F445413

General Info

Members Datasets Scaffolds Average Seq Length
445 238 890 305

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100032264|Ga0070683_1000322644
Length 330
Sequence MAVVGQDDSAGARPAPHVTRPRIDLNPLFRSGILAATGNPLVSHVVQRYGMRLGASRFVAGETFDEAIPVLRGLNQKGLRTNTTLLGEGIKDRATTRAVVDEYKRDFDRIAMEGLQTNIALKLTHLGLDLDPELAYRNLAEIVAHAAGHGNFVRIDMEESNRVDDTLRIYRRLREEGHDNVGTVLQAYLFRTPADFASLLPLRPNLRLVKGAYLEPASVAYPQKADVDRAYLELAELMLLEGGFTAIATHDERIIDHVLDFTQRHGIGTDRFELQMLFGVRPQYQADLARAGHRVLVATPYGPHWYRYLMRRLAERPANLAWFASNVVRR

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
98 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
99 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
111 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
112 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
113 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
114 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
115 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
116 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
117 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
118 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
121 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
122 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
137 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
138 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
142 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
143 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
144 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
150 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
151 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
164 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
165 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
211 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
223 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
224 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
231 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
232 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
233 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
234 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
235 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
236 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
237 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
238 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.98
Metatranscriptomes 0.22
Isolates 1.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 8.09
Rhizosphere 90.34
Stem 0
Stem Tuber 0
Unclassified 4.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100032264 3300005329 Bacteria 4770
2 Ga0070658_10158455 3300005327 Bacteria 1898
3 Ga0070683_100044702 3300005329 Bacteria 4085
4 Ga0070683_100227063 3300005329 Unclassified 1775
5 Ga0068869_100192511 3300005334 Bacteria 1604
6 Ga0070680_100024634 3300005336 Bacteria 4809
7 Ga0070682_100028605 3300005337 Bacteria 3353
8 Ga0070689_100074479 3300005340 Bacteria 2656
9 Ga0070687_100011807 3300005343 Bacteria 3836
10 Ga0070661_100048518 3300005344 Bacteria 3108
11 Ga0070692_10033233 3300005345 Bacteria 2599
12 Ga0070671_100147996 3300005355 Bacteria 1983
13 Ga0070674_100493068 3300005356 Bacteria 1019
14 Ga0070688_100011297 3300005365 Bacteria 4959
15 Ga0070659_100051752 3300005366 Bacteria 3229
16 Ga0070659_100314451 3300005366 Bacteria 1308
17 Ga0070709_10121555 3300005434 Bacteria 1771
18 Ga0070714_100005702 3300005435 Bacteria 9536
19 Ga0070714_100161330 3300005435 Bacteria 2029
20 Ga0070705_100010187 3300005440 Bacteria 4697
21 Ga0070700_100047122 3300005441 Bacteria 2666
22 Ga0070708_100231831 3300005445 Bacteria 1732
23 Ga0070681_10002282 3300005458 Bacteria 17522
24 Ga0070681_10076604 3300005458 Bacteria 3302
25 Ga0070681_10077887 3300005458 Bacteria 3272
26 Ga0070706_100177758 3300005467 Bacteria 1987
27 Ga0070707_100000967 3300005468 Bacteria 28411
28 Ga0070707_100271894 3300005468 Bacteria 1647
29 Ga0070679_100012378 3300005530 Bacteria 8151
30 Ga0070679_100038745 3300005530 Bacteria 4738
31 Ga0070679_100135434 3300005530 Bacteria 2444
32 Ga0070684_100047730 3300005535 Bacteria 3711
33 Ga0070684_100060371 3300005535 Bacteria 3316
34 Ga0068853_100026258 3300005539 Bacteria 4890
35 Ga0068853_100280877 3300005539 Bacteria 1535
36 Ga0070693_100050808 3300005547 Bacteria 2371
37 Ga0068855_100019894 3300005563 Bacteria 8062
38 Ga0068855_100383160 3300005563 Bacteria 1543
39 Ga0070702_100030705 3300005615 Bacteria 2932
40 Ga0068852_100069171 3300005616 Bacteria 3093
41 Ga0068863_100072418 3300005841 Bacteria 3260
42 Ga0081455_10009468 3300005937 Bacteria 10019
43 Ga0070717_10028071 3300006028 Bacteria 4501
44 Ga0070712_100016277 3300006175 Bacteria 4803
45 Ga0068871_100097613 3300006358 Bacteria 2456
46 Ga0075430_100004529 3300006846 Bacteria 11704
47 Ga0075430_100075327 3300006846 Bacteria 2829
48 Ga0075431_100401545 3300006847 Bacteria 1372
49 Ga0075433_10031533 3300006852 Bacteria 4532
50 Ga0111539_10441614 3300009094 Bacteria 1515
51 Ga0105245_10041478 3300009098 Bacteria 4102
52 Ga0105247_10061295 3300009101 Bacteria 2332
53 Ga0114129_10100209 3300009147 Bacteria 4008
54 Ga0105243_10065997 3300009148 Bacteria 2909
55 Ga0105242_10043640 3300009176 Bacteria 3627
56 Ga0105248_10463768 3300009177 Bacteria 1428
57 Ga0105237_10029558 3300009545 Bacteria 5569
58 Ga0105237_10040322 3300009545 Bacteria 4709
59 Ga0105237_10239531 3300009545 Unclassified 1815
60 Ga0105238_10041627 3300009551 Bacteria 4652
61 Ga0105238_10099365 3300009551 Bacteria 2893
62 Ga0105249_10444752 3300009553 Bacteria 1334
63 Ga0105246_10215296 3300011119 Bacteria 1502
64 Ga0157373_10057156 3300013100 Bacteria 2768
65 Ga0157369_10092016 3300013105 Bacteria 3236
66 Ga0157374_10138246 3300013296 Bacteria 2363
67 Ga0157378_10210033 3300013297 Bacteria 1845
68 Ga0157372_10011742 3300013307 Bacteria 9327
69 Ga0157372_10231893 3300013307 Bacteria 2140
70 Ga0157375_10026281 3300013308 Bacteria 5421
71 Ga0157375_10421472 3300013308 Bacteria 1501
72 Ga0157379_10165188 3300014968 Bacteria 1998
73 Ga0157376_10035395 3300014969 Bacteria 4039
74 Ga0157376_10170132 3300014969 Bacteria 1983
75 Ga0206356_10541719 3300020070 Bacteria 2868
76 Ga0213873_10020766 3300021358 Unclassified 1537
77 Ga0213876_10006708 3300021384 Bacteria 6282
78 Ga0207642_10109786 3300025899 Bacteria 1402
79 Ga0207685_10041806 3300025905 Bacteria 1718
80 Ga0207705_10044491 3300025909 Bacteria 3191
81 Ga0207705_10071033 3300025909 Bacteria 2523
82 Ga0207684_10152711 3300025910 Bacteria 1987
83 Ga0207707_10041335 3300025912 Bacteria 4027
84 Ga0207707_10309773 3300025912 Bacteria 1364
85 Ga0207707_10410663 3300025912 Bacteria 1162
86 Ga0207671_10331823 3300025914 Bacteria 1205
87 Ga0207693_10019178 3300025915 Bacteria 5443
88 Ga0207693_10042318 3300025915 Bacteria 3586
89 Ga0207660_10035014 3300025917 Bacteria 3483
90 Ga0207660_10158002 3300025917 Unclassified 1747
91 Ga0207660_10220984 3300025917 Bacteria 1487
92 Ga0207662_10045143 3300025918 Bacteria 2604
93 Ga0207657_10003378 3300025919 Bacteria 17066
94 Ga0207657_10005580 3300025919 Bacteria 13138
95 Ga0207657_10052056 3300025919 Bacteria 3556
96 Ga0207657_10179474 3300025919 Bacteria 1712
97 Ga0207652_10112451 3300025921 Bacteria 2416
98 Ga0207652_10122850 3300025921 Bacteria 2311
99 Ga0207652_10443780 3300025921 Bacteria 1170
100 Ga0207646_10000523 3300025922 Bacteria 51093
101 Ga0207694_10092187 3300025924 Bacteria 2391
102 Ga0207687_10165122 3300025927 Bacteria 1703
103 Ga0207700_10046990 3300025928 Bacteria 3197
104 Ga0207690_10264469 3300025932 Bacteria 1334
105 Ga0207670_10201873 3300025936 Bacteria 1511
106 Ga0207711_10084966 3300025941 Bacteria 2771
107 Ga0207689_10201434 3300025942 Bacteria 1643
108 Ga0207661_10037390 3300025944 Bacteria 3797
109 Ga0207661_10355004 3300025944 Unclassified 1323
110 Ga0207667_10055017 3300025949 Bacteria 4184
111 Ga0207667_10071067 3300025949 Bacteria 3620
112 Ga0207667_10128935 3300025949 Bacteria 2605
113 Ga0207712_10154947 3300025961 Bacteria 1774
114 Ga0207640_10332736 3300025981 Bacteria 1214
115 Ga0207639_10142391 3300026041 Bacteria 1999
116 Ga0207678_10122734 3300026067 Bacteria 2216
117 Ga0207708_10013328 3300026075 Bacteria 6141
118 Ga0207702_10048931 3300026078 Bacteria 3566
119 Ga0207674_10015034 3300026116 Bacteria 8525
120 Ga0207674_10085601 3300026116 Bacteria 3147
121 Ga0207674_10109423 3300026116 Bacteria 2739
122 Ga0207675_100524123 3300026118 Bacteria 1182
123 Ga0207683_10032120 3300026121 Bacteria 4559
124 Ga0268266_10146586 3300028379 Bacteria 2123
125 Ga0268264_10123819 3300028381 Bacteria 2282
126 Ga0265338_10002905 3300028800 Bacteria 24920
127 Ga0265338_10090364 3300028800 Bacteria 2534
128 Ga0265327_10022102 3300031251 Bacteria 3817
129 Ga0265313_10051261 3300031595 Bacteria 1975
130 Ga0307410_10266555 3300031852 Bacteria 1338
131 Ga0307409_100151139 3300031995 Bacteria 2016
132 Ga0307415_100096449 3300032126 Bacteria 2155
133 Ga0373943_0005060 3300035170 Bacteria 5947
134 Ga0373943_0005096 3300035170 Bacteria 5920
135 Ga0373946_0007761 3300035171 Bacteria 3936
136 Ga0373924_0053280 3300035410 Bacteria 1680
137 Ga0373935_0027746 3300035692 Bacteria 3499
138 Ga0373927_0105256 3300035695 Bacteria 1837
139 Ga0373947_0006173 3300035725 Bacteria 6969
140 Ga0373947_0035885 3300035725 Bacteria 2937
141 Ga0373925_0012171 3300037068 Bacteria 6228
142 Ga0373925_0055267 3300037068 Bacteria 2971
143 Ga0395899_0113346 3300037312 Bacteria 1947
144 Ga0395900_0020711 3300037418 Bacteria 6720
145 Ga0395900_0163220 3300037418 Unclassified 2271
146 Ga0395898_0008937 3300037466 Bacteria 10552
147 Ga0395898_0019264 3300037466 Bacteria 6947
148 Ga0395898_0079341 3300037466 Bacteria 3167
149 Ga0395898_0333229 3300037466 Bacteria 1447
150 Ga0395905_0026683 3300037471 Bacteria 5446
151 Ga0395905_0557174 3300037471 Bacteria 1047
152 Ga0395901_0006012 3300038443 Bacteria 12296
153 Ga0395901_0007996 3300038443 Bacteria 10675
154 Ga0395901_0076825 3300038443 Bacteria 3484
155 Ga0436365_0186427 3300039437 Unclassified 2722
156 Ga0436360_0460027 3300039438 Bacteria 1112
157 Ga0436363_1625980 3300039450 Unclassified 3936
158 Ga0436362_0204343 3300039453 Bacteria 2948
159 Ga0439448_0069663 3300042005 Bacteria 1171
160 Ga0439449_0008868 3300042007 Bacteria 3815
161 Ga0439457_051980 3300042014 Bacteria 921
162 Ga0466969_0001830 3300044656 Bacteria 11354
163 Ga0466965_0077806 3300044683 Bacteria 1675
164 Ga0466965_0091071 3300044683 Bacteria 1551
165 Ga0466961_0004711 3300044693 Bacteria 8580
166 Ga0466961_0024355 3300044693 Bacteria 3894
167 Ga0466961_0068952 3300044693 Bacteria 2245
168 Ga0466961_0248514 3300044693 Bacteria 1092
169 Ga0466963_0000298 3300044694 Bacteria 22349
170 Ga0466963_0000482 3300044694 Bacteria 18580
171 Ga0466963_0001696 3300044694 Bacteria 12006
172 Ga0466963_0002096 3300044694 Bacteria 11011
173 Ga0466963_0002956 3300044694 Bacteria 9603
174 Ga0466963_0004681 3300044694 Bacteria 7986
175 Ga0466963_0005909 3300044694 Bacteria 7205
176 Ga0466963_0010624 3300044694 Bacteria 5581
177 Ga0466963_0019384 3300044694 Bacteria 4265
178 Ga0466963_0019440 3300044694 Bacteria 4262
179 Ga0466963_0021423 3300044694 Bacteria 4077
180 Ga0466963_0115401 3300044694 Bacteria 1845
181 Ga0466963_0122171 3300044694 Bacteria 1793
182 Ga0466964_0002630 3300044706 Bacteria 6429
183 Ga0466964_0006206 3300044706 Bacteria 4454
184 Ga0466964_0007807 3300044706 Bacteria 4006
185 Ga0466964_0013650 3300044706 Bacteria 3082
186 Ga0466964_0037484 3300044706 Bacteria 1947
187 Ga0466964_0038505 3300044706 Bacteria 1923
188 Ga0466964_0060841 3300044706 Bacteria 1571
189 Ga0466964_0088992 3300044706 Bacteria 1340
190 Ga0466964_0109725 3300044706 Unclassified 1229
191 Ga0466971_0000127 3300044719 Bacteria 27731
192 Ga0466971_0001805 3300044719 Bacteria 9086
193 Ga0466971_0004784 3300044719 Bacteria 5858
194 Ga0466971_0014788 3300044719 Bacteria 3434
195 Ga0466971_0049191 3300044719 Bacteria 1897
196 Ga0466971_0169830 3300044719 Bacteria 1023
197 Ga0466968_0003400 3300044735 Bacteria 5884
198 Ga0466968_0039989 3300044735 Bacteria 1976
199 Ga0466957_0001239 3300044842 Bacteria 13301
200 Ga0466957_0011408 3300044842 Bacteria 5127
201 Ga0466957_0011744 3300044842 Bacteria 5061
202 Ga0466957_0012562 3300044842 Bacteria 4903
203 Ga0466957_0019526 3300044842 Bacteria 3986
204 Ga0466957_0047503 3300044842 Bacteria 2608
205 Ga0466957_0090021 3300044842 Bacteria 1921
206 Ga0466957_0166145 3300044842 Bacteria 1435
207 Ga0466960_0002382 3300044901 Bacteria 7074
208 Ga0466960_0122799 3300044901 Bacteria 1362
209 Ga0466959_0006797 3300045049 Bacteria 7970
210 Ga0466959_0007429 3300045049 Bacteria 7687
211 Ga0466959_0007831 3300045049 Bacteria 7520
212 Ga0466959_0028520 3300045049 Bacteria 4139
213 Ga0466958_0000596 3300045836 Bacteria 15416
214 Ga0466958_0005516 3300045836 Bacteria 6822
215 Ga0466958_0006575 3300045836 Bacteria 6336
216 Ga0466958_0009049 3300045836 Bacteria 5531
217 Ga0466958_0016619 3300045836 Bacteria 4240
218 Ga0466958_0036435 3300045836 Bacteria 2944
219 Ga0466958_0169242 3300045836 Bacteria 1383
220 Ga0466967_0001902 3300045976 Bacteria 12606
221 Ga0466967_0005334 3300045976 Bacteria 8883
222 Ga0466967_0010178 3300045976 Bacteria 7035
223 Ga0466967_0010364 3300045976 Bacteria 6986
224 Ga0466967_0011964 3300045976 Bacteria 6612
225 Ga0466967_0014265 3300045976 Bacteria 6181
226 Ga0466967_0014394 3300045976 Bacteria 6160
227 Ga0466967_0025981 3300045976 Bacteria 4840
228 Ga0466967_0029841 3300045976 Bacteria 4569
229 Ga0466967_0040198 3300045976 Bacteria 4025
230 Ga0466967_0046469 3300045976 Bacteria 3780
231 Ga0466967_0050206 3300045976 Bacteria 3652
232 Ga0466967_0055171 3300045976 Bacteria 3500
233 Ga0466967_0056992 3300045976 Bacteria 3447
234 Ga0466967_0110862 3300045976 Bacteria 2521
235 Ga0466967_0117759 3300045976 Bacteria 2449
236 Ga0466967_0265018 3300045976 Bacteria 1644
237 Ga0466967_0387710 3300045976 Unclassified 1357
238 Ga0466967_0422490 3300045976 Bacteria 1299
239 Ga0495592_0020993 3300046454 Bacteria 4966
240 Ga0495629_0038065 3300046459 Bacteria 3389
241 Ga0495629_0138177 3300046459 Bacteria 1696
242 Ga0495641_0008727 3300046461 Bacteria 6124
243 Ga0495641_0046725 3300046461 Bacteria 1990
244 Ga0495651_0112137 3300046462 Bacteria 2015
245 Ga0495653_0046272 3300046463 Bacteria 3370
246 Ga0495653_0112143 3300046463 Bacteria 1958
247 Ga0495653_0132624 3300046463 Bacteria 1761
248 Ga0495580_0000821 3300046472 Bacteria 26951
249 Ga0495580_0029469 3300046472 Bacteria 3983
250 Ga0495582_0015331 3300046473 Bacteria 4211
251 Ga0495582_0047791 3300046473 Bacteria 2357
252 Ga0495639_0007329 3300046475 Bacteria 4733
253 Ga0495662_0005156 3300046476 Bacteria 6549
254 Ga0495662_0112555 3300046476 Unclassified 1334
255 Ga0495664_0008329 3300046477 Bacteria 5781
256 Ga0495618_0032250 3300046514 Bacteria 3280
257 Ga0495618_0123550 3300046514 Bacteria 1657
258 Ga0495628_0079018 3300046516 Bacteria 2558
259 Ga0495630_0031211 3300046517 Bacteria 3966
260 Ga0495630_0140691 3300046517 Unclassified 1835
261 Ga0495666_0034110 3300046526 Bacteria 2483
262 Ga0495652_0027962 3300046529 Bacteria 4966
263 Ga0495665_0004800 3300046531 Bacteria 7298
264 Ga0495640_0006558 3300046533 Bacteria 9195
265 Ga0495587_0035244 3300046536 Bacteria 3015
266 Ga0495645_0006659 3300046543 Bacteria 8025
267 Ga0495667_0109813 3300046559 Bacteria 1782
268 Ga0495635_0019394 3300046663 Bacteria 4741
269 Ga0495588_0132165 3300046674 Bacteria 1317
270 Ga0495657_0161343 3300046675 Bacteria 1387
271 Ga0495657_0201268 3300046675 Bacteria 1214
272 Ga0495599_0001562 3300046678 Bacteria 13195
273 Ga0495646_0021753 3300046680 Bacteria 4051
274 Ga0495647_0000641 3300046681 Bacteria 10349
275 Ga0495658_0001923 3300046683 Bacteria 10610
276 Ga0495658_0002177 3300046683 Bacteria 9916
277 Ga0495613_0063336 3300046689 Bacteria 2705
278 Ga0495613_0074144 3300046689 Bacteria 2478
279 Ga0495624_0021914 3300046690 Bacteria 4231
280 Ga0495600_0139011 3300046809 Bacteria 1576
281 Ga0495600_0180841 3300046809 Unclassified 1359
282 Ga0495581_0012846 3300047315 Bacteria 4850
283 Ga0495674_0019054 3300047319 Bacteria 6379
284 Ga0495674_0088305 3300047319 Bacteria 2652
285 Ga0495676_0020421 3300047321 Bacteria 5811
286 Ga0495680_0018929 3300047322 Bacteria 5831
287 Ga0495680_0157589 3300047322 Unclassified 1651
288 Ga0495680_0216565 3300047322 Bacteria 1369
289 Ga0495684_0039041 3300047471 Bacteria 3639
290 Ga0495593_0002352 3300047673 Bacteria 11355
291 Ga0495602_0019146 3300048088 Bacteria 6808
292 Ga0495614_0002973 3300048089 Bacteria 7552
293 Ga0496100_0035915 3300048903 Bacteria 3121
294 Ga0496100_0045567 3300048903 Bacteria 2815
295 Ga0496100_0051790 3300048903 Bacteria 2666
296 Ga0496100_0118194 3300048903 Bacteria 1852
297 Ga0496101_0002626 3300048904 Bacteria 11044
298 Ga0496102_0007265 3300048905 Bacteria 9456
299 Ga0496102_0082958 3300048905 Bacteria 2957
300 Ga0496104_0205923 3300048907 Bacteria 1879
301 Ga0496104_0361614 3300048907 Bacteria 1364
302 Ga0496105_0001404 3300048908 Bacteria 16936
303 Ga0496105_0011602 3300048908 Bacteria 6970
304 Ga0496105_0023519 3300048908 Bacteria 4999
305 Ga0496105_0325001 3300048908 Bacteria 1232
306 Ga0496106_0001983 3300048909 Bacteria 15390
307 Ga0496106_0163781 3300048909 Bacteria 1759
308 Ga0496107_0011095 3300048910 Bacteria 6268
309 Ga0496108_0019982 3300048911 Bacteria 5503
310 Ga0496108_0062345 3300048911 Bacteria 3140
311 Ga0496109_0009778 3300048912 Bacteria 8188
312 Ga0496109_0034095 3300048912 Bacteria 4582
313 Ga0496109_0146105 3300048912 Bacteria 2212
314 Ga0496109_0157030 3300048912 Bacteria 2131
315 Ga0496109_0278515 3300048912 Unclassified 1576
316 Ga0496110_0010963 3300048913 Bacteria 7394
317 Ga0496110_0017774 3300048913 Bacteria 5950
318 Ga0496111_0051995 3300048914 Bacteria 2958
319 Ga0496112_0042477 3300048915 Bacteria 4448
320 Ga0496112_0151619 3300048915 Bacteria 2285
321 Ga0496113_0066521 3300048916 Bacteria 2730
322 Ga0496114_0001668 3300048917 Bacteria 16839
323 Ga0496114_0034764 3300048917 Bacteria 4160
324 Ga0496114_0301992 3300048917 Bacteria 1413
325 Ga0496114_0337417 3300048917 Bacteria 1332
326 Ga0496114_0402055 3300048917 Bacteria 1213
327 Ga0496115_0003827 3300048918 Bacteria 10844
328 Ga0496115_0144071 3300048918 Bacteria 1966
329 Ga0501031_0001461 3300049568 Bacteria 14667
330 Ga0501031_0279724 3300049568 Bacteria 1082
331 Ga0501032_0003077 3300049569 Bacteria 12878
332 Ga0501033_0002783 3300049570 Bacteria 14659
333 Ga0501033_0051429 3300049570 Bacteria 3054
334 Ga0501034_0049782 3300049571 Bacteria 4228
335 Ga0501036_0000178 3300049572 Bacteria 41797
336 Ga0501036_0062587 3300049572 Unclassified 3151
337 Ga0501037_0000798 3300049573 Bacteria 23662
338 Ga0501037_0018637 3300049573 Bacteria 5114
339 Ga0501038_0002900 3300049574 Bacteria 15987
340 Ga0501038_0015430 3300049574 Bacteria 6943
341 Ga0501038_0065810 3300049574 Bacteria 3088
342 Ga0501039_0000506 3300049575 Bacteria 28182
343 Ga0501040_0000075 3300049576 Bacteria 47781
344 Ga0501040_0094857 3300049576 Bacteria 2076
345 Ga0501040_0438265 3300049576 Bacteria 940
346 Ga0501041_0000017 3300049577 Bacteria 55768
347 Ga0501041_0213433 3300049577 Bacteria 1210
348 Ga0501041_0391215 3300049577 Bacteria 880
349 Ga0501042_0003724 3300049578 Bacteria 9629
350 Ga0501042_0024826 3300049578 Bacteria 4207
351 Ga0501042_0051370 3300049578 Bacteria 2940
352 Ga0501043_0000772 3300049579 Bacteria 28436
353 Ga0501043_0015649 3300049579 Bacteria 5945
354 Ga0501046_0000614 3300049580 Bacteria 35035
355 Ga0501046_0004887 3300049580 Bacteria 12075
356 Ga0501047_0000553 3300049581 Bacteria 40391
357 Ga0501047_0128955 3300049581 Bacteria 2410
358 Ga0501048_0002209 3300049582 Bacteria 14814
359 Ga0501048_0006363 3300049582 Bacteria 8976
360 Ga0501048_0249745 3300049582 Bacteria 1259
361 Ga0501067_0003878 3300049583 Bacteria 8253
362 Ga0501067_0013356 3300049583 Bacteria 4548
363 Ga0501067_0018188 3300049583 Bacteria 3893
364 Ga0501067_0023142 3300049583 Bacteria 3442
365 Ga0501067_0145294 3300049583 Bacteria 1321
366 Ga0501067_0153897 3300049583 Bacteria 1281
367 Ga0501068_0000348 3300049584 Bacteria 23216
368 Ga0501068_0009826 3300049584 Bacteria 5358
369 Ga0501069_0000275 3300049585 Bacteria 23345
370 Ga0501069_0012609 3300049585 Bacteria 4495
371 Ga0501069_0025138 3300049585 Bacteria 3253
372 Ga0501070_0003806 3300049586 Bacteria 13025
373 Ga0501071_0000077 3300049587 Bacteria 35035
374 Ga0501071_0067254 3300049587 Bacteria 2605
375 Ga0501071_0157883 3300049587 Bacteria 1694
376 Ga0501072_0000930 3300049588 Bacteria 21555
377 Ga0501072_0151247 3300049588 Unclassified 1850
378 Ga0501072_0280192 3300049588 Bacteria 1326
379 Ga0501073_0040987 3300049589 Bacteria 3273
380 Ga0501074_0000068 3300049590 Bacteria 49549
381 Ga0501074_0008589 3300049590 Bacteria 7396
382 Ga0501075_0000033 3300049591 Bacteria 55705
383 Ga0501075_0014922 3300049591 Bacteria 5572
384 Ga0501075_0059448 3300049591 Bacteria 2879
385 Ga0501076_0000081 3300049592 Bacteria 49598
386 Ga0501076_0017047 3300049592 Bacteria 5515
387 Ga0501076_0099269 3300049592 Bacteria 2345
388 Ga0501077_0003920 3300049593 Bacteria 8963
389 Ga0501077_0008081 3300049593 Bacteria 6501
390 Ga0501208_016429 3300049655 Bacteria 1151
391 Ga0501079_0000294 3300049741 Bacteria 30839
392 Ga0501079_0010329 3300049741 Bacteria 7093
393 Ga0501079_0110720 3300049741 Unclassified 2133
394 Ga0501079_0167399 3300049741 Bacteria 1714
395 Ga0501080_0001270 3300049742 Bacteria 20981
396 Ga0501080_0035359 3300049742 Bacteria 4662
397 Ga0501080_0671981 3300049742 Bacteria 915
398 Ga0501081_0012072 3300049743 Bacteria 5661
399 Ga0501081_0043607 3300049743 Unclassified 3077
400 Ga0501083_0000863 3300049744 Bacteria 19992
401 Ga0501083_0008286 3300049744 Bacteria 7350
402 Ga0501035_0001112 3300049822 Bacteria 28156
403 Ga0501035_0029473 3300049822 Bacteria 5004
404 Ga0501044_0003077 3300049823 Bacteria 18881
405 Ga0501044_0031503 3300049823 Bacteria 5581
406 Ga0501045_0000172 3300049824 Bacteria 35365
407 Ga0501045_0050673 3300049824 Unclassified 3029
408 Ga0501045_0159022 3300049824 Bacteria 1681
409 nmdc:mga05p37_213654_c1 3300050507 Bacteria 2331
410 nmdc:mga0qj67_5555_c1 3300050509 Bacteria 9220
411 nmdc:mga06r32_44366_c1 3300050510 Bacteria 4234
412 nmdc:mga08y16_161870_c1 3300050511 Bacteria 2325
413 nmdc:mga0n895_2495_c1 3300050512 Bacteria 14390
414 nmdc:mga0n895_45104_c1 3300050512 Bacteria 4301
415 nmdc:mga0rr50_93074_c1 3300050513 Bacteria 2351
416 nmdc:mga0a205_11294_c1 3300050515 Bacteria 8223
417 Ga0495601_0003266 3300053077 Bacteria 9266
418 Ga0495601_0024240 3300053077 Bacteria 3736
419 Ga0495612_0002818 3300053078 Bacteria 7190
420 Ga0495595_0003142 3300053084 Bacteria 6548
421 Ga0495595_0032500 3300053084 Bacteria 2350
422 Ga0495619_0013606 3300053085 Bacteria 5127
423 Ga0495619_0018970 3300053085 Bacteria 4369
424 Ga0500566_0081239 3300053094 Bacteria 1803
425 Ga0501084_0000261 3300054114 Bacteria 39815
426 Ga0501084_0038336 3300054114 Bacteria 4006
427 Ga0501082_0000122 3300060353 Bacteria 62357
428 Ga0501082_0037251 3300060353 Bacteria 4191
429 Ga0501082_0185046 3300060353 Bacteria 1812
430 Ga0466962_0000661 3300061719 Bacteria 15283
431 Ga0466962_0004047 3300061719 Bacteria 7016
432 Ga0466962_0007279 3300061719 Bacteria 5305
433 Ga0466962_0167043 3300061719 Bacteria 1071
434 Ga0530510_0003974 3300061734 Bacteria 10203
435 Ga0530510_0039066 3300061734 Bacteria 3426
436 Ga0530510_0145554 3300061734 Bacteria 1748
437 Ga0530510_0259892 3300061734 Bacteria 1294
438 2865000176 2864997549 Bacteria 5139696
439 2865003761 2865002811 Bacteria 6333767
440 2889296250 2889295896 Bacteria 4704906
441 2981287994 2981284811 Bacteria 4641497
442 2981292292 2981289755 Bacteria 4641509
443 2981983613 2981980479 Bacteria 4641628
444 2981988350 2981985349 Bacteria 4641497
445 8057978789 8057977335 Bacteria 5694872
446 Ga0070683_100032264
447 Ga0070658_10158455
448 Ga0070683_100044702
449 Ga0070683_100227063
450 Ga0068869_100192511
451 Ga0070680_100024634
452 Ga0070682_100028605
453 Ga0070689_100074479
454 Ga0070687_100011807
455 Ga0070661_100048518
456 Ga0070692_10033233
457 Ga0070671_100147996
458 Ga0070674_100493068
459 Ga0070688_100011297
460 Ga0070659_100051752
461 Ga0070659_100314451
462 Ga0070709_10121555
463 Ga0070714_100005702
464 Ga0070714_100161330
465 Ga0070705_100010187
466 Ga0070700_100047122
467 Ga0070708_100231831
468 Ga0070681_10002282
469 Ga0070681_10076604
470 Ga0070681_10077887
471 Ga0070706_100177758
472 Ga0070707_100000967
473 Ga0070707_100271894
474 Ga0070679_100012378
475 Ga0070679_100038745
476 Ga0070679_100135434
477 Ga0070684_100047730
478 Ga0070684_100060371
479 Ga0068853_100026258
480 Ga0068853_100280877
481 Ga0070693_100050808
482 Ga0068855_100019894
483 Ga0068855_100383160
484 Ga0070702_100030705
485 Ga0068852_100069171
486 Ga0068863_100072418
487 Ga0081455_10009468
488 Ga0070717_10028071
489 Ga0070712_100016277
490 Ga0068871_100097613
491 Ga0075430_100004529
492 Ga0075430_100075327
493 Ga0075431_100401545
494 Ga0075433_10031533
495 Ga0111539_10441614
496 Ga0105245_10041478
497 Ga0105247_10061295
498 Ga0114129_10100209
499 Ga0105243_10065997
500 Ga0105242_10043640
501 Ga0105248_10463768
502 Ga0105237_10029558
503 Ga0105237_10040322
504 Ga0105237_10239531
505 Ga0105238_10041627
506 Ga0105238_10099365
507 Ga0105249_10444752
508 Ga0105246_10215296
509 Ga0157373_10057156
510 Ga0157369_10092016
511 Ga0157374_10138246
512 Ga0157378_10210033
513 Ga0157372_10011742
514 Ga0157372_10231893
515 Ga0157375_10026281
516 Ga0157375_10421472
517 Ga0157379_10165188
518 Ga0157376_10035395
519 Ga0157376_10170132
520 Ga0206356_10541719
521 Ga0213873_10020766
522 Ga0213876_10006708
523 Ga0207642_10109786
524 Ga0207685_10041806
525 Ga0207705_10044491
526 Ga0207705_10071033
527 Ga0207684_10152711
528 Ga0207707_10041335
529 Ga0207707_10309773
530 Ga0207707_10410663
531 Ga0207671_10331823
532 Ga0207693_10019178
533 Ga0207693_10042318
534 Ga0207660_10035014
535 Ga0207660_10158002
536 Ga0207660_10220984
537 Ga0207662_10045143
538 Ga0207657_10003378
539 Ga0207657_10005580
540 Ga0207657_10052056
541 Ga0207657_10179474
542 Ga0207652_10112451
543 Ga0207652_10122850
544 Ga0207652_10443780
545 Ga0207646_10000523
546 Ga0207694_10092187
547 Ga0207687_10165122
548 Ga0207700_10046990
549 Ga0207690_10264469
550 Ga0207670_10201873
551 Ga0207711_10084966
552 Ga0207689_10201434
553 Ga0207661_10037390
554 Ga0207661_10355004
555 Ga0207667_10055017
556 Ga0207667_10071067
557 Ga0207667_10128935
558 Ga0207712_10154947
559 Ga0207640_10332736
560 Ga0207639_10142391
561 Ga0207678_10122734
562 Ga0207708_10013328
563 Ga0207702_10048931
564 Ga0207674_10015034
565 Ga0207674_10085601
566 Ga0207674_10109423
567 Ga0207675_100524123
568 Ga0207683_10032120
569 Ga0268266_10146586
570 Ga0268264_10123819
571 Ga0265338_10002905
572 Ga0265338_10090364
573 Ga0265327_10022102
574 Ga0265313_10051261
575 Ga0307410_10266555
576 Ga0307409_100151139
577 Ga0307415_100096449
578 Ga0373943_0005060
579 Ga0373943_0005096
580 Ga0373946_0007761
581 Ga0373924_0053280
582 Ga0373935_0027746
583 Ga0373927_0105256
584 Ga0373947_0006173
585 Ga0373947_0035885
586 Ga0373925_0012171
587 Ga0373925_0055267
588 Ga0395899_0113346
589 Ga0395900_0020711
590 Ga0395900_0163220
591 Ga0395898_0008937
592 Ga0395898_0019264
593 Ga0395898_0079341
594 Ga0395898_0333229
595 Ga0395905_0026683
596 Ga0395905_0557174
597 Ga0395901_0006012
598 Ga0395901_0007996
599 Ga0395901_0076825
600 Ga0436365_0186427
601 Ga0436360_0460027
602 Ga0436363_1625980
603 Ga0436362_0204343
604 Ga0439448_0069663
605 Ga0439449_0008868
606 Ga0439457_051980
607 Ga0466969_0001830
608 Ga0466965_0077806
609 Ga0466965_0091071
610 Ga0466961_0004711
611 Ga0466961_0024355
612 Ga0466961_0068952
613 Ga0466961_0248514
614 Ga0466963_0000298
615 Ga0466963_0000482
616 Ga0466963_0001696
617 Ga0466963_0002096
618 Ga0466963_0002956
619 Ga0466963_0004681
620 Ga0466963_0005909
621 Ga0466963_0010624
622 Ga0466963_0019384
623 Ga0466963_0019440
624 Ga0466963_0021423
625 Ga0466963_0115401
626 Ga0466963_0122171
627 Ga0466964_0002630
628 Ga0466964_0006206
629 Ga0466964_0007807
630 Ga0466964_0013650
631 Ga0466964_0037484
632 Ga0466964_0038505
633 Ga0466964_0060841
634 Ga0466964_0088992
635 Ga0466964_0109725
636 Ga0466971_0000127
637 Ga0466971_0001805
638 Ga0466971_0004784
639 Ga0466971_0014788
640 Ga0466971_0049191
641 Ga0466971_0169830
642 Ga0466968_0003400
643 Ga0466968_0039989
644 Ga0466957_0001239
645 Ga0466957_0011408
646 Ga0466957_0011744
647 Ga0466957_0012562
648 Ga0466957_0019526
649 Ga0466957_0047503
650 Ga0466957_0090021
651 Ga0466957_0166145
652 Ga0466960_0002382
653 Ga0466960_0122799
654 Ga0466959_0006797
655 Ga0466959_0007429
656 Ga0466959_0007831
657 Ga0466959_0028520
658 Ga0466958_0000596
659 Ga0466958_0005516
660 Ga0466958_0006575
661 Ga0466958_0009049
662 Ga0466958_0016619
663 Ga0466958_0036435
664 Ga0466958_0169242
665 Ga0466967_0001902
666 Ga0466967_0005334
667 Ga0466967_0010178
668 Ga0466967_0010364
669 Ga0466967_0011964
670 Ga0466967_0014265
671 Ga0466967_0014394
672 Ga0466967_0025981
673 Ga0466967_0029841
674 Ga0466967_0040198
675 Ga0466967_0046469
676 Ga0466967_0050206
677 Ga0466967_0055171
678 Ga0466967_0056992
679 Ga0466967_0110862
680 Ga0466967_0117759
681 Ga0466967_0265018
682 Ga0466967_0387710
683 Ga0466967_0422490
684 Ga0495592_0020993
685 Ga0495629_0038065
686 Ga0495629_0138177
687 Ga0495641_0008727
688 Ga0495641_0046725
689 Ga0495651_0112137
690 Ga0495653_0046272
691 Ga0495653_0112143
692 Ga0495653_0132624
693 Ga0495580_0000821
694 Ga0495580_0029469
695 Ga0495582_0015331
696 Ga0495582_0047791
697 Ga0495639_0007329
698 Ga0495662_0005156
699 Ga0495662_0112555
700 Ga0495664_0008329
701 Ga0495618_0032250
702 Ga0495618_0123550
703 Ga0495628_0079018
704 Ga0495630_0031211
705 Ga0495630_0140691
706 Ga0495666_0034110
707 Ga0495652_0027962
708 Ga0495665_0004800
709 Ga0495640_0006558
710 Ga0495587_0035244
711 Ga0495645_0006659
712 Ga0495667_0109813
713 Ga0495635_0019394
714 Ga0495588_0132165
715 Ga0495657_0161343
716 Ga0495657_0201268
717 Ga0495599_0001562
718 Ga0495646_0021753
719 Ga0495647_0000641
720 Ga0495658_0001923
721 Ga0495658_0002177
722 Ga0495613_0063336
723 Ga0495613_0074144
724 Ga0495624_0021914
725 Ga0495600_0139011
726 Ga0495600_0180841
727 Ga0495581_0012846
728 Ga0495674_0019054
729 Ga0495674_0088305
730 Ga0495676_0020421
731 Ga0495680_0018929
732 Ga0495680_0157589
733 Ga0495680_0216565
734 Ga0495684_0039041
735 Ga0495593_0002352
736 Ga0495602_0019146
737 Ga0495614_0002973
738 Ga0496100_0035915
739 Ga0496100_0045567
740 Ga0496100_0051790
741 Ga0496100_0118194
742 Ga0496101_0002626
743 Ga0496102_0007265
744 Ga0496102_0082958
745 Ga0496104_0205923
746 Ga0496104_0361614
747 Ga0496105_0001404
748 Ga0496105_0011602
749 Ga0496105_0023519
750 Ga0496105_0325001
751 Ga0496106_0001983
752 Ga0496106_0163781
753 Ga0496107_0011095
754 Ga0496108_0019982
755 Ga0496108_0062345
756 Ga0496109_0009778
757 Ga0496109_0034095
758 Ga0496109_0146105
759 Ga0496109_0157030
760 Ga0496109_0278515
761 Ga0496110_0010963
762 Ga0496110_0017774
763 Ga0496111_0051995
764 Ga0496112_0042477
765 Ga0496112_0151619
766 Ga0496113_0066521
767 Ga0496114_0001668
768 Ga0496114_0034764
769 Ga0496114_0301992
770 Ga0496114_0337417
771 Ga0496114_0402055
772 Ga0496115_0003827
773 Ga0496115_0144071
774 Ga0501031_0001461
775 Ga0501031_0279724
776 Ga0501032_0003077
777 Ga0501033_0002783
778 Ga0501033_0051429
779 Ga0501034_0049782
780 Ga0501036_0000178
781 Ga0501036_0062587
782 Ga0501037_0000798
783 Ga0501037_0018637
784 Ga0501038_0002900
785 Ga0501038_0015430
786 Ga0501038_0065810
787 Ga0501039_0000506
788 Ga0501040_0000075
789 Ga0501040_0094857
790 Ga0501040_0438265
791 Ga0501041_0000017
792 Ga0501041_0213433
793 Ga0501041_0391215
794 Ga0501042_0003724
795 Ga0501042_0024826
796 Ga0501042_0051370
797 Ga0501043_0000772
798 Ga0501043_0015649
799 Ga0501046_0000614
800 Ga0501046_0004887
801 Ga0501047_0000553
802 Ga0501047_0128955
803 Ga0501048_0002209
804 Ga0501048_0006363
805 Ga0501048_0249745
806 Ga0501067_0003878
807 Ga0501067_0013356
808 Ga0501067_0018188
809 Ga0501067_0023142
810 Ga0501067_0145294
811 Ga0501067_0153897
812 Ga0501068_0000348
813 Ga0501068_0009826
814 Ga0501069_0000275
815 Ga0501069_0012609
816 Ga0501069_0025138
817 Ga0501070_0003806
818 Ga0501071_0000077
819 Ga0501071_0067254
820 Ga0501071_0157883
821 Ga0501072_0000930
822 Ga0501072_0151247
823 Ga0501072_0280192
824 Ga0501073_0040987
825 Ga0501074_0000068
826 Ga0501074_0008589
827 Ga0501075_0000033
828 Ga0501075_0014922
829 Ga0501075_0059448
830 Ga0501076_0000081
831 Ga0501076_0017047
832 Ga0501076_0099269
833 Ga0501077_0003920
834 Ga0501077_0008081
835 Ga0501208_016429
836 Ga0501079_0000294
837 Ga0501079_0010329
838 Ga0501079_0110720
839 Ga0501079_0167399
840 Ga0501080_0001270
841 Ga0501080_0035359
842 Ga0501080_0671981
843 Ga0501081_0012072
844 Ga0501081_0043607
845 Ga0501083_0000863
846 Ga0501083_0008286
847 Ga0501035_0001112
848 Ga0501035_0029473
849 Ga0501044_0003077
850 Ga0501044_0031503
851 Ga0501045_0000172
852 Ga0501045_0050673
853 Ga0501045_0159022
854 nmdc:mga05p37_213654_c1
855 nmdc:mga0qj67_5555_c1
856 nmdc:mga06r32_44366_c1
857 nmdc:mga08y16_161870_c1
858 nmdc:mga0n895_2495_c1
859 nmdc:mga0n895_45104_c1
860 nmdc:mga0rr50_93074_c1
861 nmdc:mga0a205_11294_c1
862 Ga0495601_0003266
863 Ga0495601_0024240
864 Ga0495612_0002818
865 Ga0495595_0003142
866 Ga0495595_0032500
867 Ga0495619_0013606
868 Ga0495619_0018970
869 Ga0500566_0081239
870 Ga0501084_0000261
871 Ga0501084_0038336
872 Ga0501082_0000122
873 Ga0501082_0037251
874 Ga0501082_0185046
875 Ga0466962_0000661
876 Ga0466962_0004047
877 Ga0466962_0007279
878 Ga0466962_0167043
879 Ga0530510_0003974
880 Ga0530510_0039066
881 Ga0530510_0145554
882 Ga0530510_0259892
883 2865000176
884 2865003761
885 2889296250
886 2981287994
887 2981292292
888 2981983613
889 2981988350
890 8057978789

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01619

Pro_dh

Proline dehydrogenase

67

324

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5m42-assembly1.cif.gz_A structure of thermus thermophilus l-proline dehydrogenase lacking alpha helices a, b and c 0.975 47 283
4h6r-assembly1.cif.gz_A structure of reduced deinococcus radiodurans proline dehydrogenase 0.9611 36 298
2ekg-assembly1.cif.gz_B structure of thermus thermophilus proline dehydrogenase inactivated by n-propargylglycine 0.9578 10 297
5m42-assembly1.cif.gz_A structure of thermus thermophilus l-proline dehydrogenase lacking alpha helices a, b and c 0.9513 47 283
2g37-assembly1.cif.gz_A structure of thermus thermophilus l-proline dehydrogenase 0.9506 13 298
ID Description Score Start End Superfamily
2ekgB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9697 45 283 3.20.20.220
af_Q2FXG3_20_304_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9616 31 309 3.20.20.220
4h6rA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9611 36 298 3.20.20.220
2ekgB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9541 45 283 3.20.20.220
af_Q2FXG3_20_304_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9385 31 309 3.20.20.220
ID Description Score Start End GO Terms
AF-A0A1F2XUP0-F1-model_v4 proline dehydrogenase (EC 1.5.5.2) 0.9873 39 305 GO:0000166
GO:0004657
GO:0010133
AF-C2PMD1-F1-model_v4 deleted 0.9809 178 311
AF-A0A223D6M5-F1-model_v4 proline dehydrogenase (EC 1.5.5.2) 0.9791 39 311 GO:0000166
GO:0004657
GO:0010133
AF-A0A4R5KXX6-F1-model_v4 proline dehydrogenase (EC 1.5.5.2) 0.9787 39 311 GO:0000166
GO:0004657
GO:0010133
AF-A0A0D5NSA9-F1-model_v4 proline dehydrogenase (EC 1.5.5.2) 0.978 15 311 GO:0000166
GO:0004657
GO:0010133

Map