100003691
577 Ga0068865_100102269
578 Ga0068865_100717480
579 Ga0068865_100811040
580 Ga0097620_100008532
581 Ga0097620_100010254
582 Ga0097620_100349462
583 Ga0105250_10060960
584 Ga0105250_10082750
585 Ga0105245_10003194
586 Ga0105245_10011842
587 Ga0105245_10142638
588 Ga0105247_10000021
589 Ga0105247_10005631
590 Ga0105247_10018907
591 Ga0114129_10004683
592 Ga0114129_11172093
593 Ga0105243_10001183
594 Ga0105243_10770569
595 Ga0105241_10276855
596 Ga0105242_10008274
597 Ga0105242_10011000
598 Ga0105248_10000777
599 Ga0105248_10017115
600 Ga0105248_10020788
601 Ga0105248_10512874
602 Ga0105248_10759807
603 Ga0105237_10026580
604 Ga0105237_10168997
605 Ga0105238_10380497
606 Ga0105249_10000334
607 Ga0105249_10008828
608 Ga0105249_10042831
609 Ga0105249_10050167
610 Ga0105239_10011133
611 Ga0105239_10637532
612 Ga0105246_10051660
613 Ga0157374_10006683
614 Ga0157378_10000812
615 Ga0163162_10022754
616 Ga0163162_10305821
617 Ga0163162_11207079
618 Ga0157372_10028158
619 Ga0157372_10192285
620 Ga0157375_10028618
621 Ga0157375_10196727
622 Ga0157375_10937733
623 Ga0163163_10006468
624 Ga0163163_10031312
625 Ga0163163_11243574
626 Ga0157380_10001247
627 Ga0157380_11362581
628 Ga0157377_10025501
629 Ga0157379_10004209
630 Ga0157379_10019781
631 Ga0157379_10047179
632 Ga0157379_10126177
633 Ga0157376_10107230
634 Ga0157376_10339486
635 Ga0163161_10149484
636 Ga0207656_10208463
637 Ga0207696_1044994
638 Ga0207692_10003131
639 Ga0207692_10018600
640 Ga0207642_10003183
641 Ga0207642_10047025
642 Ga0207710_10000027
643 Ga0207710_10000045
644 Ga0207710_10001642
645 Ga0207688_10001401
646 Ga0207680_10025367
647 Ga0207647_10030141
648 Ga0207685_10003531
649 Ga0207685_10005711
650 Ga0207699_10003454
651 Ga0207699_10020054
652 Ga0207645_10038084
653 Ga0207645_10071098
654 Ga0207684_10001704
655 Ga0207654_10050747
656 Ga0207671_10152634
657 Ga0207693_10001138
658 Ga0207693_10021273
659 Ga0207693_10030599
660 Ga0207663_10002081
661 Ga0207646_10000264
662 Ga0207681_10136431
663 Ga0207694_10720211
664 Ga0207659_10119352
665 Ga0207687_10004995
666 Ga0207687_10189337
667 Ga0207687_10489784
668 Ga0207700_10001853
669 Ga0207700_10059058
670 Ga0207664_10002105
671 Ga0207664_10219773
672 Ga0207706_10043257
673 Ga0207706_10069018
674 Ga0207706_10617346
675 Ga0207686_10019904
676 Ga0207686_10073363
677 Ga0207709_10067596
678 Ga0207709_10508989
679 Ga0207670_10017494
680 Ga0207669_10002560
681 Ga0207704_10001134
682 Ga0207704_10510592
683 Ga0207665_10006210
684 Ga0207665_10017038
685 Ga0207691_10020920
686 Ga0207711_10003965
687 Ga0207711_10006464
688 Ga0207711_10231147
689 Ga0207711_10583672
690 Ga0207689_10071137
691 Ga0207689_10131509
692 Ga0207651_10049739
693 Ga0207712_10000282
694 Ga0207712_10032862
695 Ga0207712_10307297
696 Ga0207640_10092502
697 Ga0207658_10000745
698 Ga0207658_10013912
699 Ga0207658_10043084
700 Ga0207658_10052436
701 Ga0207677_10002015
702 Ga0207677_10234555
703 Ga0207703_10003259
704 Ga0207703_10019552
705 Ga0207639_10010884
706 Ga0207678_10016589
707 Ga0207708_10000968
708 Ga0207708_10399597
709 Ga0207702_10508944
710 Ga0207641_10006741
711 Ga0207648_10006846
712 Ga0207676_10078110
713 Ga0207674_10136246
714 Ga0207675_100000092
715 Ga0207675_100038864
716 Ga0207675_100168271
717 Ga0207683_10000319
718 Ga0207683_10361001
719 Ga0207683_10480578
720 Ga0207698_10291055
721 Ga0268266_10115358
722 Ga0268265_10000028
723 Ga0268265_10007435
724 Ga0268265_10088918
725 Ga0268264_10000092
726 Ga0268264_10011564
727 Ga0268264_10112834
728 Ga0268264_10490281
729 Ga0307413_10025235
730 Ga0307413_10117350
731 Ga0307410_10005560
732 Ga0307409_100146001
733 Ga0307411_10852353
734 Ga0373952_0011585
735 Ga0373943_0191245
736 Ga0373955_0004699
737 Ga0373962_0076589
738 Ga0373931_0012414
739 Ga0373931_0028996
740 Ga0373947_0246149
741 Ga0373925_0068691
742 Ga0436365_0098483
743 Ga0436365_1383150
744 Ga0436363_0933242
745 Ga0439466_0003904
746 Ga0439466_0050430
747 Ga0439465_0010140
748 Ga0439465_0018906
749 Ga0439465_0032455
750 Ga0439465_0178529
751 Ga0451789_0098901
752 Ga0439431_0062043
753 Ga0439445_0020768
754 Ga0439434_0166972
755 Ga0439435_0018134
756 Ga0466969_0051388
757 Ga0466972_0048628
758 Ga0466965_0006161
759 Ga0466966_0009380
760 Ga0466961_0011830
761 Ga0466961_0315264
762 Ga0466963_0084859
763 Ga0466964_0005595
764 Ga0466964_0045202
765 Ga0466964_0454038
766 Ga0466971_0003065
767 Ga0466968_0090939
768 Ga0466970_0019270
769 Ga0466957_0252319
770 Ga0466960_0001060
771 Ga0466960_0001351
772 Ga0466959_0028827
773 Ga0466959_0066097
774 Ga0466959_0079002
775 Ga0466958_0041801
776 Ga0466958_0450814
777 Ga0466967_0003917
778 Ga0466967_0010650
779 Ga0466967_0015784
780 Ga0466967_0124979
781 Ga0466967_0310573
782 Ga0466967_1357185
783 Ga0495603_0003036
784 Ga0495629_0032900
785 Ga0495638_0003105
786 Ga0495582_0044040
787 Ga0495628_0425133
788 Ga0495658_0100106
789 Ga0495613_0145314
790 Ga0495649_0173765
791 Ga0495581_0063986
792 Ga0495674_0008065
793 Ga0495675_0476182
794 Ga0496100_0007452
795 Ga0496100_0655029
796 Ga0496101_0000751
797 Ga0496101_0001119
798 Ga0496101_0136543
799 Ga0496102_0000817
800 Ga0496102_0084860
801 Ga0496102_0109895
802 Ga0496102_0256754
803 Ga0496103_0001149
804 Ga0496103_0003448
805 Ga0496103_0044101
806 Ga0496103_0132486
807 Ga0496104_0006897
808 Ga0496105_0375565
809 Ga0496106_0002671
810 Ga0496106_0008670
811 Ga0496107_0013141
812 Ga0496107_0021696
813 Ga0496107_0069128
814 Ga0496108_0013865
815 Ga0496108_0101619
816 Ga0496109_0211431
817 Ga0496109_0250878
818 Ga0496109_0255750
819 Ga0496110_0066711
820 Ga0496110_0080045
821 Ga0496110_0754800
822 Ga0496111_0027303
823 Ga0496112_0014924
824 Ga0496112_0025234
825 Ga0496112_0117263
826 Ga0496112_0652158
827 Ga0496113_0624665
828 Ga0496115_0010668
829 Ga0496117_0004933
830 Ga0496118_0007649
831 Ga0496119_0005340
832 Ga0496119_0007640
833 Ga0496120_0000785
834 Ga0496120_0059857
835 Ga0496121_0032255
836 Ga0496125_0051509
837 Ga0496126_0002448
838 Ga0496126_0023666
839 Ga0501032_0009160
840 Ga0501036_0027841
841 Ga0501037_0007152
842 Ga0501038_0010162
843 Ga0501039_0001964
844 Ga0501043_0002137
845 Ga0501070_0043407
846 Ga0501044_0157315
847 nmdc:mga00v17_6113_c1
848 nmdc:mga0yw44_204019_c1
849 nmdc:mga0yw44_418599_c1
850 nmdc:mga0yw44_46304_c1
851 nmdc:mga0yw44_78617_c1
852 nmdc:mga07m45_25319_c1
853 nmdc:mga07m45_27257_c1
854 nmdc:mga07m45_3143_c1
855 nmdc:mga07m45_44020_c1
856 nmdc:mga05p37_139250_c1
857 nmdc:mga09592_12387_c1
858 nmdc:mga09592_208356_c1
859 nmdc:mga0qj67_37893_c1
860 nmdc:mga06r32_29633_c1
861 nmdc:mga08y16_341900_c1
862 nmdc:mga0n895_45572_c1
863 nmdc:mga0sz30_13285_c1
864 nmdc:mga0sz30_1760_c1
865 nmdc:mga0sz30_75693_c1
866 Ga0495619_0251067
867 Ga0466962_0019020
868 2528214557
869 2546947261
870 2548692600
871 2579749506
872 2671837525
873 2686538042
874 2686542308
875 2689996320
876 2710603958
877 2774855681
878 2774865607
879 2842136085
880 2856745555
881 2891564121
882 2895888029
883 2902841334
884 2919718171
885 2929218532
886 3002999698
887 8002783605
888 8002785219
889 8054918016
890 8055161250

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13578

Methyltransf_24

Methyltransferase domain

55

183

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g7d-assembly1.cif.gz_A structure of met1 from mycobacterium hassiacum in complex with sam and glycerol. 0.956 1 210
6g7d-assembly1.cif.gz_A structure of met1 from mycobacterium hassiacum in complex with sam and glycerol. 0.9516 1 210
6g80-assembly1.cif.gz_A structure of mycobacterium hassiacum met1 from orthorhombic crystals. 0.9419 4 210
6g80-assembly1.cif.gz_A structure of mycobacterium hassiacum met1 from orthorhombic crystals. 0.9245 4 210
5i10-assembly1.cif.gz_A crystal structure of spinosyn rhamnosyl 4'-o-methyltransferase spnh mutant t242q from saccharopolyspora spinosa 0.7837 4 203
ID Description Score Start End Superfamily
af_F4HS78_116_300_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7787 17 197 3.40.50.150
af_F4HS78_116_300_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.76 17 197 3.40.50.150
af_Q4D9H6_110_325_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7587 9 202 3.40.50.150
af_K8ERZ6_162_450_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7557 21 159 3.40.50.150
af_K7N0B7_9_135_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7501 2 140 3.40.50.150
ID Description Score Start End GO Terms
AF-X8BK68-F1-model_v4 deleted 1.001 152 208
AF-A0A2S8N0U1-F1-model_v4 deleted 0.9813 135 209
AF-A0A6J7TGP9-F1-model_v4 Unannotated protein 0.9812 91 203
AF-A0A354VXC3-F1-model_v4 deleted 0.9808 97 201
AF-A0A519GHA4-F1-model_v4 Class I SAM-dependent methyltransferase 0.9784 103 209 GO:0008168
GO:0032259

Map