F445351

General Info

Members Datasets Scaffolds Average Seq Length
444 240 888 197

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0027851|Ga0496115_0027851_3475_4032
Length 185
Sequence MAAHEVTFPITDPAEILKLRAGDEVTVQGHIIGIRDRTQIRIFDQGVEPPMDLSGAFLLHTAPNVRKLGPGRYEKICIGTTTSARMVRFTEPLGEQYGVRAICGKGGFPDEAIEPIVGGAAALETTQIEEIEEVAWEELMPECLWKFRVKDFGPLTVGIDAHGNSLYHDVQAEAQKRLETIFARL

Samples

Sample ID Description Type Environment
1 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
56 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
98 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
101 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
113 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
114 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
115 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
131 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
132 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
133 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
134 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
135 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
136 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
137 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
138 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
139 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
140 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
141 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
142 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
150 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
155 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
158 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
164 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
165 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
168 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
172 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
178 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
179 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
180 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
188 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
218 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
219 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
236 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
237 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
240 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 10.14
Rhizosphere 89.19
Stem 0
Stem Tuber 0
Unclassified 18.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496115_0027851 3300048918 Bacteria 4424
2 Ga0070683_100003808 3300005329 Bacteria 12323
3 Ga0070683_100504603 3300005329 Bacteria 1156
4 Ga0070683_100699664 3300005329 Bacteria 971
5 Ga0070670_100231831 3300005331 Bacteria 1607
6 Ga0070670_101246949 3300005331 Unclassified 680
7 Ga0070666_10221415 3300005335 Unclassified 1335
8 Ga0070680_100022365 3300005336 Bacteria 5036
9 Ga0070680_100993625 3300005336 Unclassified 725
10 Ga0070682_100019609 3300005337 Bacteria 3969
11 Ga0068868_100037957 3300005338 Bacteria 3737
12 Ga0070660_100005099 3300005339 Bacteria 9074
13 Ga0070660_100076465 3300005339 Bacteria 2622
14 Ga0070675_100376739 3300005354 Bacteria 1262
15 Ga0070673_100074615 3300005364 Unclassified 2734
16 Ga0070667_100575827 3300005367 Unclassified 1036
17 Ga0070709_10947196 3300005434 Unclassified 683
18 Ga0070714_100573811 3300005435 Bacteria 1082
19 Ga0070714_100610779 3300005435 Bacteria 1048
20 Ga0070708_100269510 3300005445 Bacteria 1601
21 Ga0070708_101102533 3300005445 Unclassified 743
22 Ga0070678_100244250 3300005456 Bacteria 1502
23 Ga0070681_10089581 3300005458 Bacteria 3028
24 Ga0070681_10107747 3300005458 Bacteria 2727
25 Ga0068867_100418360 3300005459 Bacteria 1135
26 Ga0070706_100264884 3300005467 Unclassified 1604
27 Ga0070707_100643800 3300005468 Bacteria 1022
28 Ga0070698_100489640 3300005471 Bacteria 1167
29 Ga0070679_100000265 3300005530 Bacteria 43944
30 Ga0070679_100035729 3300005530 Bacteria 4929
31 Ga0070679_100173410 3300005530 Bacteria 2129
32 Ga0070684_100005351 3300005535 Bacteria 9837
33 Ga0070684_100072697 3300005535 Bacteria 3028
34 Ga0070684_100453896 3300005535 Bacteria 1185
35 Ga0070684_100812079 3300005535 Bacteria 875
36 Ga0068853_100251664 3300005539 Bacteria 1621
37 Ga0070672_100536491 3300005543 Bacteria 1015
38 Ga0070696_100238985 3300005546 Unclassified 1369
39 Ga0070665_100758936 3300005548 Bacteria 983
40 Ga0070704_100085253 3300005549 Unclassified 2337
41 Ga0070704_100351416 3300005549 Bacteria 1245
42 Ga0068855_100082017 3300005563 Bacteria 3738
43 Ga0068855_100155459 3300005563 Bacteria 2598
44 Ga0068855_100233979 3300005563 Bacteria 2055
45 Ga0070664_100745592 3300005564 Unclassified 914
46 Ga0068854_100158174 3300005578 Bacteria 1753
47 Ga0068856_100055835 3300005614 Bacteria 3897
48 Ga0068856_100259571 3300005614 Bacteria 1753
49 Ga0068852_100519769 3300005616 Bacteria 1188
50 Ga0068866_10132065 3300005718 Unclassified 1421
51 Ga0068862_100575736 3300005844 Unclassified 1078
52 Ga0070717_10224588 3300006028 Unclassified 1652
53 Ga0070717_10336672 3300006028 Unclassified 1347
54 Ga0070715_10186647 3300006163 Bacteria 1044
55 Ga0097621_100134894 3300006237 Bacteria 2105
56 Ga0097621_101141652 3300006237 Bacteria 733
57 Ga0068871_100724331 3300006358 Bacteria 913
58 Ga0075431_100371195 3300006847 Bacteria 1436
59 Ga0075433_10125578 3300006852 Unclassified 2278
60 Ga0075434_100038374 3300006871 Bacteria 4744
61 Ga0075434_100116846 3300006871 Bacteria 2681
62 Ga0075434_100707804 3300006871 Unclassified 1024
63 Ga0068865_100981683 3300006881 Bacteria 739
64 Ga0075436_100071107 3300006914 Bacteria 2406
65 Ga0075436_100242203 3300006914 Bacteria 1283
66 Ga0075435_100047701 3300007076 Bacteria 3440
67 Ga0075435_100078730 3300007076 Bacteria 2703
68 Ga0105240_10045039 3300009093 Bacteria 5600
69 Ga0105240_10482735 3300009093 Unclassified 1381
70 Ga0105245_10012398 3300009098 Bacteria 7417
71 Ga0114129_10057122 3300009147 Bacteria 5464
72 Ga0105241_10430074 3300009174 Bacteria 1164
73 Ga0105242_10618515 3300009176 Unclassified 1049
74 Ga0105248_10882272 3300009177 Bacteria 1010
75 Ga0105248_11063243 3300009177 Bacteria 914
76 Ga0105237_10163129 3300009545 Bacteria 2227
77 Ga0105238_10397432 3300009551 Bacteria 1371
78 Ga0105238_10794260 3300009551 Bacteria 962
79 Ga0105238_11233081 3300009551 Bacteria 773
80 Ga0105249_10974327 3300009553 Unclassified 916
81 Ga0105239_10160865 3300010375 Bacteria 2508
82 Ga0157321_1001381 3300012487 Unclassified 1225
83 Ga0157313_1010972 3300012503 Unclassified 779
84 Ga0157370_10011003 3300013104 Bacteria 9489
85 Ga0157370_10082157 3300013104 Bacteria 3031
86 Ga0157370_11039802 3300013104 Unclassified 741
87 Ga0157369_10017645 3300013105 Bacteria 8020
88 Ga0157369_10052947 3300013105 Bacteria 4389
89 Ga0157369_10574469 3300013105 Bacteria 1164
90 Ga0157369_11552431 3300013105 Bacteria 673
91 Ga0163162_10124844 3300013306 Bacteria 2679
92 Ga0163162_11045539 3300013306 Bacteria 924
93 Ga0157372_10196802 3300013307 Bacteria 2334
94 Ga0157372_10382051 3300013307 Unclassified 1641
95 Ga0157376_10091146 3300014969 Bacteria 2640
96 Ga0206356_11817099 3300020070 Unclassified 1161
97 Ga0207682_10122461 3300025893 Unclassified 1155
98 Ga0207682_10269757 3300025893 Unclassified 794
99 Ga0207699_10133837 3300025906 Unclassified 1621
100 Ga0207684_10069519 3300025910 Bacteria 2992
101 Ga0207684_10780212 3300025910 Unclassified 809
102 Ga0207707_10016321 3300025912 Bacteria 6477
103 Ga0207707_10048000 3300025912 Bacteria 3719
104 Ga0207707_10263685 3300025912 Bacteria 1494
105 Ga0207707_10482587 3300025912 Unclassified 1059
106 Ga0207695_10026836 3300025913 Bacteria 6422
107 Ga0207695_10034493 3300025913 Bacteria 5502
108 Ga0207671_10339002 3300025914 Bacteria 1191
109 Ga0207693_10395953 3300025915 Bacteria 1080
110 Ga0207660_10017078 3300025917 Bacteria 4815
111 Ga0207660_10133190 3300025917 Bacteria 1894
112 Ga0207660_10265320 3300025917 Bacteria 1359
113 Ga0207657_10022771 3300025919 Bacteria 5851
114 Ga0207657_10076915 3300025919 Bacteria 2814
115 Ga0207657_10349360 3300025919 Unclassified 1166
116 Ga0207649_10085872 3300025920 Bacteria 2049
117 Ga0207652_10000547 3300025921 Bacteria 38079
118 Ga0207652_10018363 3300025921 Bacteria 5735
119 Ga0207652_10195170 3300025921 Bacteria 1821
120 Ga0207652_10403250 3300025921 Unclassified 1234
121 Ga0207694_10414135 3300025924 Bacteria 1122
122 Ga0207650_10285594 3300025925 Bacteria 1344
123 Ga0207659_10540414 3300025926 Bacteria 990
124 Ga0207687_10455465 3300025927 Unclassified 1062
125 Ga0207687_10618194 3300025927 Bacteria 914
126 Ga0207700_10548936 3300025928 Bacteria 1026
127 Ga0207664_10573742 3300025929 Bacteria 1013
128 Ga0207644_10658749 3300025931 Bacteria 872
129 Ga0207644_10893417 3300025931 Bacteria 744
130 Ga0207669_10019364 3300025937 Bacteria 3542
131 Ga0207704_10537762 3300025938 Bacteria 948
132 Ga0207691_10149580 3300025940 Bacteria 2053
133 Ga0207691_10436963 3300025940 Bacteria 1114
134 Ga0207691_10707623 3300025940 Unclassified 849
135 Ga0207711_10606017 3300025941 Bacteria 1022
136 Ga0207689_10263665 3300025942 Bacteria 1426
137 Ga0207661_10021952 3300025944 Bacteria 4794
138 Ga0207661_10484876 3300025944 Unclassified 1129
139 Ga0207661_11313650 3300025944 Bacteria 664
140 Ga0207667_10058434 3300025949 Archaea 4045
141 Ga0207667_10260368 3300025949 Bacteria 1774
142 Ga0207640_10740703 3300025981 Bacteria 846
143 Ga0207677_10339140 3300026023 Bacteria 1255
144 Ga0207639_10689033 3300026041 Bacteria 947
145 Ga0207702_10660587 3300026078 Bacteria 1028
146 Ga0207641_10225507 3300026088 Unclassified 1740
147 Ga0207648_10835767 3300026089 Bacteria 858
148 Ga0207683_10019608 3300026121 Bacteria 5778
149 Ga0207683_10276577 3300026121 Unclassified 1534
150 Ga0207683_10425730 3300026121 Bacteria 1223
151 Ga0207698_10840114 3300026142 Unclassified 923
152 Ga0268266_10283339 3300028379 Bacteria 1542
153 Ga0268266_10602844 3300028379 Bacteria 1055
154 Ga0265319_1001078 3300028563 Bacteria 16951
155 Ga0265318_10000760 3300028577 Bacteria 21502
156 Ga0265318_10012118 3300028577 Bacteria 3681
157 Ga0265318_10099042 3300028577 Bacteria 1073
158 Ga0265338_10006443 3300028800 Bacteria 14962
159 Ga0265338_10022333 3300028800 Bacteria 6553
160 Ga0265329_10007808 3300031242 Bacteria 4106
161 Ga0265340_10124981 3300031247 Bacteria 1182
162 Ga0265316_10007718 3300031344 Bacteria 10084
163 Ga0307408_100271036 3300031548 Bacteria 1409
164 Ga0265314_10044418 3300031711 Bacteria 3150
165 Ga0307405_10260441 3300031731 Bacteria 1295
166 Ga0307405_10298252 3300031731 Bacteria 1221
167 Ga0307410_10481194 3300031852 Unclassified 1018
168 Ga0307406_10544185 3300031901 Bacteria 949
169 Ga0307409_100387764 3300031995 Unclassified 1330
170 Ga0307416_101212357 3300032002 Unclassified 860
171 Ga0307414_10764812 3300032004 Unclassified 879
172 Ga0307415_100000283 3300032126 Bacteria 21941
173 Ga0373926_0140206 3300035083 Bacteria 918
174 Ga0373944_0033568 3300035089 Bacteria 1555
175 Ga0373944_0089860 3300035089 Unclassified 1025
176 Ga0373939_0206444 3300035114 Bacteria 746
177 Ga0373945_0008033 3300035116 Bacteria 3427
178 Ga0373945_0073708 3300035116 Unclassified 1297
179 Ga0373943_0007529 3300035170 Bacteria 4890
180 Ga0373943_0015127 3300035170 Bacteria 3502
181 Ga0373943_0090203 3300035170 Bacteria 1586
182 Ga0373943_0290917 3300035170 Unclassified 926
183 Ga0373943_0407384 3300035170 Bacteria 786
184 Ga0373946_0006247 3300035171 Bacteria 4316
185 Ga0373955_0051576 3300035172 Bacteria 2241
186 Ga0373955_0054575 3300035172 Bacteria 2186
187 Ga0373955_0410020 3300035172 Bacteria 824
188 Ga0373935_0008364 3300035692 Bacteria 6191
189 Ga0373927_0132886 3300035695 Bacteria 1626
190 Ga0373927_0156239 3300035695 Bacteria 1494
191 Ga0373933_0061911 3300035724 Bacteria 2259
192 Ga0373947_0002827 3300035725 Bacteria 10358
193 Ga0373947_0009884 3300035725 Bacteria 5478
194 Ga0373947_0034925 3300035725 Bacteria 2975
195 Ga0373947_0279945 3300035725 Unclassified 1109
196 Ga0373937_0024762 3300036401 Bacteria 5417
197 Ga0373937_0055764 3300036401 Bacteria 3628
198 Ga0373925_0001342 3300037068 Bacteria 21503
199 Ga0373925_0461867 3300037068 Bacteria 1040
200 Ga0395899_0030508 3300037312 Bacteria 4054
201 Ga0395899_0253951 3300037312 Bacteria 1205
202 Ga0395899_0627084 3300037312 Bacteria 682
203 Ga0395900_0099321 3300037418 Bacteria 2990
204 Ga0395898_0002920 3300037466 Bacteria 19456
205 Ga0395898_0006307 3300037466 Bacteria 12672
206 Ga0395898_0232958 3300037466 Bacteria 1756
207 Ga0395905_0001573 3300037471 Bacteria 27258
208 Ga0395901_0011492 3300038443 Bacteria 8972
209 Ga0395901_0349521 3300038443 Bacteria 1526
210 Ga0439453_0003230 3300041408 Bacteria 2329
211 Ga0439466_0061391 3300041411 Bacteria 1210
212 Ga0451802_1033641 3300041460 Unclassified 1032
213 Ga0451847_0636417 3300041503 Bacteria 771
214 Ga0451843_0665293 3300041509 Bacteria 1237
215 Ga0439442_014853 3300042002 Bacteria 1604
216 Ga0439445_0032351 3300042004 Bacteria 1363
217 Ga0439454_017050 3300042011 Bacteria 1034
218 Ga0439446_0010236 3300042156 Bacteria 2524
219 Ga0439446_0010900 3300042156 Unclassified 2457
220 Ga0450909_010802 3300042185 Bacteria 1337
221 Ga0439434_0013019 3300042435 Bacteria 2467
222 Ga0439460_0167960 3300042461 Bacteria 738
223 Ga0450918_014849 3300042531 Bacteria 1354
224 Ga0466963_0147059 3300044694 Unclassified 1635
225 Ga0451576_0278739 3300045051 Bacteria 1748
226 Ga0451576_0597215 3300045051 Bacteria 1160
227 Ga0466958_0027662 3300045836 Bacteria 3357
228 Ga0495592_0070720 3300046454 Bacteria 2541
229 Ga0495592_0095408 3300046454 Bacteria 2127
230 Ga0495603_0173407 3300046455 Bacteria 1249
231 Ga0495603_0219562 3300046455 Bacteria 1097
232 Ga0495603_0253424 3300046455 Bacteria 1013
233 Ga0495603_0365150 3300046455 Bacteria 828
234 Ga0495603_0420214 3300046455 Bacteria 766
235 Ga0495629_0008674 3300046459 Bacteria 7486
236 Ga0495629_0243414 3300046459 Unclassified 1238
237 Ga0495641_0003715 3300046461 Bacteria 11243
238 Ga0495641_0006580 3300046461 Bacteria 7490
239 Ga0495641_0072379 3300046461 Unclassified 1546
240 Ga0495641_0140117 3300046461 Bacteria 1080
241 Ga0495641_0154593 3300046461 Bacteria 1026
242 Ga0495651_0074902 3300046462 Unclassified 2567
243 Ga0495651_0145320 3300046462 Bacteria 1715
244 Ga0495651_0184167 3300046462 Bacteria 1475
245 Ga0495653_0016938 3300046463 Bacteria 5928
246 Ga0495653_0117565 3300046463 Bacteria 1899
247 Ga0495580_0427922 3300046472 Unclassified 890
248 Ga0495582_0000585 3300046473 Bacteria 20182
249 Ga0495582_0045655 3300046473 Unclassified 2413
250 Ga0495582_0046250 3300046473 Bacteria 2397
251 Ga0495582_0098843 3300046473 Bacteria 1633
252 Ga0495582_0103418 3300046473 Bacteria 1596
253 Ga0495582_0191889 3300046473 Bacteria 1166
254 Ga0495639_0011490 3300046475 Bacteria 3818
255 Ga0495662_0008140 3300046476 Bacteria 5164
256 Ga0495662_0162322 3300046476 Unclassified 1101
257 Ga0495664_0132290 3300046477 Unclassified 1511
258 Ga0495664_0307692 3300046477 Bacteria 956
259 Ga0495584_0109982 3300046491 Archaea 1394
260 Ga0495594_0003500 3300046499 Bacteria 8089
261 Ga0495594_0274556 3300046499 Bacteria 960
262 Ga0495608_0046284 3300046511 Bacteria 2895
263 Ga0495608_0211305 3300046511 Bacteria 1220
264 Ga0495618_0038202 3300046514 Unclassified 3016
265 Ga0495618_0052747 3300046514 Bacteria 2571
266 Ga0495628_0073036 3300046516 Unclassified 2673
267 Ga0495628_0233080 3300046516 Bacteria 1379
268 Ga0495628_0365747 3300046516 Bacteria 1058
269 Ga0495630_0003092 3300046517 Bacteria 11549
270 Ga0495630_0067675 3300046517 Bacteria 2685
271 Ga0495631_0156426 3300046518 Bacteria 978
272 Ga0495663_0084329 3300046525 Bacteria 1027
273 Ga0495666_0018320 3300046526 Bacteria 3484
274 Ga0495666_0091786 3300046526 Bacteria 1433
275 Ga0495652_0024308 3300046529 Bacteria 5364
276 Ga0495652_0091560 3300046529 Bacteria 2485
277 Ga0495652_0113208 3300046529 Bacteria 2178
278 Ga0495665_0002817 3300046531 Bacteria 9380
279 Ga0495640_0039936 3300046533 Bacteria 3289
280 Ga0495640_0082759 3300046533 Bacteria 2130
281 Ga0495640_0179010 3300046533 Bacteria 1352
282 Ga0495640_0544495 3300046533 Bacteria 704
283 Ga0495587_0012536 3300046536 Bacteria 5331
284 Ga0495587_0032994 3300046536 Unclassified 3127
285 Ga0495587_0290361 3300046536 Bacteria 915
286 Ga0495587_0345791 3300046536 Bacteria 829
287 Ga0495645_0001685 3300046543 Bacteria 15012
288 Ga0495645_0174443 3300046543 Unclassified 1477
289 Ga0495622_0107632 3300046557 Bacteria 1277
290 Ga0495622_0158914 3300046557 Bacteria 1020
291 Ga0495667_0007584 3300046559 Bacteria 7364
292 Ga0495667_0032460 3300046559 Unclassified 3499
293 Ga0495667_0088394 3300046559 Bacteria 2008
294 Ga0495667_0257321 3300046559 Bacteria 1110
295 Ga0495656_0242829 3300046615 Bacteria 907
296 Ga0495656_0343381 3300046615 Bacteria 772
297 Ga0495668_0129372 3300046616 Bacteria 1382
298 Ga0495634_0093400 3300046642 Bacteria 1951
299 Ga0495634_0169289 3300046642 Bacteria 1374
300 Ga0495634_0201405 3300046642 Unclassified 1236
301 Ga0495635_0002577 3300046663 Bacteria 12403
302 Ga0495635_0237101 3300046663 Bacteria 1231
303 Ga0495659_0145105 3300046664 Bacteria 950
304 Ga0495661_0057700 3300046665 Bacteria 2317
305 Ga0495588_0054675 3300046674 Bacteria 2060
306 Ga0495588_0172126 3300046674 Bacteria 1145
307 Ga0495657_0012540 3300046675 Bacteria 6294
308 Ga0495657_0098562 3300046675 Bacteria 1865
309 Ga0495657_0271861 3300046675 Bacteria 1016
310 Ga0495599_0033966 3300046678 Bacteria 3206
311 Ga0495599_0270319 3300046678 Bacteria 1031
312 Ga0495599_0288633 3300046678 Bacteria 992
313 Ga0495623_0043121 3300046679 Bacteria 2871
314 Ga0495623_0204224 3300046679 Unclassified 1134
315 Ga0495646_0083463 3300046680 Bacteria 1857
316 Ga0495646_0124639 3300046680 Bacteria 1455
317 Ga0495646_0134394 3300046680 Unclassified 1389
318 Ga0495647_0003968 3300046681 Bacteria 4774
319 Ga0495647_0092682 3300046681 Bacteria 1241
320 Ga0495658_0001945 3300046683 Bacteria 10561
321 Ga0495658_0011517 3300046683 Bacteria 4451
322 Ga0495613_0003723 3300046689 Bacteria 11435
323 Ga0495613_0448049 3300046689 Unclassified 875
324 Ga0495613_0603301 3300046689 Unclassified 730
325 Ga0495624_0014532 3300046690 Bacteria 5339
326 Ga0495624_0153503 3300046690 Bacteria 1408
327 Ga0495589_0113731 3300046794 Bacteria 1305
328 Ga0495600_0023495 3300046809 Bacteria 3966
329 Ga0495600_0198357 3300046809 Bacteria 1289
330 Ga0495581_0000648 3300047315 Bacteria 18222
331 Ga0495581_0003961 3300047315 Bacteria 8531
332 Ga0495581_0249407 3300047315 Unclassified 1038
333 Ga0495604_0004516 3300047317 Bacteria 11025
334 Ga0495604_0004674 3300047317 Bacteria 10858
335 Ga0495604_0057660 3300047317 Bacteria 2986
336 Ga0495604_0126686 3300047317 Bacteria 1840
337 Ga0495604_0366506 3300047317 Bacteria 954
338 Ga0495674_0029754 3300047319 Bacteria 4969
339 Ga0495674_0086351 3300047319 Bacteria 2686
340 Ga0495674_0154164 3300047319 Bacteria 1925
341 Ga0495674_0313481 3300047319 Bacteria 1279
342 Ga0495676_0000879 3300047321 Bacteria 25087
343 Ga0495676_0039994 3300047321 Bacteria 3875
344 Ga0495676_0117419 3300047321 Bacteria 1941
345 Ga0495676_0265432 3300047321 Bacteria 1166
346 Ga0495676_0280644 3300047321 Unclassified 1128
347 Ga0495680_0027054 3300047322 Bacteria 4718
348 Ga0495680_0162038 3300047322 Bacteria 1623
349 Ga0495680_0562951 3300047322 Bacteria 766
350 Ga0495675_0044880 3300047444 Unclassified 2815
351 Ga0495675_0162689 3300047444 Bacteria 1374
352 Ga0495675_0254353 3300047444 Bacteria 1054
353 Ga0495684_0009806 3300047471 Bacteria 7392
354 Ga0495684_0029365 3300047471 Bacteria 4220
355 Ga0495684_0184982 3300047471 Unclassified 1543
356 Ga0495684_0276331 3300047471 Bacteria 1213
357 Ga0495593_0004224 3300047673 Bacteria 8543
358 Ga0495593_0477132 3300047673 Unclassified 625
359 Ga0495602_0161219 3300048088 Unclassified 1750
360 Ga0495602_0758179 3300048088 Bacteria 654
361 Ga0495614_0009568 3300048089 Bacteria 4283
362 Ga0496100_0022470 3300048903 Bacteria 3817
363 Ga0496100_0128861 3300048903 Bacteria 1779
364 Ga0496100_0760315 3300048903 Bacteria 758
365 Ga0496101_0021755 3300048904 Bacteria 4408
366 Ga0496101_0079277 3300048904 Bacteria 2424
367 Ga0496101_0143976 3300048904 Bacteria 1819
368 Ga0496101_0572171 3300048904 Bacteria 893
369 Ga0496102_0149156 3300048905 Bacteria 2196
370 Ga0496102_0197583 3300048905 Bacteria 1896
371 Ga0496103_0019118 3300048906 Bacteria 4113
372 Ga0496103_0038461 3300048906 Bacteria 2936
373 Ga0496103_0188278 3300048906 Bacteria 1327
374 Ga0496104_0043096 3300048907 Bacteria 4238
375 Ga0496104_0248336 3300048907 Bacteria 1692
376 Ga0496104_0261815 3300048907 Bacteria 1642
377 Ga0496105_0034345 3300048908 Bacteria 4170
378 Ga0496105_0046338 3300048908 Bacteria 3589
379 Ga0496105_0080884 3300048908 Bacteria 2684
380 Ga0496105_0092869 3300048908 Bacteria 2492
381 Ga0496106_0089994 3300048909 Bacteria 2368
382 Ga0496107_0179442 3300048910 Bacteria 1572
383 Ga0496109_0177541 3300048912 Bacteria 1999
384 Ga0496109_0188027 3300048912 Bacteria 1940
385 Ga0496110_0189195 3300048913 Bacteria 1869
386 Ga0496110_0438068 3300048913 Bacteria 1191
387 Ga0496110_0692441 3300048913 Bacteria 920
388 Ga0496111_0057462 3300048914 Bacteria 2817
389 Ga0496111_0067973 3300048914 Bacteria 2589
390 Ga0496111_0120820 3300048914 Bacteria 1935
391 Ga0496111_0428867 3300048914 Bacteria 976
392 Ga0496112_0092042 3300048915 Bacteria 3001
393 Ga0496113_0517128 3300048916 Bacteria 958
394 Ga0496114_0008773 3300048917 Bacteria 8010
395 Ga0496114_0008842 3300048917 Bacteria 7983
396 Ga0496114_0047736 3300048917 Bacteria 3561
397 Ga0496114_0126696 3300048917 Unclassified 2202
398 Ga0496114_0172604 3300048917 Bacteria 1885
399 Ga0496114_0198792 3300048917 Bacteria 1755
400 Ga0496114_0335543 3300048917 Bacteria 1337
401 Ga0496114_0402253 3300048917 Bacteria 1213
402 Ga0496114_0549563 3300048917 Bacteria 1020
403 Ga0496115_0010453 3300048918 Bacteria 6936
404 Ga0496115_0026568 3300048918 Bacteria 4520
405 Ga0501039_0533986 3300049575 Unclassified 921
406 Ga0501041_0231361 3300049577 Bacteria 1161
407 Ga0501041_0679895 3300049577 Bacteria 658
408 Ga0501048_0514970 3300049582 Bacteria 858
409 Ga0501067_0019921 3300049583 Bacteria 3711
410 Ga0501067_0032722 3300049583 Bacteria 2886
411 Ga0501069_0034665 3300049585 Bacteria 2779
412 Ga0501069_0120203 3300049585 Bacteria 1500
413 Ga0501070_0980806 3300049586 Bacteria 656
414 Ga0501074_0629423 3300049590 Bacteria 758
415 Ga0501075_0004361 3300049591 Bacteria 9570
416 Ga0501075_0095112 3300049591 Bacteria 2261
417 Ga0501076_0126612 3300049592 Bacteria 2070
418 Ga0501077_0060402 3300049593 Bacteria 2406
419 Ga0501077_0065542 3300049593 Bacteria 2303
420 Ga0501079_0060267 3300049741 Bacteria 2927
421 Ga0501079_0123298 3300049741 Bacteria 2015
422 Ga0501079_0188586 3300049741 Bacteria 1609
423 Ga0501079_0209839 3300049741 Bacteria 1521
424 Ga0501080_0025332 3300049742 Bacteria 5504
425 Ga0501080_0502142 3300049742 Bacteria 1084
426 Ga0501081_0144938 3300049743 Bacteria 1704
427 nmdc:mga05p37_40353_c1 3300050507 Bacteria 5731
428 nmdc:mga0qj67_328624_c1 3300050509 Bacteria 1237
429 nmdc:mga06r32_202187_c1 3300050510 Unclassified 1974
430 nmdc:mga0n895_629058_c1 3300050512 Unclassified 1074
431 nmdc:mga0rr50_77828_c1 3300050513 Unclassified 2550
432 nmdc:mga08x19_187794_c1 3300050514 Unclassified 1413
433 nmdc:mga0a205_45894_c1 3300050515 Unclassified 4214
434 nmdc:mga0a205_652857_c1 3300050515 Bacteria 903
435 Ga0495601_0205286 3300053077 Bacteria 1287
436 Ga0495595_0005012 3300053084 Bacteria 5347
437 Ga0495619_0031792 3300053085 Bacteria 3421
438 Ga0495619_0040457 3300053085 Bacteria 3047
439 Ga0495619_0143974 3300053085 Bacteria 1642
440 Ga0495619_0579275 3300053085 Unclassified 769
441 Ga0500628_111977 3300053129 Bacteria 733
442 Ga0501084_0169294 3300054114 Bacteria 1844
443 Ga0501082_0030563 3300060353 Bacteria 4642
444 Ga0530510_0022942 3300061734 Bacteria 4447
445 Ga0496115_0027851
446 Ga0070683_100003808
447 Ga0070683_100504603
448 Ga0070683_100699664
449 Ga0070670_100231831
450 Ga0070670_101246949
451 Ga0070666_10221415
452 Ga0070680_100022365
453 Ga0070680_100993625
454 Ga0070682_100019609
455 Ga0068868_100037957
456 Ga0070660_100005099
457 Ga0070660_100076465
458 Ga0070675_100376739
459 Ga0070673_100074615
460 Ga0070667_100575827
461 Ga0070709_10947196
462 Ga0070714_100573811
463 Ga0070714_100610779
464 Ga0070708_100269510
465 Ga0070708_101102533
466 Ga0070678_100244250
467 Ga0070681_10089581
468 Ga0070681_10107747
469 Ga0068867_100418360
470 Ga0070706_100264884
471 Ga0070707_100643800
472 Ga0070698_100489640
473 Ga0070679_100000265
474 Ga0070679_100035729
475 Ga0070679_100173410
476 Ga0070684_100005351
477 Ga0070684_100072697
478 Ga0070684_100453896
479 Ga0070684_100812079
480 Ga0068853_100251664
481 Ga0070672_100536491
482 Ga0070696_100238985
483 Ga0070665_100758936
484 Ga0070704_100085253
485 Ga0070704_100351416
486 Ga0068855_100082017
487 Ga0068855_100155459
488 Ga0068855_100233979
489 Ga0070664_100745592
490 Ga0068854_100158174
491 Ga0068856_100055835
492 Ga0068856_100259571
493 Ga0068852_100519769
494 Ga0068866_10132065
495 Ga0068862_100575736
496 Ga0070717_10224588
497 Ga0070717_10336672
498 Ga0070715_10186647
499 Ga0097621_100134894
500 Ga0097621_101141652
501 Ga0068871_100724331
502 Ga0075431_100371195
503 Ga0075433_10125578
504 Ga0075434_100038374
505 Ga0075434_100116846
506 Ga0075434_100707804
507 Ga0068865_100981683
508 Ga0075436_100071107
509 Ga0075436_100242203
510 Ga0075435_100047701
511 Ga0075435_100078730
512 Ga0105240_10045039
513 Ga0105240_10482735
514 Ga0105245_10012398
515 Ga0114129_10057122
516 Ga0105241_10430074
517 Ga0105242_10618515
518 Ga0105248_10882272
519 Ga0105248_11063243
520 Ga0105237_10163129
521 Ga0105238_10397432
522 Ga0105238_10794260
523 Ga0105238_11233081
524 Ga0105249_10974327
525 Ga0105239_10160865
526 Ga0157321_1001381
527 Ga0157313_1010972
528 Ga0157370_10011003
529 Ga0157370_10082157
530 Ga0157370_11039802
531 Ga0157369_10017645
532 Ga0157369_10052947
533 Ga0157369_10574469
534 Ga0157369_11552431
535 Ga0163162_10124844
536 Ga0163162_11045539
537 Ga0157372_10196802
538 Ga0157372_10382051
539 Ga0157376_10091146
540 Ga0206356_11817099
541 Ga0207682_10122461
542 Ga0207682_10269757
543 Ga0207699_10133837
544 Ga0207684_10069519
545 Ga0207684_10780212
546 Ga0207707_10016321
547 Ga0207707_10048000
548 Ga0207707_10263685
549 Ga0207707_10482587
550 Ga0207695_10026836
551 Ga0207695_10034493
552 Ga0207671_10339002
553 Ga0207693_10395953
554 Ga0207660_10017078
555 Ga0207660_10133190
556 Ga0207660_10265320
557 Ga0207657_10022771
558 Ga0207657_10076915
559 Ga0207657_10349360
560 Ga0207649_10085872
561 Ga0207652_10000547
562 Ga0207652_10018363
563 Ga0207652_10195170
564 Ga0207652_10403250
565 Ga0207694_10414135
566 Ga0207650_10285594
567 Ga0207659_10540414
568 Ga0207687_10455465
569 Ga0207687_10618194
570 Ga0207700_10548936
571 Ga0207664_10573742
572 Ga0207644_10658749
573 Ga0207644_10893417
574 Ga0207669_10019364
575 Ga0207704_10537762
576 Ga0207691_10149580
577 Ga0207691_10436963
578 Ga0207691_10707623
579 Ga0207711_10606017
580 Ga0207689_10263665
581 Ga0207661_10021952
582 Ga0207661_10484876
583 Ga0207661_11313650
584 Ga0207667_10058434
585 Ga0207667_10260368
586 Ga0207640_10740703
587 Ga0207677_10339140
588 Ga0207639_10689033
589 Ga0207702_10660587
590 Ga0207641_10225507
591 Ga0207648_10835767
592 Ga0207683_10019608
593 Ga0207683_10276577
594 Ga0207683_10425730
595 Ga0207698_10840114
596 Ga0268266_10283339
597 Ga0268266_10602844
598 Ga0265319_1001078
599 Ga0265318_10000760
600 Ga0265318_10012118
601 Ga0265318_10099042
602 Ga0265338_10006443
603 Ga0265338_10022333
604 Ga0265329_10007808
605 Ga0265340_10124981
606 Ga0265316_10007718
607 Ga0307408_100271036
608 Ga0265314_10044418
609 Ga0307405_10260441
610 Ga0307405_10298252
611 Ga0307410_10481194
612 Ga0307406_10544185
613 Ga0307409_100387764
614 Ga0307416_101212357
615 Ga0307414_10764812
616 Ga0307415_100000283
617 Ga0373926_0140206
618 Ga0373944_0033568
619 Ga0373944_0089860
620 Ga0373939_0206444
621 Ga0373945_0008033
622 Ga0373945_0073708
623 Ga0373943_0007529
624 Ga0373943_0015127
625 Ga0373943_0090203
626 Ga0373943_0290917
627 Ga0373943_0407384
628 Ga0373946_0006247
629 Ga0373955_0051576
630 Ga0373955_0054575
631 Ga0373955_0410020
632 Ga0373935_0008364
633 Ga0373927_0132886
634 Ga0373927_0156239
635 Ga0373933_0061911
636 Ga0373947_0002827
637 Ga0373947_0009884
638 Ga0373947_0034925
639 Ga0373947_0279945
640 Ga0373937_0024762
641 Ga0373937_0055764
642 Ga0373925_0001342
643 Ga0373925_0461867
644 Ga0395899_0030508
645 Ga0395899_0253951
646 Ga0395899_0627084
647 Ga0395900_0099321
648 Ga0395898_0002920
649 Ga0395898_0006307
650 Ga0395898_0232958
651 Ga0395905_0001573
652 Ga0395901_0011492
653 Ga0395901_0349521
654 Ga0439453_0003230
655 Ga0439466_0061391
656 Ga0451802_1033641
657 Ga0451847_0636417
658 Ga0451843_0665293
659 Ga0439442_014853
660 Ga0439445_0032351
661 Ga0439454_017050
662 Ga0439446_0010236
663 Ga0439446_0010900
664 Ga0450909_010802
665 Ga0439434_0013019
666 Ga0439460_0167960
667 Ga0450918_014849
668 Ga0466963_0147059
669 Ga0451576_0278739
670 Ga0451576_0597215
671 Ga0466958_0027662
672 Ga0495592_0070720
673 Ga0495592_0095408
674 Ga0495603_0173407
675 Ga0495603_0219562
676 Ga0495603_0253424
677 Ga0495603_0365150
678 Ga0495603_0420214
679 Ga0495629_0008674
680 Ga0495629_0243414
681 Ga0495641_0003715
682 Ga0495641_0006580
683 Ga0495641_0072379
684 Ga0495641_0140117
685 Ga0495641_0154593
686 Ga0495651_0074902
687 Ga0495651_0145320
688 Ga0495651_0184167
689 Ga0495653_0016938
690 Ga0495653_0117565
691 Ga0495580_0427922
692 Ga0495582_0000585
693 Ga0495582_0045655
694 Ga0495582_0046250
695 Ga0495582_0098843
696 Ga0495582_0103418
697 Ga0495582_0191889
698 Ga0495639_0011490
699 Ga0495662_0008140
700 Ga0495662_0162322
701 Ga0495664_0132290
702 Ga0495664_0307692
703 Ga0495584_0109982
704 Ga0495594_0003500
705 Ga0495594_0274556
706 Ga0495608_0046284
707 Ga0495608_0211305
708 Ga0495618_0038202
709 Ga0495618_0052747
710 Ga0495628_0073036
711 Ga0495628_0233080
712 Ga0495628_0365747
713 Ga0495630_0003092
714 Ga0495630_0067675
715 Ga0495631_0156426
716 Ga0495663_0084329
717 Ga0495666_0018320
718 Ga0495666_0091786
719 Ga0495652_0024308
720 Ga0495652_0091560
721 Ga0495652_0113208
722 Ga0495665_0002817
723 Ga0495640_0039936
724 Ga0495640_0082759
725 Ga0495640_0179010
726 Ga0495640_0544495
727 Ga0495587_0012536
728 Ga0495587_0032994
729 Ga0495587_0290361
730 Ga0495587_0345791
731 Ga0495645_0001685
732 Ga0495645_0174443
733 Ga0495622_0107632
734 Ga0495622_0158914
735 Ga0495667_0007584
736 Ga0495667_0032460
737 Ga0495667_0088394
738 Ga0495667_0257321
739 Ga0495656_0242829
740 Ga0495656_0343381
741 Ga0495668_0129372
742 Ga0495634_0093400
743 Ga0495634_0169289
744 Ga0495634_0201405
745 Ga0495635_0002577
746 Ga0495635_0237101
747 Ga0495659_0145105
748 Ga0495661_0057700
749 Ga0495588_0054675
750 Ga0495588_0172126
751 Ga0495657_0012540
752 Ga0495657_0098562
753 Ga0495657_0271861
754 Ga0495599_0033966
755 Ga0495599_0270319
756 Ga0495599_0288633
757 Ga0495623_0043121
758 Ga0495623_0204224
759 Ga0495646_0083463
760 Ga0495646_0124639
761 Ga0495646_0134394
762 Ga0495647_0003968
763 Ga0495647_0092682
764 Ga0495658_0001945
765 Ga0495658_0011517
766 Ga0495613_0003723
767 Ga0495613_0448049
768 Ga0495613_0603301
769 Ga0495624_0014532
770 Ga0495624_0153503
771 Ga0495589_0113731
772 Ga0495600_0023495
773 Ga0495600_0198357
774 Ga0495581_0000648
775 Ga0495581_0003961
776 Ga0495581_0249407
777 Ga0495604_0004516
778 Ga0495604_0004674
779 Ga0495604_0057660
780 Ga0495604_0126686
781 Ga0495604_0366506
782 Ga0495674_0029754
783 Ga0495674_0086351
784 Ga0495674_0154164
785 Ga0495674_0313481
786 Ga0495676_0000879
787 Ga0495676_0039994
788 Ga0495676_0117419
789 Ga0495676_0265432
790 Ga0495676_0280644
791 Ga0495680_0027054
792 Ga0495680_0162038
793 Ga0495680_0562951
794 Ga0495675_0044880
795 Ga0495675_0162689
796 Ga0495675_0254353
797 Ga0495684_0009806
798 Ga0495684_0029365
799 Ga0495684_0184982
800 Ga0495684_0276331
801 Ga0495593_0004224
802 Ga0495593_0477132
803 Ga0495602_0161219
804 Ga0495602_0758179
805 Ga0495614_0009568
806 Ga0496100_0022470
807 Ga0496100_0128861
808 Ga0496100_0760315
809 Ga0496101_0021755
810 Ga0496101_0079277
811 Ga0496101_0143976
812 Ga0496101_0572171
813 Ga0496102_0149156
814 Ga0496102_0197583
815 Ga0496103_0019118
816 Ga0496103_0038461
817 Ga0496103_0188278
818 Ga0496104_0043096
819 Ga0496104_0248336
820 Ga0496104_0261815
821 Ga0496105_0034345
822 Ga0496105_0046338
823 Ga0496105_0080884
824 Ga0496105_0092869
825 Ga0496106_0089994
826 Ga0496107_0179442
827 Ga0496109_0177541
828 Ga0496109_0188027
829 Ga0496110_0189195
830 Ga0496110_0438068
831 Ga0496110_0692441
832 Ga0496111_0057462
833 Ga0496111_0067973
834 Ga0496111_0120820
835 Ga0496111_0428867
836 Ga0496112_0092042
837 Ga0496113_0517128
838 Ga0496114_0008773
839 Ga0496114_0008842
840 Ga0496114_0047736
841 Ga0496114_0126696
842 Ga0496114_0172604
843 Ga0496114_0198792
844 Ga0496114_0335543
845 Ga0496114_0402253
846 Ga0496114_0549563
847 Ga0496115_0010453
848 Ga0496115_0026568
849 Ga0501039_0533986
850 Ga0501041_0231361
851 Ga0501041_0679895
852 Ga0501048_0514970
853 Ga0501067_0019921
854 Ga0501067_0032722
855 Ga0501069_0034665
856 Ga0501069_0120203
857 Ga0501070_0980806
858 Ga0501074_0629423
859 Ga0501075_0004361
860 Ga0501075_0095112
861 Ga0501076_0126612
862 Ga0501077_0060402
863 Ga0501077_0065542
864 Ga0501079_0060267
865 Ga0501079_0123298
866 Ga0501079_0188586
867 Ga0501079_0209839
868 Ga0501080_0025332
869 Ga0501080_0502142
870 Ga0501081_0144938
871 nmdc:mga05p37_40353_c1
872 nmdc:mga0qj67_328624_c1
873 nmdc:mga06r32_202187_c1
874 nmdc:mga0n895_629058_c1
875 nmdc:mga0rr50_77828_c1
876 nmdc:mga08x19_187794_c1
877 nmdc:mga0a205_45894_c1
878 nmdc:mga0a205_652857_c1
879 Ga0495601_0205286
880 Ga0495595_0005012
881 Ga0495619_0031792
882 Ga0495619_0040457
883 Ga0495619_0143974
884 Ga0495619_0579275
885 Ga0500628_111977
886 Ga0501084_0169294
887 Ga0501082_0030563
888 Ga0530510_0022942

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05683

Fumerase_C

Fumarase C-terminus

3

170

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2isb-assembly1.cif.gz_A crystal structure of fumarase of fum-1 (np_069927.1) from archaeoglobus fulgidus at 1.66 a resolution 0.8686 1 182
7xky-assembly1.cif.gz_B crystal structure of methanocaldococcus jannaschii two-subunit fumarate hydratase apo-protein complex 0.8658 5 196
7xky-assembly1.cif.gz_B crystal structure of methanocaldococcus jannaschii two-subunit fumarate hydratase apo-protein complex 0.8533 5 196
5dni-assembly2.cif.gz_B crystal structure of methanocaldococcus jannaschii fumarate hydratase beta subunit 0.852 5 182
5dni-assembly2.cif.gz_B crystal structure of methanocaldococcus jannaschii fumarate hydratase beta subunit 0.8389 5 182
ID Description Score Start End Superfamily
af_P0AC35_1_176_3.20.130.10 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.9106 1 181 3.20.130.10
af_P0AC35_1_176_3.20.130.10 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.8961 1 181 3.20.130.10
1vpjA00 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.8814 2 182 3.20.130.10
1vpjA00 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.8718 2 182 3.20.130.10
5dniA00 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.8567 5 182 3.20.130.10
ID Description Score Start End GO Terms
AF-A0A537TQ94-F1-model_v4 Fumarate hydrolyase 0.9547 1 200 GO:0016836
AF-A0A537TQ94-F1-model_v4 Fumarate hydrolyase 0.9499 1 200 GO:0016836
AF-A0A538CJM4-F1-model_v4 Fumarate hydrolyase 0.9459 35 200 GO:0016836
AF-A0A535IKX1-F1-model_v4 Fumarate hydrolyase 0.9449 47 173 GO:0016836
AF-A0A538CJM4-F1-model_v4 Fumarate hydrolyase 0.9403 35 200 GO:0016836

Map