F445413
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 445 | 238 | 890 | 305 |
Family's Representative Sequence
| Representative Sequence | 3300005329|Ga0070683_100032264|Ga0070683_1000322644 |
| Length | 330 |
| Sequence | MAVVGQDDSAGARPAPHVTRPRIDLNPLFRSGILAATGNPLVSHVVQRYGMRLGASRFVAGETFDEAIPVLRGLNQKGLRTNTTLLGEGIKDRATTRAVVDEYKRDFDRIAMEGLQTNIALKLTHLGLDLDPELAYRNLAEIVAHAAGHGNFVRIDMEESNRVDDTLRIYRRLREEGHDNVGTVLQAYLFRTPADFASLLPLRPNLRLVKGAYLEPASVAYPQKADVDRAYLELAELMLLEGGFTAIATHDERIIDHVLDFTQRHGIGTDRFELQMLFGVRPQYQADLARAGHRVLVATPYGPHWYRYLMRRLAERPANLAWFASNVVRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 30 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 31 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 34 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 35 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 36 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 37 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 57 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 58 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 59 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 92 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 93 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 94 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 95 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 96 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 97 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 98 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 99 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 100 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 101 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 102 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 103 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 104 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 105 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 106 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 107 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 108 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 109 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 110 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 111 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 112 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 113 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 114 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 115 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 116 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 117 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 118 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 119 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 120 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 121 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 122 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 123 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 124 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 125 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 126 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 127 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 128 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 167 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 169 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 170 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 171 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 172 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 173 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 174 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 176 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 177 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 178 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 179 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 180 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 181 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 208 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 227 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 230 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 231 | 2864997549 | Paenibacillus sp. R-72005 | Isolate | Unclassified |
| 232 | 2865002811 | Paenibacillus sp. R-74131 | Isolate | Unclassified |
| 233 | 2889295896 | Paenibacillus sp. PvR098 | Isolate | Rhizosphere |
| 234 | 2981284811 | Paenibacillus sp. PvR052 | Isolate | Rhizosphere |
| 235 | 2981289755 | Paenibacillus sp. PvR148 | Isolate | Rhizosphere |
| 236 | 2981980479 | Paenibacillus sp. PvR018 | Isolate | Rhizosphere |
| 237 | 2981985349 | Paenibacillus sp. PvR053 | Isolate | Rhizosphere |
| 238 | 8057977335 | Paenibacillus oenotherae DT7-4 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.98 |
| Metatranscriptomes | 0.22 |
| Isolates | 1.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.22 |
| Nodule | 0 |
| Rhizoplane | 8.09 |
| Rhizosphere | 90.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100032264 | 3300005329 | Bacteria | 4770 |
| 2 | Ga0070658_10158455 | 3300005327 | Bacteria | 1898 |
| 3 | Ga0070683_100044702 | 3300005329 | Bacteria | 4085 |
| 4 | Ga0070683_100227063 | 3300005329 | Unclassified | 1775 |
| 5 | Ga0068869_100192511 | 3300005334 | Bacteria | 1604 |
| 6 | Ga0070680_100024634 | 3300005336 | Bacteria | 4809 |
| 7 | Ga0070682_100028605 | 3300005337 | Bacteria | 3353 |
| 8 | Ga0070689_100074479 | 3300005340 | Bacteria | 2656 |
| 9 | Ga0070687_100011807 | 3300005343 | Bacteria | 3836 |
| 10 | Ga0070661_100048518 | 3300005344 | Bacteria | 3108 |
| 11 | Ga0070692_10033233 | 3300005345 | Bacteria | 2599 |
| 12 | Ga0070671_100147996 | 3300005355 | Bacteria | 1983 |
| 13 | Ga0070674_100493068 | 3300005356 | Bacteria | 1019 |
| 14 | Ga0070688_100011297 | 3300005365 | Bacteria | 4959 |
| 15 | Ga0070659_100051752 | 3300005366 | Bacteria | 3229 |
| 16 | Ga0070659_100314451 | 3300005366 | Bacteria | 1308 |
| 17 | Ga0070709_10121555 | 3300005434 | Bacteria | 1771 |
| 18 | Ga0070714_100005702 | 3300005435 | Bacteria | 9536 |
| 19 | Ga0070714_100161330 | 3300005435 | Bacteria | 2029 |
| 20 | Ga0070705_100010187 | 3300005440 | Bacteria | 4697 |
| 21 | Ga0070700_100047122 | 3300005441 | Bacteria | 2666 |
| 22 | Ga0070708_100231831 | 3300005445 | Bacteria | 1732 |
| 23 | Ga0070681_10002282 | 3300005458 | Bacteria | 17522 |
| 24 | Ga0070681_10076604 | 3300005458 | Bacteria | 3302 |
| 25 | Ga0070681_10077887 | 3300005458 | Bacteria | 3272 |
| 26 | Ga0070706_100177758 | 3300005467 | Bacteria | 1987 |
| 27 | Ga0070707_100000967 | 3300005468 | Bacteria | 28411 |
| 28 | Ga0070707_100271894 | 3300005468 | Bacteria | 1647 |
| 29 | Ga0070679_100012378 | 3300005530 | Bacteria | 8151 |
| 30 | Ga0070679_100038745 | 3300005530 | Bacteria | 4738 |
| 31 | Ga0070679_100135434 | 3300005530 | Bacteria | 2444 |
| 32 | Ga0070684_100047730 | 3300005535 | Bacteria | 3711 |
| 33 | Ga0070684_100060371 | 3300005535 | Bacteria | 3316 |
| 34 | Ga0068853_100026258 | 3300005539 | Bacteria | 4890 |
| 35 | Ga0068853_100280877 | 3300005539 | Bacteria | 1535 |
| 36 | Ga0070693_100050808 | 3300005547 | Bacteria | 2371 |
| 37 | Ga0068855_100019894 | 3300005563 | Bacteria | 8062 |
| 38 | Ga0068855_100383160 | 3300005563 | Bacteria | 1543 |
| 39 | Ga0070702_100030705 | 3300005615 | Bacteria | 2932 |
| 40 | Ga0068852_100069171 | 3300005616 | Bacteria | 3093 |
| 41 | Ga0068863_100072418 | 3300005841 | Bacteria | 3260 |
| 42 | Ga0081455_10009468 | 3300005937 | Bacteria | 10019 |
| 43 | Ga0070717_10028071 | 3300006028 | Bacteria | 4501 |
| 44 | Ga0070712_100016277 | 3300006175 | Bacteria | 4803 |
| 45 | Ga0068871_100097613 | 3300006358 | Bacteria | 2456 |
| 46 | Ga0075430_100004529 | 3300006846 | Bacteria | 11704 |
| 47 | Ga0075430_100075327 | 3300006846 | Bacteria | 2829 |
| 48 | Ga0075431_100401545 | 3300006847 | Bacteria | 1372 |
| 49 | Ga0075433_10031533 | 3300006852 | Bacteria | 4532 |
| 50 | Ga0111539_10441614 | 3300009094 | Bacteria | 1515 |
| 51 | Ga0105245_10041478 | 3300009098 | Bacteria | 4102 |
| 52 | Ga0105247_10061295 | 3300009101 | Bacteria | 2332 |
| 53 | Ga0114129_10100209 | 3300009147 | Bacteria | 4008 |
| 54 | Ga0105243_10065997 | 3300009148 | Bacteria | 2909 |
| 55 | Ga0105242_10043640 | 3300009176 | Bacteria | 3627 |
| 56 | Ga0105248_10463768 | 3300009177 | Bacteria | 1428 |
| 57 | Ga0105237_10029558 | 3300009545 | Bacteria | 5569 |
| 58 | Ga0105237_10040322 | 3300009545 | Bacteria | 4709 |
| 59 | Ga0105237_10239531 | 3300009545 | Unclassified | 1815 |
| 60 | Ga0105238_10041627 | 3300009551 | Bacteria | 4652 |
| 61 | Ga0105238_10099365 | 3300009551 | Bacteria | 2893 |
| 62 | Ga0105249_10444752 | 3300009553 | Bacteria | 1334 |
| 63 | Ga0105246_10215296 | 3300011119 | Bacteria | 1502 |
| 64 | Ga0157373_10057156 | 3300013100 | Bacteria | 2768 |
| 65 | Ga0157369_10092016 | 3300013105 | Bacteria | 3236 |
| 66 | Ga0157374_10138246 | 3300013296 | Bacteria | 2363 |
| 67 | Ga0157378_10210033 | 3300013297 | Bacteria | 1845 |
| 68 | Ga0157372_10011742 | 3300013307 | Bacteria | 9327 |
| 69 | Ga0157372_10231893 | 3300013307 | Bacteria | 2140 |
| 70 | Ga0157375_10026281 | 3300013308 | Bacteria | 5421 |
| 71 | Ga0157375_10421472 | 3300013308 | Bacteria | 1501 |
| 72 | Ga0157379_10165188 | 3300014968 | Bacteria | 1998 |
| 73 | Ga0157376_10035395 | 3300014969 | Bacteria | 4039 |
| 74 | Ga0157376_10170132 | 3300014969 | Bacteria | 1983 |
| 75 | Ga0206356_10541719 | 3300020070 | Bacteria | 2868 |
| 76 | Ga0213873_10020766 | 3300021358 | Unclassified | 1537 |
| 77 | Ga0213876_10006708 | 3300021384 | Bacteria | 6282 |
| 78 | Ga0207642_10109786 | 3300025899 | Bacteria | 1402 |
| 79 | Ga0207685_10041806 | 3300025905 | Bacteria | 1718 |
| 80 | Ga0207705_10044491 | 3300025909 | Bacteria | 3191 |
| 81 | Ga0207705_10071033 | 3300025909 | Bacteria | 2523 |
| 82 | Ga0207684_10152711 | 3300025910 | Bacteria | 1987 |
| 83 | Ga0207707_10041335 | 3300025912 | Bacteria | 4027 |
| 84 | Ga0207707_10309773 | 3300025912 | Bacteria | 1364 |
| 85 | Ga0207707_10410663 | 3300025912 | Bacteria | 1162 |
| 86 | Ga0207671_10331823 | 3300025914 | Bacteria | 1205 |
| 87 | Ga0207693_10019178 | 3300025915 | Bacteria | 5443 |
| 88 | Ga0207693_10042318 | 3300025915 | Bacteria | 3586 |
| 89 | Ga0207660_10035014 | 3300025917 | Bacteria | 3483 |
| 90 | Ga0207660_10158002 | 3300025917 | Unclassified | 1747 |
| 91 | Ga0207660_10220984 | 3300025917 | Bacteria | 1487 |
| 92 | Ga0207662_10045143 | 3300025918 | Bacteria | 2604 |
| 93 | Ga0207657_10003378 | 3300025919 | Bacteria | 17066 |
| 94 | Ga0207657_10005580 | 3300025919 | Bacteria | 13138 |
| 95 | Ga0207657_10052056 | 3300025919 | Bacteria | 3556 |
| 96 | Ga0207657_10179474 | 3300025919 | Bacteria | 1712 |
| 97 | Ga0207652_10112451 | 3300025921 | Bacteria | 2416 |
| 98 | Ga0207652_10122850 | 3300025921 | Bacteria | 2311 |
| 99 | Ga0207652_10443780 | 3300025921 | Bacteria | 1170 |
| 100 | Ga0207646_10000523 | 3300025922 | Bacteria | 51093 |
| 101 | Ga0207694_10092187 | 3300025924 | Bacteria | 2391 |
| 102 | Ga0207687_10165122 | 3300025927 | Bacteria | 1703 |
| 103 | Ga0207700_10046990 | 3300025928 | Bacteria | 3197 |
| 104 | Ga0207690_10264469 | 3300025932 | Bacteria | 1334 |
| 105 | Ga0207670_10201873 | 3300025936 | Bacteria | 1511 |
| 106 | Ga0207711_10084966 | 3300025941 | Bacteria | 2771 |
| 107 | Ga0207689_10201434 | 3300025942 | Bacteria | 1643 |
| 108 | Ga0207661_10037390 | 3300025944 | Bacteria | 3797 |
| 109 | Ga0207661_10355004 | 3300025944 | Unclassified | 1323 |
| 110 | Ga0207667_10055017 | 3300025949 | Bacteria | 4184 |
| 111 | Ga0207667_10071067 | 3300025949 | Bacteria | 3620 |
| 112 | Ga0207667_10128935 | 3300025949 | Bacteria | 2605 |
| 113 | Ga0207712_10154947 | 3300025961 | Bacteria | 1774 |
| 114 | Ga0207640_10332736 | 3300025981 | Bacteria | 1214 |
| 115 | Ga0207639_10142391 | 3300026041 | Bacteria | 1999 |
| 116 | Ga0207678_10122734 | 3300026067 | Bacteria | 2216 |
| 117 | Ga0207708_10013328 | 3300026075 | Bacteria | 6141 |
| 118 | Ga0207702_10048931 | 3300026078 | Bacteria | 3566 |
| 119 | Ga0207674_10015034 | 3300026116 | Bacteria | 8525 |
| 120 | Ga0207674_10085601 | 3300026116 | Bacteria | 3147 |
| 121 | Ga0207674_10109423 | 3300026116 | Bacteria | 2739 |
| 122 | Ga0207675_100524123 | 3300026118 | Bacteria | 1182 |
| 123 | Ga0207683_10032120 | 3300026121 | Bacteria | 4559 |
| 124 | Ga0268266_10146586 | 3300028379 | Bacteria | 2123 |
| 125 | Ga0268264_10123819 | 3300028381 | Bacteria | 2282 |
| 126 | Ga0265338_10002905 | 3300028800 | Bacteria | 24920 |
| 127 | Ga0265338_10090364 | 3300028800 | Bacteria | 2534 |
| 128 | Ga0265327_10022102 | 3300031251 | Bacteria | 3817 |
| 129 | Ga0265313_10051261 | 3300031595 | Bacteria | 1975 |
| 130 | Ga0307410_10266555 | 3300031852 | Bacteria | 1338 |
| 131 | Ga0307409_100151139 | 3300031995 | Bacteria | 2016 |
| 132 | Ga0307415_100096449 | 3300032126 | Bacteria | 2155 |
| 133 | Ga0373943_0005060 | 3300035170 | Bacteria | 5947 |
| 134 | Ga0373943_0005096 | 3300035170 | Bacteria | 5920 |
| 135 | Ga0373946_0007761 | 3300035171 | Bacteria | 3936 |
| 136 | Ga0373924_0053280 | 3300035410 | Bacteria | 1680 |
| 137 | Ga0373935_0027746 | 3300035692 | Bacteria | 3499 |
| 138 | Ga0373927_0105256 | 3300035695 | Bacteria | 1837 |
| 139 | Ga0373947_0006173 | 3300035725 | Bacteria | 6969 |
| 140 | Ga0373947_0035885 | 3300035725 | Bacteria | 2937 |
| 141 | Ga0373925_0012171 | 3300037068 | Bacteria | 6228 |
| 142 | Ga0373925_0055267 | 3300037068 | Bacteria | 2971 |
| 143 | Ga0395899_0113346 | 3300037312 | Bacteria | 1947 |
| 144 | Ga0395900_0020711 | 3300037418 | Bacteria | 6720 |
| 145 | Ga0395900_0163220 | 3300037418 | Unclassified | 2271 |
| 146 | Ga0395898_0008937 | 3300037466 | Bacteria | 10552 |
| 147 | Ga0395898_0019264 | 3300037466 | Bacteria | 6947 |
| 148 | Ga0395898_0079341 | 3300037466 | Bacteria | 3167 |
| 149 | Ga0395898_0333229 | 3300037466 | Bacteria | 1447 |
| 150 | Ga0395905_0026683 | 3300037471 | Bacteria | 5446 |
| 151 | Ga0395905_0557174 | 3300037471 | Bacteria | 1047 |
| 152 | Ga0395901_0006012 | 3300038443 | Bacteria | 12296 |
| 153 | Ga0395901_0007996 | 3300038443 | Bacteria | 10675 |
| 154 | Ga0395901_0076825 | 3300038443 | Bacteria | 3484 |
| 155 | Ga0436365_0186427 | 3300039437 | Unclassified | 2722 |
| 156 | Ga0436360_0460027 | 3300039438 | Bacteria | 1112 |
| 157 | Ga0436363_1625980 | 3300039450 | Unclassified | 3936 |
| 158 | Ga0436362_0204343 | 3300039453 | Bacteria | 2948 |
| 159 | Ga0439448_0069663 | 3300042005 | Bacteria | 1171 |
| 160 | Ga0439449_0008868 | 3300042007 | Bacteria | 3815 |
| 161 | Ga0439457_051980 | 3300042014 | Bacteria | 921 |
| 162 | Ga0466969_0001830 | 3300044656 | Bacteria | 11354 |
| 163 | Ga0466965_0077806 | 3300044683 | Bacteria | 1675 |
| 164 | Ga0466965_0091071 | 3300044683 | Bacteria | 1551 |
| 165 | Ga0466961_0004711 | 3300044693 | Bacteria | 8580 |
| 166 | Ga0466961_0024355 | 3300044693 | Bacteria | 3894 |
| 167 | Ga0466961_0068952 | 3300044693 | Bacteria | 2245 |
| 168 | Ga0466961_0248514 | 3300044693 | Bacteria | 1092 |
| 169 | Ga0466963_0000298 | 3300044694 | Bacteria | 22349 |
| 170 | Ga0466963_0000482 | 3300044694 | Bacteria | 18580 |
| 171 | Ga0466963_0001696 | 3300044694 | Bacteria | 12006 |
| 172 | Ga0466963_0002096 | 3300044694 | Bacteria | 11011 |
| 173 | Ga0466963_0002956 | 3300044694 | Bacteria | 9603 |
| 174 | Ga0466963_0004681 | 3300044694 | Bacteria | 7986 |
| 175 | Ga0466963_0005909 | 3300044694 | Bacteria | 7205 |
| 176 | Ga0466963_0010624 | 3300044694 | Bacteria | 5581 |
| 177 | Ga0466963_0019384 | 3300044694 | Bacteria | 4265 |
| 178 | Ga0466963_0019440 | 3300044694 | Bacteria | 4262 |
| 179 | Ga0466963_0021423 | 3300044694 | Bacteria | 4077 |
| 180 | Ga0466963_0115401 | 3300044694 | Bacteria | 1845 |
| 181 | Ga0466963_0122171 | 3300044694 | Bacteria | 1793 |
| 182 | Ga0466964_0002630 | 3300044706 | Bacteria | 6429 |
| 183 | Ga0466964_0006206 | 3300044706 | Bacteria | 4454 |
| 184 | Ga0466964_0007807 | 3300044706 | Bacteria | 4006 |
| 185 | Ga0466964_0013650 | 3300044706 | Bacteria | 3082 |
| 186 | Ga0466964_0037484 | 3300044706 | Bacteria | 1947 |
| 187 | Ga0466964_0038505 | 3300044706 | Bacteria | 1923 |
| 188 | Ga0466964_0060841 | 3300044706 | Bacteria | 1571 |
| 189 | Ga0466964_0088992 | 3300044706 | Bacteria | 1340 |
| 190 | Ga0466964_0109725 | 3300044706 | Unclassified | 1229 |
| 191 | Ga0466971_0000127 | 3300044719 | Bacteria | 27731 |
| 192 | Ga0466971_0001805 | 3300044719 | Bacteria | 9086 |
| 193 | Ga0466971_0004784 | 3300044719 | Bacteria | 5858 |
| 194 | Ga0466971_0014788 | 3300044719 | Bacteria | 3434 |
| 195 | Ga0466971_0049191 | 3300044719 | Bacteria | 1897 |
| 196 | Ga0466971_0169830 | 3300044719 | Bacteria | 1023 |
| 197 | Ga0466968_0003400 | 3300044735 | Bacteria | 5884 |
| 198 | Ga0466968_0039989 | 3300044735 | Bacteria | 1976 |
| 199 | Ga0466957_0001239 | 3300044842 | Bacteria | 13301 |
| 200 | Ga0466957_0011408 | 3300044842 | Bacteria | 5127 |
| 201 | Ga0466957_0011744 | 3300044842 | Bacteria | 5061 |
| 202 | Ga0466957_0012562 | 3300044842 | Bacteria | 4903 |
| 203 | Ga0466957_0019526 | 3300044842 | Bacteria | 3986 |
| 204 | Ga0466957_0047503 | 3300044842 | Bacteria | 2608 |
| 205 | Ga0466957_0090021 | 3300044842 | Bacteria | 1921 |
| 206 | Ga0466957_0166145 | 3300044842 | Bacteria | 1435 |
| 207 | Ga0466960_0002382 | 3300044901 | Bacteria | 7074 |
| 208 | Ga0466960_0122799 | 3300044901 | Bacteria | 1362 |
| 209 | Ga0466959_0006797 | 3300045049 | Bacteria | 7970 |
| 210 | Ga0466959_0007429 | 3300045049 | Bacteria | 7687 |
| 211 | Ga0466959_0007831 | 3300045049 | Bacteria | 7520 |
| 212 | Ga0466959_0028520 | 3300045049 | Bacteria | 4139 |
| 213 | Ga0466958_0000596 | 3300045836 | Bacteria | 15416 |
| 214 | Ga0466958_0005516 | 3300045836 | Bacteria | 6822 |
| 215 | Ga0466958_0006575 | 3300045836 | Bacteria | 6336 |
| 216 | Ga0466958_0009049 | 3300045836 | Bacteria | 5531 |
| 217 | Ga0466958_0016619 | 3300045836 | Bacteria | 4240 |
| 218 | Ga0466958_0036435 | 3300045836 | Bacteria | 2944 |
| 219 | Ga0466958_0169242 | 3300045836 | Bacteria | 1383 |
| 220 | Ga0466967_0001902 | 3300045976 | Bacteria | 12606 |
| 221 | Ga0466967_0005334 | 3300045976 | Bacteria | 8883 |
| 222 | Ga0466967_0010178 | 3300045976 | Bacteria | 7035 |
| 223 | Ga0466967_0010364 | 3300045976 | Bacteria | 6986 |
| 224 | Ga0466967_0011964 | 3300045976 | Bacteria | 6612 |
| 225 | Ga0466967_0014265 | 3300045976 | Bacteria | 6181 |
| 226 | Ga0466967_0014394 | 3300045976 | Bacteria | 6160 |
| 227 | Ga0466967_0025981 | 3300045976 | Bacteria | 4840 |
| 228 | Ga0466967_0029841 | 3300045976 | Bacteria | 4569 |
| 229 | Ga0466967_0040198 | 3300045976 | Bacteria | 4025 |
| 230 | Ga0466967_0046469 | 3300045976 | Bacteria | 3780 |
| 231 | Ga0466967_0050206 | 3300045976 | Bacteria | 3652 |
| 232 | Ga0466967_0055171 | 3300045976 | Bacteria | 3500 |
| 233 | Ga0466967_0056992 | 3300045976 | Bacteria | 3447 |
| 234 | Ga0466967_0110862 | 3300045976 | Bacteria | 2521 |
| 235 | Ga0466967_0117759 | 3300045976 | Bacteria | 2449 |
| 236 | Ga0466967_0265018 | 3300045976 | Bacteria | 1644 |
| 237 | Ga0466967_0387710 | 3300045976 | Unclassified | 1357 |
| 238 | Ga0466967_0422490 | 3300045976 | Bacteria | 1299 |
| 239 | Ga0495592_0020993 | 3300046454 | Bacteria | 4966 |
| 240 | Ga0495629_0038065 | 3300046459 | Bacteria | 3389 |
| 241 | Ga0495629_0138177 | 3300046459 | Bacteria | 1696 |
| 242 | Ga0495641_0008727 | 3300046461 | Bacteria | 6124 |
| 243 | Ga0495641_0046725 | 3300046461 | Bacteria | 1990 |
| 244 | Ga0495651_0112137 | 3300046462 | Bacteria | 2015 |
| 245 | Ga0495653_0046272 | 3300046463 | Bacteria | 3370 |
| 246 | Ga0495653_0112143 | 3300046463 | Bacteria | 1958 |
| 247 | Ga0495653_0132624 | 3300046463 | Bacteria | 1761 |
| 248 | Ga0495580_0000821 | 3300046472 | Bacteria | 26951 |
| 249 | Ga0495580_0029469 | 3300046472 | Bacteria | 3983 |
| 250 | Ga0495582_0015331 | 3300046473 | Bacteria | 4211 |
| 251 | Ga0495582_0047791 | 3300046473 | Bacteria | 2357 |
| 252 | Ga0495639_0007329 | 3300046475 | Bacteria | 4733 |
| 253 | Ga0495662_0005156 | 3300046476 | Bacteria | 6549 |
| 254 | Ga0495662_0112555 | 3300046476 | Unclassified | 1334 |
| 255 | Ga0495664_0008329 | 3300046477 | Bacteria | 5781 |
| 256 | Ga0495618_0032250 | 3300046514 | Bacteria | 3280 |
| 257 | Ga0495618_0123550 | 3300046514 | Bacteria | 1657 |
| 258 | Ga0495628_0079018 | 3300046516 | Bacteria | 2558 |
| 259 | Ga0495630_0031211 | 3300046517 | Bacteria | 3966 |
| 260 | Ga0495630_0140691 | 3300046517 | Unclassified | 1835 |
| 261 | Ga0495666_0034110 | 3300046526 | Bacteria | 2483 |
| 262 | Ga0495652_0027962 | 3300046529 | Bacteria | 4966 |
| 263 | Ga0495665_0004800 | 3300046531 | Bacteria | 7298 |
| 264 | Ga0495640_0006558 | 3300046533 | Bacteria | 9195 |
| 265 | Ga0495587_0035244 | 3300046536 | Bacteria | 3015 |
| 266 | Ga0495645_0006659 | 3300046543 | Bacteria | 8025 |
| 267 | Ga0495667_0109813 | 3300046559 | Bacteria | 1782 |
| 268 | Ga0495635_0019394 | 3300046663 | Bacteria | 4741 |
| 269 | Ga0495588_0132165 | 3300046674 | Bacteria | 1317 |
| 270 | Ga0495657_0161343 | 3300046675 | Bacteria | 1387 |
| 271 | Ga0495657_0201268 | 3300046675 | Bacteria | 1214 |
| 272 | Ga0495599_0001562 | 3300046678 | Bacteria | 13195 |
| 273 | Ga0495646_0021753 | 3300046680 | Bacteria | 4051 |
| 274 | Ga0495647_0000641 | 3300046681 | Bacteria | 10349 |
| 275 | Ga0495658_0001923 | 3300046683 | Bacteria | 10610 |
| 276 | Ga0495658_0002177 | 3300046683 | Bacteria | 9916 |
| 277 | Ga0495613_0063336 | 3300046689 | Bacteria | 2705 |
| 278 | Ga0495613_0074144 | 3300046689 | Bacteria | 2478 |
| 279 | Ga0495624_0021914 | 3300046690 | Bacteria | 4231 |
| 280 | Ga0495600_0139011 | 3300046809 | Bacteria | 1576 |
| 281 | Ga0495600_0180841 | 3300046809 | Unclassified | 1359 |
| 282 | Ga0495581_0012846 | 3300047315 | Bacteria | 4850 |
| 283 | Ga0495674_0019054 | 3300047319 | Bacteria | 6379 |
| 284 | Ga0495674_0088305 | 3300047319 | Bacteria | 2652 |
| 285 | Ga0495676_0020421 | 3300047321 | Bacteria | 5811 |
| 286 | Ga0495680_0018929 | 3300047322 | Bacteria | 5831 |
| 287 | Ga0495680_0157589 | 3300047322 | Unclassified | 1651 |
| 288 | Ga0495680_0216565 | 3300047322 | Bacteria | 1369 |
| 289 | Ga0495684_0039041 | 3300047471 | Bacteria | 3639 |
| 290 | Ga0495593_0002352 | 3300047673 | Bacteria | 11355 |
| 291 | Ga0495602_0019146 | 3300048088 | Bacteria | 6808 |
| 292 | Ga0495614_0002973 | 3300048089 | Bacteria | 7552 |
| 293 | Ga0496100_0035915 | 3300048903 | Bacteria | 3121 |
| 294 | Ga0496100_0045567 | 3300048903 | Bacteria | 2815 |
| 295 | Ga0496100_0051790 | 3300048903 | Bacteria | 2666 |
| 296 | Ga0496100_0118194 | 3300048903 | Bacteria | 1852 |
| 297 | Ga0496101_0002626 | 3300048904 | Bacteria | 11044 |
| 298 | Ga0496102_0007265 | 3300048905 | Bacteria | 9456 |
| 299 | Ga0496102_0082958 | 3300048905 | Bacteria | 2957 |
| 300 | Ga0496104_0205923 | 3300048907 | Bacteria | 1879 |
| 301 | Ga0496104_0361614 | 3300048907 | Bacteria | 1364 |
| 302 | Ga0496105_0001404 | 3300048908 | Bacteria | 16936 |
| 303 | Ga0496105_0011602 | 3300048908 | Bacteria | 6970 |
| 304 | Ga0496105_0023519 | 3300048908 | Bacteria | 4999 |
| 305 | Ga0496105_0325001 | 3300048908 | Bacteria | 1232 |
| 306 | Ga0496106_0001983 | 3300048909 | Bacteria | 15390 |
| 307 | Ga0496106_0163781 | 3300048909 | Bacteria | 1759 |
| 308 | Ga0496107_0011095 | 3300048910 | Bacteria | 6268 |
| 309 | Ga0496108_0019982 | 3300048911 | Bacteria | 5503 |
| 310 | Ga0496108_0062345 | 3300048911 | Bacteria | 3140 |
| 311 | Ga0496109_0009778 | 3300048912 | Bacteria | 8188 |
| 312 | Ga0496109_0034095 | 3300048912 | Bacteria | 4582 |
| 313 | Ga0496109_0146105 | 3300048912 | Bacteria | 2212 |
| 314 | Ga0496109_0157030 | 3300048912 | Bacteria | 2131 |
| 315 | Ga0496109_0278515 | 3300048912 | Unclassified | 1576 |
| 316 | Ga0496110_0010963 | 3300048913 | Bacteria | 7394 |
| 317 | Ga0496110_0017774 | 3300048913 | Bacteria | 5950 |
| 318 | Ga0496111_0051995 | 3300048914 | Bacteria | 2958 |
| 319 | Ga0496112_0042477 | 3300048915 | Bacteria | 4448 |
| 320 | Ga0496112_0151619 | 3300048915 | Bacteria | 2285 |
| 321 | Ga0496113_0066521 | 3300048916 | Bacteria | 2730 |
| 322 | Ga0496114_0001668 | 3300048917 | Bacteria | 16839 |
| 323 | Ga0496114_0034764 | 3300048917 | Bacteria | 4160 |
| 324 | Ga0496114_0301992 | 3300048917 | Bacteria | 1413 |
| 325 | Ga0496114_0337417 | 3300048917 | Bacteria | 1332 |
| 326 | Ga0496114_0402055 | 3300048917 | Bacteria | 1213 |
| 327 | Ga0496115_0003827 | 3300048918 | Bacteria | 10844 |
| 328 | Ga0496115_0144071 | 3300048918 | Bacteria | 1966 |
| 329 | Ga0501031_0001461 | 3300049568 | Bacteria | 14667 |
| 330 | Ga0501031_0279724 | 3300049568 | Bacteria | 1082 |
| 331 | Ga0501032_0003077 | 3300049569 | Bacteria | 12878 |
| 332 | Ga0501033_0002783 | 3300049570 | Bacteria | 14659 |
| 333 | Ga0501033_0051429 | 3300049570 | Bacteria | 3054 |
| 334 | Ga0501034_0049782 | 3300049571 | Bacteria | 4228 |
| 335 | Ga0501036_0000178 | 3300049572 | Bacteria | 41797 |
| 336 | Ga0501036_0062587 | 3300049572 | Unclassified | 3151 |
| 337 | Ga0501037_0000798 | 3300049573 | Bacteria | 23662 |
| 338 | Ga0501037_0018637 | 3300049573 | Bacteria | 5114 |
| 339 | Ga0501038_0002900 | 3300049574 | Bacteria | 15987 |
| 340 | Ga0501038_0015430 | 3300049574 | Bacteria | 6943 |
| 341 | Ga0501038_0065810 | 3300049574 | Bacteria | 3088 |
| 342 | Ga0501039_0000506 | 3300049575 | Bacteria | 28182 |
| 343 | Ga0501040_0000075 | 3300049576 | Bacteria | 47781 |
| 344 | Ga0501040_0094857 | 3300049576 | Bacteria | 2076 |
| 345 | Ga0501040_0438265 | 3300049576 | Bacteria | 940 |
| 346 | Ga0501041_0000017 | 3300049577 | Bacteria | 55768 |
| 347 | Ga0501041_0213433 | 3300049577 | Bacteria | 1210 |
| 348 | Ga0501041_0391215 | 3300049577 | Bacteria | 880 |
| 349 | Ga0501042_0003724 | 3300049578 | Bacteria | 9629 |
| 350 | Ga0501042_0024826 | 3300049578 | Bacteria | 4207 |
| 351 | Ga0501042_0051370 | 3300049578 | Bacteria | 2940 |
| 352 | Ga0501043_0000772 | 3300049579 | Bacteria | 28436 |
| 353 | Ga0501043_0015649 | 3300049579 | Bacteria | 5945 |
| 354 | Ga0501046_0000614 | 3300049580 | Bacteria | 35035 |
| 355 | Ga0501046_0004887 | 3300049580 | Bacteria | 12075 |
| 356 | Ga0501047_0000553 | 3300049581 | Bacteria | 40391 |
| 357 | Ga0501047_0128955 | 3300049581 | Bacteria | 2410 |
| 358 | Ga0501048_0002209 | 3300049582 | Bacteria | 14814 |
| 359 | Ga0501048_0006363 | 3300049582 | Bacteria | 8976 |
| 360 | Ga0501048_0249745 | 3300049582 | Bacteria | 1259 |
| 361 | Ga0501067_0003878 | 3300049583 | Bacteria | 8253 |
| 362 | Ga0501067_0013356 | 3300049583 | Bacteria | 4548 |
| 363 | Ga0501067_0018188 | 3300049583 | Bacteria | 3893 |
| 364 | Ga0501067_0023142 | 3300049583 | Bacteria | 3442 |
| 365 | Ga0501067_0145294 | 3300049583 | Bacteria | 1321 |
| 366 | Ga0501067_0153897 | 3300049583 | Bacteria | 1281 |
| 367 | Ga0501068_0000348 | 3300049584 | Bacteria | 23216 |
| 368 | Ga0501068_0009826 | 3300049584 | Bacteria | 5358 |
| 369 | Ga0501069_0000275 | 3300049585 | Bacteria | 23345 |
| 370 | Ga0501069_0012609 | 3300049585 | Bacteria | 4495 |
| 371 | Ga0501069_0025138 | 3300049585 | Bacteria | 3253 |
| 372 | Ga0501070_0003806 | 3300049586 | Bacteria | 13025 |
| 373 | Ga0501071_0000077 | 3300049587 | Bacteria | 35035 |
| 374 | Ga0501071_0067254 | 3300049587 | Bacteria | 2605 |
| 375 | Ga0501071_0157883 | 3300049587 | Bacteria | 1694 |
| 376 | Ga0501072_0000930 | 3300049588 | Bacteria | 21555 |
| 377 | Ga0501072_0151247 | 3300049588 | Unclassified | 1850 |
| 378 | Ga0501072_0280192 | 3300049588 | Bacteria | 1326 |
| 379 | Ga0501073_0040987 | 3300049589 | Bacteria | 3273 |
| 380 | Ga0501074_0000068 | 3300049590 | Bacteria | 49549 |
| 381 | Ga0501074_0008589 | 3300049590 | Bacteria | 7396 |
| 382 | Ga0501075_0000033 | 3300049591 | Bacteria | 55705 |
| 383 | Ga0501075_0014922 | 3300049591 | Bacteria | 5572 |
| 384 | Ga0501075_0059448 | 3300049591 | Bacteria | 2879 |
| 385 | Ga0501076_0000081 | 3300049592 | Bacteria | 49598 |
| 386 | Ga0501076_0017047 | 3300049592 | Bacteria | 5515 |
| 387 | Ga0501076_0099269 | 3300049592 | Bacteria | 2345 |
| 388 | Ga0501077_0003920 | 3300049593 | Bacteria | 8963 |
| 389 | Ga0501077_0008081 | 3300049593 | Bacteria | 6501 |
| 390 | Ga0501208_016429 | 3300049655 | Bacteria | 1151 |
| 391 | Ga0501079_0000294 | 3300049741 | Bacteria | 30839 |
| 392 | Ga0501079_0010329 | 3300049741 | Bacteria | 7093 |
| 393 | Ga0501079_0110720 | 3300049741 | Unclassified | 2133 |
| 394 | Ga0501079_0167399 | 3300049741 | Bacteria | 1714 |
| 395 | Ga0501080_0001270 | 3300049742 | Bacteria | 20981 |
| 396 | Ga0501080_0035359 | 3300049742 | Bacteria | 4662 |
| 397 | Ga0501080_0671981 | 3300049742 | Bacteria | 915 |
| 398 | Ga0501081_0012072 | 3300049743 | Bacteria | 5661 |
| 399 | Ga0501081_0043607 | 3300049743 | Unclassified | 3077 |
| 400 | Ga0501083_0000863 | 3300049744 | Bacteria | 19992 |
| 401 | Ga0501083_0008286 | 3300049744 | Bacteria | 7350 |
| 402 | Ga0501035_0001112 | 3300049822 | Bacteria | 28156 |
| 403 | Ga0501035_0029473 | 3300049822 | Bacteria | 5004 |
| 404 | Ga0501044_0003077 | 3300049823 | Bacteria | 18881 |
| 405 | Ga0501044_0031503 | 3300049823 | Bacteria | 5581 |
| 406 | Ga0501045_0000172 | 3300049824 | Bacteria | 35365 |
| 407 | Ga0501045_0050673 | 3300049824 | Unclassified | 3029 |
| 408 | Ga0501045_0159022 | 3300049824 | Bacteria | 1681 |
| 409 | nmdc:mga05p37_213654_c1 | 3300050507 | Bacteria | 2331 |
| 410 | nmdc:mga0qj67_5555_c1 | 3300050509 | Bacteria | 9220 |
| 411 | nmdc:mga06r32_44366_c1 | 3300050510 | Bacteria | 4234 |
| 412 | nmdc:mga08y16_161870_c1 | 3300050511 | Bacteria | 2325 |
| 413 | nmdc:mga0n895_2495_c1 | 3300050512 | Bacteria | 14390 |
| 414 | nmdc:mga0n895_45104_c1 | 3300050512 | Bacteria | 4301 |
| 415 | nmdc:mga0rr50_93074_c1 | 3300050513 | Bacteria | 2351 |
| 416 | nmdc:mga0a205_11294_c1 | 3300050515 | Bacteria | 8223 |
| 417 | Ga0495601_0003266 | 3300053077 | Bacteria | 9266 |
| 418 | Ga0495601_0024240 | 3300053077 | Bacteria | 3736 |
| 419 | Ga0495612_0002818 | 3300053078 | Bacteria | 7190 |
| 420 | Ga0495595_0003142 | 3300053084 | Bacteria | 6548 |
| 421 | Ga0495595_0032500 | 3300053084 | Bacteria | 2350 |
| 422 | Ga0495619_0013606 | 3300053085 | Bacteria | 5127 |
| 423 | Ga0495619_0018970 | 3300053085 | Bacteria | 4369 |
| 424 | Ga0500566_0081239 | 3300053094 | Bacteria | 1803 |
| 425 | Ga0501084_0000261 | 3300054114 | Bacteria | 39815 |
| 426 | Ga0501084_0038336 | 3300054114 | Bacteria | 4006 |
| 427 | Ga0501082_0000122 | 3300060353 | Bacteria | 62357 |
| 428 | Ga0501082_0037251 | 3300060353 | Bacteria | 4191 |
| 429 | Ga0501082_0185046 | 3300060353 | Bacteria | 1812 |
| 430 | Ga0466962_0000661 | 3300061719 | Bacteria | 15283 |
| 431 | Ga0466962_0004047 | 3300061719 | Bacteria | 7016 |
| 432 | Ga0466962_0007279 | 3300061719 | Bacteria | 5305 |
| 433 | Ga0466962_0167043 | 3300061719 | Bacteria | 1071 |
| 434 | Ga0530510_0003974 | 3300061734 | Bacteria | 10203 |
| 435 | Ga0530510_0039066 | 3300061734 | Bacteria | 3426 |
| 436 | Ga0530510_0145554 | 3300061734 | Bacteria | 1748 |
| 437 | Ga0530510_0259892 | 3300061734 | Bacteria | 1294 |
| 438 | 2865000176 | 2864997549 | Bacteria | 5139696 |
| 439 | 2865003761 | 2865002811 | Bacteria | 6333767 |
| 440 | 2889296250 | 2889295896 | Bacteria | 4704906 |
| 441 | 2981287994 | 2981284811 | Bacteria | 4641497 |
| 442 | 2981292292 | 2981289755 | Bacteria | 4641509 |
| 443 | 2981983613 | 2981980479 | Bacteria | 4641628 |
| 444 | 2981988350 | 2981985349 | Bacteria | 4641497 |
| 445 | 8057978789 | 8057977335 | Bacteria | 5694872 |
| 446 | Ga0070683_100032264 | |||
| 447 | Ga0070658_10158455 | |||
| 448 | Ga0070683_100044702 | |||
| 449 | Ga0070683_100227063 | |||
| 450 | Ga0068869_100192511 | |||
| 451 | Ga0070680_100024634 | |||
| 452 | Ga0070682_100028605 | |||
| 453 | Ga0070689_100074479 | |||
| 454 | Ga0070687_100011807 | |||
| 455 | Ga0070661_100048518 | |||
| 456 | Ga0070692_10033233 | |||
| 457 | Ga0070671_100147996 | |||
| 458 | Ga0070674_100493068 | |||
| 459 | Ga0070688_100011297 | |||
| 460 | Ga0070659_100051752 | |||
| 461 | Ga0070659_100314451 | |||
| 462 | Ga0070709_10121555 | |||
| 463 | Ga0070714_100005702 | |||
| 464 | Ga0070714_100161330 | |||
| 465 | Ga0070705_100010187 | |||
| 466 | Ga0070700_100047122 | |||
| 467 | Ga0070708_100231831 | |||
| 468 | Ga0070681_10002282 | |||
| 469 | Ga0070681_10076604 | |||
| 470 | Ga0070681_10077887 | |||
| 471 | Ga0070706_100177758 | |||
| 472 | Ga0070707_100000967 | |||
| 473 | Ga0070707_100271894 | |||
| 474 | Ga0070679_100012378 | |||
| 475 | Ga0070679_100038745 | |||
| 476 | Ga0070679_100135434 | |||
| 477 | Ga0070684_100047730 | |||
| 478 | Ga0070684_100060371 | |||
| 479 | Ga0068853_100026258 | |||
| 480 | Ga0068853_100280877 | |||
| 481 | Ga0070693_100050808 | |||
| 482 | Ga0068855_100019894 | |||
| 483 | Ga0068855_100383160 | |||
| 484 | Ga0070702_100030705 | |||
| 485 | Ga0068852_100069171 | |||
| 486 | Ga0068863_100072418 | |||
| 487 | Ga0081455_10009468 | |||
| 488 | Ga0070717_10028071 | |||
| 489 | Ga0070712_100016277 | |||
| 490 | Ga0068871_100097613 | |||
| 491 | Ga0075430_100004529 | |||
| 492 | Ga0075430_100075327 | |||
| 493 | Ga0075431_100401545 | |||
| 494 | Ga0075433_10031533 | |||
| 495 | Ga0111539_10441614 | |||
| 496 | Ga0105245_10041478 | |||
| 497 | Ga0105247_10061295 | |||
| 498 | Ga0114129_10100209 | |||
| 499 | Ga0105243_10065997 | |||
| 500 | Ga0105242_10043640 | |||
| 501 | Ga0105248_10463768 | |||
| 502 | Ga0105237_10029558 | |||
| 503 | Ga0105237_10040322 | |||
| 504 | Ga0105237_10239531 | |||
| 505 | Ga0105238_10041627 | |||
| 506 | Ga0105238_10099365 | |||
| 507 | Ga0105249_10444752 | |||
| 508 | Ga0105246_10215296 | |||
| 509 | Ga0157373_10057156 | |||
| 510 | Ga0157369_10092016 | |||
| 511 | Ga0157374_10138246 | |||
| 512 | Ga0157378_10210033 | |||
| 513 | Ga0157372_10011742 | |||
| 514 | Ga0157372_10231893 | |||
| 515 | Ga0157375_10026281 | |||
| 516 | Ga0157375_10421472 | |||
| 517 | Ga0157379_10165188 | |||
| 518 | Ga0157376_10035395 | |||
| 519 | Ga0157376_10170132 | |||
| 520 | Ga0206356_10541719 | |||
| 521 | Ga0213873_10020766 | |||
| 522 | Ga0213876_10006708 | |||
| 523 | Ga0207642_10109786 | |||
| 524 | Ga0207685_10041806 | |||
| 525 | Ga0207705_10044491 | |||
| 526 | Ga0207705_10071033 | |||
| 527 | Ga0207684_10152711 | |||
| 528 | Ga0207707_10041335 | |||
| 529 | Ga0207707_10309773 | |||
| 530 | Ga0207707_10410663 | |||
| 531 | Ga0207671_10331823 | |||
| 532 | Ga0207693_10019178 | |||
| 533 | Ga0207693_10042318 | |||
| 534 | Ga0207660_10035014 | |||
| 535 | Ga0207660_10158002 | |||
| 536 | Ga0207660_10220984 | |||
| 537 | Ga0207662_10045143 | |||
| 538 | Ga0207657_10003378 | |||
| 539 | Ga0207657_10005580 | |||
| 540 | Ga0207657_10052056 | |||
| 541 | Ga0207657_10179474 | |||
| 542 | Ga0207652_10112451 | |||
| 543 | Ga0207652_10122850 | |||
| 544 | Ga0207652_10443780 | |||
| 545 | Ga0207646_10000523 | |||
| 546 | Ga0207694_10092187 | |||
| 547 | Ga0207687_10165122 | |||
| 548 | Ga0207700_10046990 | |||
| 549 | Ga0207690_10264469 | |||
| 550 | Ga0207670_10201873 | |||
| 551 | Ga0207711_10084966 | |||
| 552 | Ga0207689_10201434 | |||
| 553 | Ga0207661_10037390 | |||
| 554 | Ga0207661_10355004 | |||
| 555 | Ga0207667_10055017 | |||
| 556 | Ga0207667_10071067 | |||
| 557 | Ga0207667_10128935 | |||
| 558 | Ga0207712_10154947 | |||
| 559 | Ga0207640_10332736 | |||
| 560 | Ga0207639_10142391 | |||
| 561 | Ga0207678_10122734 | |||
| 562 | Ga0207708_10013328 | |||
| 563 | Ga0207702_10048931 | |||
| 564 | Ga0207674_10015034 | |||
| 565 | Ga0207674_10085601 | |||
| 566 | Ga0207674_10109423 | |||
| 567 | Ga0207675_100524123 | |||
| 568 | Ga0207683_10032120 | |||
| 569 | Ga0268266_10146586 | |||
| 570 | Ga0268264_10123819 | |||
| 571 | Ga0265338_10002905 | |||
| 572 | Ga0265338_10090364 | |||
| 573 | Ga0265327_10022102 | |||
| 574 | Ga0265313_10051261 | |||
| 575 | Ga0307410_10266555 | |||
| 576 | Ga0307409_100151139 | |||
| 577 | Ga0307415_100096449 | |||
| 578 | Ga0373943_0005060 | |||
| 579 | Ga0373943_0005096 | |||
| 580 | Ga0373946_0007761 | |||
| 581 | Ga0373924_0053280 | |||
| 582 | Ga0373935_0027746 | |||
| 583 | Ga0373927_0105256 | |||
| 584 | Ga0373947_0006173 | |||
| 585 | Ga0373947_0035885 | |||
| 586 | Ga0373925_0012171 | |||
| 587 | Ga0373925_0055267 | |||
| 588 | Ga0395899_0113346 | |||
| 589 | Ga0395900_0020711 | |||
| 590 | Ga0395900_0163220 | |||
| 591 | Ga0395898_0008937 | |||
| 592 | Ga0395898_0019264 | |||
| 593 | Ga0395898_0079341 | |||
| 594 | Ga0395898_0333229 | |||
| 595 | Ga0395905_0026683 | |||
| 596 | Ga0395905_0557174 | |||
| 597 | Ga0395901_0006012 | |||
| 598 | Ga0395901_0007996 | |||
| 599 | Ga0395901_0076825 | |||
| 600 | Ga0436365_0186427 | |||
| 601 | Ga0436360_0460027 | |||
| 602 | Ga0436363_1625980 | |||
| 603 | Ga0436362_0204343 | |||
| 604 | Ga0439448_0069663 | |||
| 605 | Ga0439449_0008868 | |||
| 606 | Ga0439457_051980 | |||
| 607 | Ga0466969_0001830 | |||
| 608 | Ga0466965_0077806 | |||
| 609 | Ga0466965_0091071 | |||
| 610 | Ga0466961_0004711 | |||
| 611 | Ga0466961_0024355 | |||
| 612 | Ga0466961_0068952 | |||
| 613 | Ga0466961_0248514 | |||
| 614 | Ga0466963_0000298 | |||
| 615 | Ga0466963_0000482 | |||
| 616 | Ga0466963_0001696 | |||
| 617 | Ga0466963_0002096 | |||
| 618 | Ga0466963_0002956 | |||
| 619 | Ga0466963_0004681 | |||
| 620 | Ga0466963_0005909 | |||
| 621 | Ga0466963_0010624 | |||
| 622 | Ga0466963_0019384 | |||
| 623 | Ga0466963_0019440 | |||
| 624 | Ga0466963_0021423 | |||
| 625 | Ga0466963_0115401 | |||
| 626 | Ga0466963_0122171 | |||
| 627 | Ga0466964_0002630 | |||
| 628 | Ga0466964_0006206 | |||
| 629 | Ga0466964_0007807 | |||
| 630 | Ga0466964_0013650 | |||
| 631 | Ga0466964_0037484 | |||
| 632 | Ga0466964_0038505 | |||
| 633 | Ga0466964_0060841 | |||
| 634 | Ga0466964_0088992 | |||
| 635 | Ga0466964_0109725 | |||
| 636 | Ga0466971_0000127 | |||
| 637 | Ga0466971_0001805 | |||
| 638 | Ga0466971_0004784 | |||
| 639 | Ga0466971_0014788 | |||
| 640 | Ga0466971_0049191 | |||
| 641 | Ga0466971_0169830 | |||
| 642 | Ga0466968_0003400 | |||
| 643 | Ga0466968_0039989 | |||
| 644 | Ga0466957_0001239 | |||
| 645 | Ga0466957_0011408 | |||
| 646 | Ga0466957_0011744 | |||
| 647 | Ga0466957_0012562 | |||
| 648 | Ga0466957_0019526 | |||
| 649 | Ga0466957_0047503 | |||
| 650 | Ga0466957_0090021 | |||
| 651 | Ga0466957_0166145 | |||
| 652 | Ga0466960_0002382 | |||
| 653 | Ga0466960_0122799 | |||
| 654 | Ga0466959_0006797 | |||
| 655 | Ga0466959_0007429 | |||
| 656 | Ga0466959_0007831 | |||
| 657 | Ga0466959_0028520 | |||
| 658 | Ga0466958_0000596 | |||
| 659 | Ga0466958_0005516 | |||
| 660 | Ga0466958_0006575 | |||
| 661 | Ga0466958_0009049 | |||
| 662 | Ga0466958_0016619 | |||
| 663 | Ga0466958_0036435 | |||
| 664 | Ga0466958_0169242 | |||
| 665 | Ga0466967_0001902 | |||
| 666 | Ga0466967_0005334 | |||
| 667 | Ga0466967_0010178 | |||
| 668 | Ga0466967_0010364 | |||
| 669 | Ga0466967_0011964 | |||
| 670 | Ga0466967_0014265 | |||
| 671 | Ga0466967_0014394 | |||
| 672 | Ga0466967_0025981 | |||
| 673 | Ga0466967_0029841 | |||
| 674 | Ga0466967_0040198 | |||
| 675 | Ga0466967_0046469 | |||
| 676 | Ga0466967_0050206 | |||
| 677 | Ga0466967_0055171 | |||
| 678 | Ga0466967_0056992 | |||
| 679 | Ga0466967_0110862 | |||
| 680 | Ga0466967_0117759 | |||
| 681 | Ga0466967_0265018 | |||
| 682 | Ga0466967_0387710 | |||
| 683 | Ga0466967_0422490 | |||
| 684 | Ga0495592_0020993 | |||
| 685 | Ga0495629_0038065 | |||
| 686 | Ga0495629_0138177 | |||
| 687 | Ga0495641_0008727 | |||
| 688 | Ga0495641_0046725 | |||
| 689 | Ga0495651_0112137 | |||
| 690 | Ga0495653_0046272 | |||
| 691 | Ga0495653_0112143 | |||
| 692 | Ga0495653_0132624 | |||
| 693 | Ga0495580_0000821 | |||
| 694 | Ga0495580_0029469 | |||
| 695 | Ga0495582_0015331 | |||
| 696 | Ga0495582_0047791 | |||
| 697 | Ga0495639_0007329 | |||
| 698 | Ga0495662_0005156 | |||
| 699 | Ga0495662_0112555 | |||
| 700 | Ga0495664_0008329 | |||
| 701 | Ga0495618_0032250 | |||
| 702 | Ga0495618_0123550 | |||
| 703 | Ga0495628_0079018 | |||
| 704 | Ga0495630_0031211 | |||
| 705 | Ga0495630_0140691 | |||
| 706 | Ga0495666_0034110 | |||
| 707 | Ga0495652_0027962 | |||
| 708 | Ga0495665_0004800 | |||
| 709 | Ga0495640_0006558 | |||
| 710 | Ga0495587_0035244 | |||
| 711 | Ga0495645_0006659 | |||
| 712 | Ga0495667_0109813 | |||
| 713 | Ga0495635_0019394 | |||
| 714 | Ga0495588_0132165 | |||
| 715 | Ga0495657_0161343 | |||
| 716 | Ga0495657_0201268 | |||
| 717 | Ga0495599_0001562 | |||
| 718 | Ga0495646_0021753 | |||
| 719 | Ga0495647_0000641 | |||
| 720 | Ga0495658_0001923 | |||
| 721 | Ga0495658_0002177 | |||
| 722 | Ga0495613_0063336 | |||
| 723 | Ga0495613_0074144 | |||
| 724 | Ga0495624_0021914 | |||
| 725 | Ga0495600_0139011 | |||
| 726 | Ga0495600_0180841 | |||
| 727 | Ga0495581_0012846 | |||
| 728 | Ga0495674_0019054 | |||
| 729 | Ga0495674_0088305 | |||
| 730 | Ga0495676_0020421 | |||
| 731 | Ga0495680_0018929 | |||
| 732 | Ga0495680_0157589 | |||
| 733 | Ga0495680_0216565 | |||
| 734 | Ga0495684_0039041 | |||
| 735 | Ga0495593_0002352 | |||
| 736 | Ga0495602_0019146 | |||
| 737 | Ga0495614_0002973 | |||
| 738 | Ga0496100_0035915 | |||
| 739 | Ga0496100_0045567 | |||
| 740 | Ga0496100_0051790 | |||
| 741 | Ga0496100_0118194 | |||
| 742 | Ga0496101_0002626 | |||
| 743 | Ga0496102_0007265 | |||
| 744 | Ga0496102_0082958 | |||
| 745 | Ga0496104_0205923 | |||
| 746 | Ga0496104_0361614 | |||
| 747 | Ga0496105_0001404 | |||
| 748 | Ga0496105_0011602 | |||
| 749 | Ga0496105_0023519 | |||
| 750 | Ga0496105_0325001 | |||
| 751 | Ga0496106_0001983 | |||
| 752 | Ga0496106_0163781 | |||
| 753 | Ga0496107_0011095 | |||
| 754 | Ga0496108_0019982 | |||
| 755 | Ga0496108_0062345 | |||
| 756 | Ga0496109_0009778 | |||
| 757 | Ga0496109_0034095 | |||
| 758 | Ga0496109_0146105 | |||
| 759 | Ga0496109_0157030 | |||
| 760 | Ga0496109_0278515 | |||
| 761 | Ga0496110_0010963 | |||
| 762 | Ga0496110_0017774 | |||
| 763 | Ga0496111_0051995 | |||
| 764 | Ga0496112_0042477 | |||
| 765 | Ga0496112_0151619 | |||
| 766 | Ga0496113_0066521 | |||
| 767 | Ga0496114_0001668 | |||
| 768 | Ga0496114_0034764 | |||
| 769 | Ga0496114_0301992 | |||
| 770 | Ga0496114_0337417 | |||
| 771 | Ga0496114_0402055 | |||
| 772 | Ga0496115_0003827 | |||
| 773 | Ga0496115_0144071 | |||
| 774 | Ga0501031_0001461 | |||
| 775 | Ga0501031_0279724 | |||
| 776 | Ga0501032_0003077 | |||
| 777 | Ga0501033_0002783 | |||
| 778 | Ga0501033_0051429 | |||
| 779 | Ga0501034_0049782 | |||
| 780 | Ga0501036_0000178 | |||
| 781 | Ga0501036_0062587 | |||
| 782 | Ga0501037_0000798 | |||
| 783 | Ga0501037_0018637 | |||
| 784 | Ga0501038_0002900 | |||
| 785 | Ga0501038_0015430 | |||
| 786 | Ga0501038_0065810 | |||
| 787 | Ga0501039_0000506 | |||
| 788 | Ga0501040_0000075 | |||
| 789 | Ga0501040_0094857 | |||
| 790 | Ga0501040_0438265 | |||
| 791 | Ga0501041_0000017 | |||
| 792 | Ga0501041_0213433 | |||
| 793 | Ga0501041_0391215 | |||
| 794 | Ga0501042_0003724 | |||
| 795 | Ga0501042_0024826 | |||
| 796 | Ga0501042_0051370 | |||
| 797 | Ga0501043_0000772 | |||
| 798 | Ga0501043_0015649 | |||
| 799 | Ga0501046_0000614 | |||
| 800 | Ga0501046_0004887 | |||
| 801 | Ga0501047_0000553 | |||
| 802 | Ga0501047_0128955 | |||
| 803 | Ga0501048_0002209 | |||
| 804 | Ga0501048_0006363 | |||
| 805 | Ga0501048_0249745 | |||
| 806 | Ga0501067_0003878 | |||
| 807 | Ga0501067_0013356 | |||
| 808 | Ga0501067_0018188 | |||
| 809 | Ga0501067_0023142 | |||
| 810 | Ga0501067_0145294 | |||
| 811 | Ga0501067_0153897 | |||
| 812 | Ga0501068_0000348 | |||
| 813 | Ga0501068_0009826 | |||
| 814 | Ga0501069_0000275 | |||
| 815 | Ga0501069_0012609 | |||
| 816 | Ga0501069_0025138 | |||
| 817 | Ga0501070_0003806 | |||
| 818 | Ga0501071_0000077 | |||
| 819 | Ga0501071_0067254 | |||
| 820 | Ga0501071_0157883 | |||
| 821 | Ga0501072_0000930 | |||
| 822 | Ga0501072_0151247 | |||
| 823 | Ga0501072_0280192 | |||
| 824 | Ga0501073_0040987 | |||
| 825 | Ga0501074_0000068 | |||
| 826 | Ga0501074_0008589 | |||
| 827 | Ga0501075_0000033 | |||
| 828 | Ga0501075_0014922 | |||
| 829 | Ga0501075_0059448 | |||
| 830 | Ga0501076_0000081 | |||
| 831 | Ga0501076_0017047 | |||
| 832 | Ga0501076_0099269 | |||
| 833 | Ga0501077_0003920 | |||
| 834 | Ga0501077_0008081 | |||
| 835 | Ga0501208_016429 | |||
| 836 | Ga0501079_0000294 | |||
| 837 | Ga0501079_0010329 | |||
| 838 | Ga0501079_0110720 | |||
| 839 | Ga0501079_0167399 | |||
| 840 | Ga0501080_0001270 | |||
| 841 | Ga0501080_0035359 | |||
| 842 | Ga0501080_0671981 | |||
| 843 | Ga0501081_0012072 | |||
| 844 | Ga0501081_0043607 | |||
| 845 | Ga0501083_0000863 | |||
| 846 | Ga0501083_0008286 | |||
| 847 | Ga0501035_0001112 | |||
| 848 | Ga0501035_0029473 | |||
| 849 | Ga0501044_0003077 | |||
| 850 | Ga0501044_0031503 | |||
| 851 | Ga0501045_0000172 | |||
| 852 | Ga0501045_0050673 | |||
| 853 | Ga0501045_0159022 | |||
| 854 | nmdc:mga05p37_213654_c1 | |||
| 855 | nmdc:mga0qj67_5555_c1 | |||
| 856 | nmdc:mga06r32_44366_c1 | |||
| 857 | nmdc:mga08y16_161870_c1 | |||
| 858 | nmdc:mga0n895_2495_c1 | |||
| 859 | nmdc:mga0n895_45104_c1 | |||
| 860 | nmdc:mga0rr50_93074_c1 | |||
| 861 | nmdc:mga0a205_11294_c1 | |||
| 862 | Ga0495601_0003266 | |||
| 863 | Ga0495601_0024240 | |||
| 864 | Ga0495612_0002818 | |||
| 865 | Ga0495595_0003142 | |||
| 866 | Ga0495595_0032500 | |||
| 867 | Ga0495619_0013606 | |||
| 868 | Ga0495619_0018970 | |||
| 869 | Ga0500566_0081239 | |||
| 870 | Ga0501084_0000261 | |||
| 871 | Ga0501084_0038336 | |||
| 872 | Ga0501082_0000122 | |||
| 873 | Ga0501082_0037251 | |||
| 874 | Ga0501082_0185046 | |||
| 875 | Ga0466962_0000661 | |||
| 876 | Ga0466962_0004047 | |||
| 877 | Ga0466962_0007279 | |||
| 878 | Ga0466962_0167043 | |||
| 879 | Ga0530510_0003974 | |||
| 880 | Ga0530510_0039066 | |||
| 881 | Ga0530510_0145554 | |||
| 882 | Ga0530510_0259892 | |||
| 883 | 2865000176 | |||
| 884 | 2865003761 | |||
| 885 | 2889296250 | |||
| 886 | 2981287994 | |||
| 887 | 2981292292 | |||
| 888 | 2981983613 | |||
| 889 | 2981988350 | |||
| 890 | 8057978789 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5m42-assembly1.cif.gz_A | structure of thermus thermophilus l-proline dehydrogenase lacking alpha helices a, b and c | 0.975 | 47 | 283 |
| 4h6r-assembly1.cif.gz_A | structure of reduced deinococcus radiodurans proline dehydrogenase | 0.9611 | 36 | 298 |
| 2ekg-assembly1.cif.gz_B | structure of thermus thermophilus proline dehydrogenase inactivated by n-propargylglycine | 0.9578 | 10 | 297 |
| 5m42-assembly1.cif.gz_A | structure of thermus thermophilus l-proline dehydrogenase lacking alpha helices a, b and c | 0.9513 | 47 | 283 |
| 2g37-assembly1.cif.gz_A | structure of thermus thermophilus l-proline dehydrogenase | 0.9506 | 13 | 298 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ekgB02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9697 | 45 | 283 | 3.20.20.220 |
| af_Q2FXG3_20_304_3.20.20.220 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9616 | 31 | 309 | 3.20.20.220 |
| 4h6rA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9611 | 36 | 298 | 3.20.20.220 |
| 2ekgB02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9541 | 45 | 283 | 3.20.20.220 |
| af_Q2FXG3_20_304_3.20.20.220 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9385 | 31 | 309 | 3.20.20.220 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F2XUP0-F1-model_v4 | proline dehydrogenase (EC 1.5.5.2) | 0.9873 | 39 | 305 |
GO:0000166
GO:0004657 GO:0010133 |
| AF-C2PMD1-F1-model_v4 | deleted | 0.9809 | 178 | 311 |
|
| AF-A0A223D6M5-F1-model_v4 | proline dehydrogenase (EC 1.5.5.2) | 0.9791 | 39 | 311 |
GO:0000166
GO:0004657 GO:0010133 |
| AF-A0A4R5KXX6-F1-model_v4 | proline dehydrogenase (EC 1.5.5.2) | 0.9787 | 39 | 311 |
GO:0000166
GO:0004657 GO:0010133 |
| AF-A0A0D5NSA9-F1-model_v4 | proline dehydrogenase (EC 1.5.5.2) | 0.978 | 15 | 311 |
GO:0000166
GO:0004657 GO:0010133 |