F445250

General Info

Members Datasets Scaffolds Average Seq Length
444 245 888 326

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10252611|Ga0081455_102526111
Length 323
Sequence MKLPRRTFVHLAAGAAALPAVSRFAWAQAYPTRPVRLIVGSPPGGVVDLYARLIGQWLSERLGQPFVIENRPGAGGNIGTEAVVRAAPDGYTLLQLTAGHSWNVALYDKLNFNFIRDIAPVASIYSSSSALLVHLSFPAKSVPELIAYAKANPGKISMASTGVGTVGHVYGELFKMMAGVDMLHIPYRGWPLPDLLAGQVPLMFEPIGSSLEYIRSGKVRALAVTSATRAEVLPDIPTVGEFVTGYEASGWQGVGAPRNTPVEIINKLNEEINAALTDPKMKARIADLGGTVLAGSPAEFRTFIGAYTEKWSKVIKLAGIKVD

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
130 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
131 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
132 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
138 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
139 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
140 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
141 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
142 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
144 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
145 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
146 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
158 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
168 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
187 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
191 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
195 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
196 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
197 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
198 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
205 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
222 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
223 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
227 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
242 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
243 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
244 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
245 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.23
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.41
Nodule 0.23
Rhizoplane 8.56
Rhizosphere 84.23
Stem 0
Stem Tuber 0
Unclassified 2.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10252611 3300005937 Bacteria 1289
2 Ga0070683_100118697 3300005329 Bacteria 2498
3 Ga0070670_100086499 3300005331 Bacteria 2693
4 Ga0070677_10004327 3300005333 Bacteria 4624
5 Ga0070680_100012612 3300005336 Bacteria 6570
6 Ga0070680_100059584 3300005336 Bacteria 3124
7 Ga0070691_10022774 3300005341 Bacteria 2907
8 Ga0070661_100132015 3300005344 Bacteria 1877
9 Ga0070675_100241223 3300005354 Bacteria 1579
10 Ga0070671_100037932 3300005355 Bacteria 3998
11 Ga0070674_100002285 3300005356 Bacteria 10581
12 Ga0070674_100041844 3300005356 Bacteria 3108
13 Ga0070674_100076339 3300005356 Bacteria 2382
14 Ga0070674_100395441 3300005356 Bacteria 1128
15 Ga0070688_100155479 3300005365 Bacteria 1566
16 Ga0070659_100193128 3300005366 Bacteria 1674
17 Ga0070703_10059151 3300005406 Bacteria 1249
18 Ga0070709_10037466 3300005434 Bacteria 2961
19 Ga0070709_10257899 3300005434 Bacteria 1258
20 Ga0070714_100189183 3300005435 Bacteria 1877
21 Ga0070713_100016936 3300005436 Bacteria 5494
22 Ga0070713_100104412 3300005436 Bacteria 2460
23 Ga0070694_100087070 3300005444 Bacteria 2184
24 Ga0070708_100027678 3300005445 Bacteria 4867
25 Ga0070708_100096092 3300005445 Bacteria 2706
26 Ga0070678_100006177 3300005456 Bacteria 7001
27 Ga0070662_100222737 3300005457 Bacteria 1506
28 Ga0070662_100235870 3300005457 Bacteria 1465
29 Ga0070681_10050801 3300005458 Bacteria 4137
30 Ga0070681_10051746 3300005458 Bacteria 4096
31 Ga0070706_100037824 3300005467 Bacteria 4456
32 Ga0070706_100093078 3300005467 Bacteria 2796
33 Ga0070707_100064482 3300005468 Bacteria 3517
34 Ga0070707_100080550 3300005468 Bacteria 3143
35 Ga0070707_100304491 3300005468 Bacteria 1549
36 Ga0070698_100026261 3300005471 Bacteria 6063
37 Ga0070698_100037683 3300005471 Bacteria 4984
38 Ga0070698_100138537 3300005471 Bacteria 2386
39 Ga0070698_100140702 3300005471 Bacteria 2364
40 Ga0070698_100225714 3300005471 Bacteria 1806
41 Ga0070699_100101629 3300005518 Bacteria 2520
42 Ga0070699_100360520 3300005518 Bacteria 1310
43 Ga0070679_100006392 3300005530 Bacteria 10975
44 Ga0070679_100041834 3300005530 Bacteria 4561
45 Ga0070684_100007810 3300005535 Bacteria 8341
46 Ga0070697_100017773 3300005536 Bacteria 5600
47 Ga0070697_100096522 3300005536 Bacteria 2452
48 Ga0070697_100174329 3300005536 Bacteria 1821
49 Ga0070697_100277865 3300005536 Bacteria 1436
50 Ga0070672_100416927 3300005543 Unclassified 1153
51 Ga0070686_100330929 3300005544 Bacteria 1139
52 Ga0070695_100007726 3300005545 Bacteria 6367
53 Ga0070665_100003540 3300005548 Bacteria 16590
54 Ga0070665_100058674 3300005548 Bacteria 3858
55 Ga0068855_100098261 3300005563 Bacteria 3373
56 Ga0068855_100220165 3300005563 Bacteria 2129
57 Ga0070664_100150389 3300005564 Bacteria 2055
58 Ga0070664_100160502 3300005564 Bacteria 1989
59 Ga0070664_100173824 3300005564 Bacteria 1911
60 Ga0068852_100319422 3300005616 Bacteria 1508
61 Ga0068859_100482382 3300005617 Bacteria 1335
62 Ga0068863_100071429 3300005841 Bacteria 3284
63 Ga0081455_10007366 3300005937 Bacteria 11600
64 Ga0081455_10010462 3300005937 Bacteria 9409
65 Ga0081455_10011190 3300005937 Bacteria 9027
66 Ga0081455_10056999 3300005937 Bacteria 3314
67 Ga0081455_10063747 3300005937 Bacteria 3091
68 Ga0081455_10088801 3300005937 Bacteria 2510
69 Ga0081455_10137570 3300005937 Unclassified 1901
70 Ga0081455_10225078 3300005937 Bacteria 1388
71 Ga0081540_1000544 3300005983 Bacteria 36521
72 Ga0081540_1002136 3300005983 Bacteria 16449
73 Ga0081540_1003603 3300005983 Bacteria 12154
74 Ga0081540_1006790 3300005983 Bacteria 8269
75 Ga0081540_1006999 3300005983 Bacteria 8113
76 Ga0081540_1027403 3300005983 Bacteria 3229
77 Ga0081539_10000349 3300005985 Bacteria 101264
78 Ga0070717_10014721 3300006028 Bacteria 6018
79 Ga0070717_10017948 3300006028 Bacteria 5518
80 Ga0070717_10051144 3300006028 Bacteria 3399
81 Ga0070717_10134836 3300006028 Bacteria 2125
82 Ga0070717_10221529 3300006028 Bacteria 1663
83 Ga0075365_10006962 3300006038 Bacteria 6282
84 Ga0075365_10013465 3300006038 Bacteria 4894
85 Ga0075368_10016726 3300006042 Bacteria 2736
86 Ga0075363_100000598 3300006048 Bacteria 11919
87 Ga0075363_100002599 3300006048 Bacteria 7438
88 Ga0075363_100075212 3300006048 Bacteria 1840
89 Ga0075364_10011289 3300006051 Bacteria 5424
90 Ga0070715_10013807 3300006163 Bacteria 2976
91 Ga0070716_100004138 3300006173 Bacteria 6887
92 Ga0075362_10046876 3300006177 Bacteria 1923
93 Ga0097621_100171917 3300006237 Bacteria 1868
94 Ga0075370_10007192 3300006353 Bacteria 5657
95 Ga0068871_100075615 3300006358 Bacteria 2781
96 Ga0075428_100073970 3300006844 Bacteria 3722
97 Ga0075428_100128638 3300006844 Unclassified 2755
98 Ga0075428_100201819 3300006844 Bacteria 2149
99 Ga0075428_100391980 3300006844 Bacteria 1489
100 Ga0075428_100480532 3300006844 Bacteria 1330
101 Ga0075428_100553242 3300006844 Bacteria 1230
102 Ga0075430_100003193 3300006846 Bacteria 13738
103 Ga0075430_100088570 3300006846 Bacteria 2590
104 Ga0075430_100129706 3300006846 Unclassified 2101
105 Ga0075431_100000947 3300006847 Bacteria 25624
106 Ga0075431_100004344 3300006847 Bacteria 13894
107 Ga0075431_100006046 3300006847 Bacteria 11999
108 Ga0075431_100044322 3300006847 Bacteria 4588
109 Ga0075431_100091634 3300006847 Bacteria 3137
110 Ga0075431_100457138 3300006847 Bacteria 1272
111 Ga0075433_10004731 3300006852 Bacteria 10616
112 Ga0075433_10029204 3300006852 Bacteria 4695
113 Ga0075434_100045634 3300006871 Bacteria 4347
114 Ga0075434_100268453 3300006871 Bacteria 1726
115 Ga0075429_100011015 3300006880 Bacteria 7823
116 Ga0075429_100025543 3300006880 Bacteria 5127
117 Ga0075429_100111788 3300006880 Bacteria 2388
118 Ga0075436_100014720 3300006914 Bacteria 5360
119 Ga0075436_100183606 3300006914 Bacteria 1479
120 Ga0097620_100482411 3300006931 Bacteria 1335
121 Ga0075435_100021858 3300007076 Bacteria 4929
122 Ga0075435_100089584 3300007076 Bacteria 2537
123 Ga0075435_100295611 3300007076 Bacteria 1384
124 Ga0099794_10017602 3300007265 Bacteria 3187
125 Ga0099795_10000918 3300007788 Bacteria 5953
126 Ga0099795_10005860 3300007788 Bacteria 3306
127 Ga0099795_10015846 3300007788 Bacteria 2371
128 Ga0099795_10024124 3300007788 Bacteria 2024
129 Ga0105240_10305568 3300009093 Bacteria 1818
130 Ga0111539_10005180 3300009094 Bacteria 16890
131 Ga0111539_10023449 3300009094 Bacteria 7583
132 Ga0111539_10045817 3300009094 Bacteria 5234
133 Ga0111539_10112347 3300009094 Bacteria 3196
134 Ga0111539_10507895 3300009094 Bacteria 1404
135 Ga0105245_10012692 3300009098 Bacteria 7335
136 Ga0105247_10017231 3300009101 Bacteria 4336
137 Ga0105247_10107663 3300009101 Bacteria 1790
138 Ga0114129_10015591 3300009147 Bacteria 10806
139 Ga0114129_10071368 3300009147 Bacteria 4842
140 Ga0114129_10330086 3300009147 Bacteria 2025
141 Ga0114129_10908463 3300009147 Bacteria 1115
142 Ga0105243_10105702 3300009148 Bacteria 2345
143 Ga0105241_10060150 3300009174 Bacteria 2922
144 Ga0105248_10163786 3300009177 Bacteria 2507
145 Ga0105248_10368368 3300009177 Bacteria 1617
146 Ga0105249_10045411 3300009553 Bacteria 3995
147 Ga0099796_10015110 3300010159 Bacteria 2249
148 Ga0099796_10017919 3300010159 Bacteria 2117
149 Ga0099796_10090866 3300010159 Bacteria 1135
150 Ga0105239_10042725 3300010375 Bacteria 4967
151 Ga0105239_10132217 3300010375 Bacteria 2776
152 Ga0105246_10040524 3300011119 Bacteria 3144
153 Ga0157369_10043913 3300013105 Bacteria 4868
154 Ga0163162_10051650 3300013306 Bacteria 4125
155 Ga0157372_10186059 3300013307 Bacteria 2405
156 Ga0157375_10013598 3300013308 Bacteria 7251
157 Ga0157375_10062627 3300013308 Bacteria 3697
158 Ga0157375_10676248 3300013308 Bacteria 1187
159 Ga0163163_10077677 3300014325 Bacteria 3315
160 Ga0157379_10085308 3300014968 Bacteria 2830
161 Ga0157376_10034654 3300014969 Bacteria 4078
162 Ga0163161_10032272 3300017792 Bacteria 3737
163 Ga0163161_10055912 3300017792 Bacteria 2865
164 Ga0213871_10012152 3300021441 Bacteria 1993
165 Ga0207682_10003304 3300025893 Bacteria 7043
166 Ga0207692_10039921 3300025898 Bacteria 2313
167 Ga0207643_10280128 3300025908 Bacteria 1034
168 Ga0207705_10262546 3300025909 Bacteria 1319
169 Ga0207684_10019430 3300025910 Bacteria 5814
170 Ga0207684_10022991 3300025910 Bacteria 5325
171 Ga0207684_10073369 3300025910 Bacteria 2906
172 Ga0207684_10094193 3300025910 Bacteria 2554
173 Ga0207707_10000316 3300025912 Bacteria 50907
174 Ga0207707_10099729 3300025912 Bacteria 2538
175 Ga0207693_10118646 3300025915 Bacteria 2077
176 Ga0207693_10128935 3300025915 Bacteria 1988
177 Ga0207660_10048754 3300025917 Bacteria 2999
178 Ga0207662_10053946 3300025918 Bacteria 2396
179 Ga0207657_10088504 3300025919 Bacteria 2588
180 Ga0207652_10006025 3300025921 Bacteria 9815
181 Ga0207652_10211057 3300025921 Bacteria 1748
182 Ga0207646_10053417 3300025922 Bacteria 3614
183 Ga0207646_10228177 3300025922 Bacteria 1682
184 Ga0207694_10383468 3300025924 Bacteria 1167
185 Ga0207650_10253850 3300025925 Bacteria 1424
186 Ga0207659_10094310 3300025926 Bacteria 2242
187 Ga0207659_10180551 3300025926 Unclassified 1672
188 Ga0207700_10035767 3300025928 Bacteria 3580
189 Ga0207700_10078060 3300025928 Bacteria 2574
190 Ga0207700_10155649 3300025928 Bacteria 1893
191 Ga0207700_10271084 3300025928 Bacteria 1457
192 Ga0207664_10033925 3300025929 Bacteria 3927
193 Ga0207664_10042978 3300025929 Bacteria 3532
194 Ga0207690_10195695 3300025932 Unclassified 1532
195 Ga0207706_10020051 3300025933 Bacteria 6008
196 Ga0207706_10091693 3300025933 Bacteria 2671
197 Ga0207706_10439939 3300025933 Bacteria 1129
198 Ga0207686_10124122 3300025934 Bacteria 1762
199 Ga0207686_10186390 3300025934 Bacteria 1476
200 Ga0207709_10076904 3300025935 Bacteria 2138
201 Ga0207670_10343834 3300025936 Bacteria 1180
202 Ga0207669_10007774 3300025937 Bacteria 4988
203 Ga0207669_10025696 3300025937 Bacteria 3188
204 Ga0207704_10047456 3300025938 Bacteria 2567
205 Ga0207704_10062910 3300025938 Bacteria 2310
206 Ga0207691_10008622 3300025940 Bacteria 9784
207 Ga0207691_10485366 3300025940 Bacteria 1050
208 Ga0207711_10057375 3300025941 Bacteria 3347
209 Ga0207711_10132131 3300025941 Bacteria 2239
210 Ga0207689_10218536 3300025942 Bacteria 1574
211 Ga0207661_10002592 3300025944 Bacteria 12429
212 Ga0207661_10082244 3300025944 Bacteria 2662
213 Ga0207679_10088714 3300025945 Bacteria 2385
214 Ga0207679_10178509 3300025945 Bacteria 1755
215 Ga0207679_10382459 3300025945 Bacteria 1234
216 Ga0207667_10130970 3300025949 Bacteria 2583
217 Ga0207712_10269726 3300025961 Bacteria 1384
218 Ga0207668_10197199 3300025972 Bacteria 1600
219 Ga0207677_10137778 3300026023 Bacteria 1864
220 Ga0207639_10026875 3300026041 Bacteria 4185
221 Ga0207639_10233526 3300026041 Bacteria 1595
222 Ga0207708_10042408 3300026075 Bacteria 3468
223 Ga0207708_10089687 3300026075 Bacteria 2370
224 Ga0207641_10145279 3300026088 Bacteria 2144
225 Ga0207676_10063948 3300026095 Bacteria 2923
226 Ga0207676_10118826 3300026095 Bacteria 2225
227 Ga0207674_10077408 3300026116 Bacteria 3332
228 Ga0207675_100076363 3300026118 Bacteria 3137
229 Ga0207683_10005950 3300026121 Bacteria 10453
230 Ga0207683_10026040 3300026121 Bacteria 5051
231 Ga0207683_10053069 3300026121 Bacteria 3553
232 Ga0209588_1007089 3300027671 Bacteria 3286
233 Ga0207428_10069535 3300027907 Bacteria 2769
234 Ga0207428_10243375 3300027907 Bacteria 1343
235 Ga0268266_10001477 3300028379 Bacteria 27905
236 Ga0268266_10041790 3300028379 Bacteria 3914
237 Ga0268266_10068008 3300028379 Bacteria 3084
238 Ga0307515_10015628 3300028794 Bacteria 13968
239 Ga0265338_10023854 3300028800 Bacteria 6271
240 Ga0265763_1000457 3300030763 Bacteria 2460
241 Ga0265330_10004459 3300031235 Bacteria 7100
242 Ga0265325_10003580 3300031241 Bacteria 10077
243 Ga0265325_10012094 3300031241 Bacteria 4944
244 Ga0265339_10020772 3300031249 Bacteria 3830
245 Ga0307513_10053540 3300031456 Bacteria 4336
246 Ga0265313_10049064 3300031595 Bacteria 2034
247 Ga0265313_10087719 3300031595 Bacteria 1402
248 Ga0307508_10248798 3300031616 Bacteria 1374
249 Ga0265314_10190335 3300031711 Bacteria 1221
250 Ga0307410_10368946 3300031852 Bacteria 1152
251 Ga0373938_0013333 3300034957 Bacteria 1558
252 Ga0373926_0004418 3300035083 Bacteria 4612
253 Ga0373926_0018526 3300035083 Bacteria 2396
254 Ga0373929_0004260 3300035085 Bacteria 2566
255 Ga0373934_0027667 3300035086 Bacteria 2205
256 Ga0373944_0013978 3300035089 Bacteria 2235
257 Ga0373944_0019823 3300035089 Bacteria 1933
258 Ga0373944_0037262 3300035089 Bacteria 1489
259 Ga0373936_0076315 3300035113 Bacteria 1389
260 Ga0373939_0036948 3300035114 Bacteria 1448
261 Ga0373945_0039601 3300035116 Bacteria 1699
262 Ga0373956_0038541 3300035119 Bacteria 2115
263 Ga0373957_0059509 3300035120 Bacteria 1478
264 Ga0373943_0036286 3300035170 Bacteria 2360
265 Ga0373943_0092171 3300035170 Bacteria 1571
266 Ga0373946_0038766 3300035171 Bacteria 1942
267 Ga0373946_0061561 3300035171 Bacteria 1598
268 Ga0373961_0031546 3300035241 Bacteria 1481
269 Ga0373931_0028868 3300035691 Bacteria 2844
270 Ga0373931_0083459 3300035691 Bacteria 1767
271 Ga0373935_0074161 3300035692 Bacteria 2199
272 Ga0373935_0107795 3300035692 Bacteria 1845
273 Ga0373935_0217312 3300035692 Bacteria 1326
274 Ga0373927_0017773 3300035695 Bacteria 4678
275 Ga0373927_0108929 3300035695 Bacteria 1804
276 Ga0373927_0137719 3300035695 Bacteria 1596
277 Ga0373927_0201945 3300035695 Bacteria 1305
278 Ga0373927_0267350 3300035695 Bacteria 1124
279 Ga0373947_0008412 3300035725 Bacteria 5946
280 Ga0373947_0076912 3300035725 Bacteria 2058
281 Ga0373947_0168455 3300035725 Bacteria 1420
282 Ga0373947_0267981 3300035725 Bacteria 1133
283 Ga0373925_0007875 3300037068 Bacteria 7757
284 Ga0373925_0058926 3300037068 Bacteria 2879
285 Ga0395898_0404496 3300037466 Bacteria 1301
286 Ga0436365_0925272 3300039437 Bacteria 2488
287 Ga0436360_0766529 3300039438 Bacteria 1365
288 Ga0436363_1192890 3300039450 Bacteria 1870
289 Ga0451853_2358198 3300041512 Unclassified 1440
290 Ga0495603_0031861 3300046455 Bacteria 3173
291 Ga0495603_0067652 3300046455 Bacteria 2102
292 Ga0495629_0017644 3300046459 Bacteria 5116
293 Ga0495629_0025372 3300046459 Bacteria 4214
294 Ga0495638_0018852 3300046460 Bacteria 4574
295 Ga0495641_0026228 3300046461 Bacteria 2846
296 Ga0495651_0238765 3300046462 Bacteria 1248
297 Ga0495580_0237378 3300046472 Bacteria 1250
298 Ga0495580_0254253 3300046472 Bacteria 1202
299 Ga0495582_0004088 3300046473 Bacteria 8197
300 Ga0495582_0022856 3300046473 Bacteria 3420
301 Ga0495639_0023246 3300046475 Bacteria 2723
302 Ga0495662_0051211 3300046476 Bacteria 1993
303 Ga0495662_0061572 3300046476 Bacteria 1813
304 Ga0495664_0082305 3300046477 Bacteria 1930
305 Ga0495584_0062708 3300046491 Bacteria 1868
306 Ga0495594_0027346 3300046499 Bacteria 3073
307 Ga0495618_0155694 3300046514 Bacteria 1458
308 Ga0495628_0137503 3300046516 Bacteria 1866
309 Ga0495630_0005819 3300046517 Bacteria 8715
310 Ga0495630_0141849 3300046517 Bacteria 1827
311 Ga0495630_0169359 3300046517 Bacteria 1664
312 Ga0495644_0026702 3300046523 Bacteria 2190
313 Ga0495666_0006992 3300046526 Bacteria 5669
314 Ga0495666_0032540 3300046526 Bacteria 2551
315 Ga0495666_0097408 3300046526 Bacteria 1387
316 Ga0495652_0031188 3300046529 Bacteria 4670
317 Ga0495665_0110461 3300046531 Bacteria 1442
318 Ga0495640_0026230 3300046533 Bacteria 4213
319 Ga0495640_0031527 3300046533 Bacteria 3782
320 Ga0495640_0106910 3300046533 Bacteria 1832
321 Ga0495586_0047878 3300046535 Bacteria 2309
322 Ga0495587_0141551 3300046536 Bacteria 1373
323 Ga0495598_0018815 3300046537 Bacteria 1801
324 Ga0495645_0084768 3300046543 Bacteria 2269
325 Ga0495622_0093191 3300046557 Bacteria 1383
326 Ga0495622_0118644 3300046557 Bacteria 1209
327 Ga0495667_0098607 3300046559 Bacteria 1892
328 Ga0495656_0064839 3300046615 Bacteria 1605
329 Ga0495634_0150248 3300046642 Bacteria 1473
330 Ga0495635_0046826 3300046663 Bacteria 2983
331 Ga0495588_0016581 3300046674 Bacteria 3562
332 Ga0495646_0127944 3300046680 Bacteria 1432
333 Ga0495647_0003932 3300046681 Bacteria 4794
334 Ga0495647_0004537 3300046681 Bacteria 4518
335 Ga0495647_0059955 3300046681 Bacteria 1499
336 Ga0495658_0004145 3300046683 Bacteria 7140
337 Ga0495613_0026330 3300046689 Bacteria 4334
338 Ga0495613_0186790 3300046689 Bacteria 1466
339 Ga0495624_0022474 3300046690 Bacteria 4168
340 Ga0495624_0032827 3300046690 Bacteria 3364
341 Ga0495670_0204730 3300046691 Bacteria 1046
342 Ga0495589_0143302 3300046794 Bacteria 1143
343 Ga0495581_0026938 3300047315 Bacteria 3333
344 Ga0495581_0091523 3300047315 Bacteria 1765
345 Ga0495636_0132131 3300047318 Bacteria 1111
346 Ga0495674_0027349 3300047319 Bacteria 5212
347 Ga0495674_0126767 3300047319 Bacteria 2153
348 Ga0495674_0232801 3300047319 Bacteria 1520
349 Ga0495676_0047848 3300047321 Bacteria 3453
350 Ga0495680_0190298 3300047322 Bacteria 1476
351 Ga0495685_065304 3300047447 Bacteria 1223
352 Ga0495684_0018627 3300047471 Bacteria 5349
353 Ga0495684_0326002 3300047471 Unclassified 1097
354 Ga0495593_0123881 3300047673 Bacteria 1314
355 Ga0495615_0004059 3300048090 Bacteria 2518
356 Ga0496100_0003516 3300048903 Bacteria 8181
357 Ga0496100_0124596 3300048903 Bacteria 1807
358 Ga0496101_0000882 3300048904 Bacteria 17656
359 Ga0496102_0007445 3300048905 Bacteria 9354
360 Ga0496103_0023399 3300048906 Bacteria 3725
361 Ga0496104_0004310 3300048907 Bacteria 12374
362 Ga0496104_0030818 3300048907 Bacteria 4986
363 Ga0496104_0036622 3300048907 Bacteria 4587
364 Ga0496104_0261436 3300048907 Bacteria 1643
365 Ga0496104_0485798 3300048907 Bacteria 1146
366 Ga0496105_0009965 3300048908 Bacteria 7455
367 Ga0496105_0121015 3300048908 Bacteria 2158
368 Ga0496107_0002052 3300048910 Bacteria 12878
369 Ga0496108_0030426 3300048911 Bacteria 4474
370 Ga0496108_0180491 3300048911 Bacteria 1828
371 Ga0496108_0259090 3300048911 Bacteria 1513
372 Ga0496109_0033579 3300048912 Bacteria 4616
373 Ga0496109_0090284 3300048912 Bacteria 2833
374 Ga0496110_0043359 3300048913 Bacteria 3928
375 Ga0496110_0050274 3300048913 Bacteria 3660
376 Ga0496110_0102532 3300048913 Bacteria 2566
377 Ga0496110_0229802 3300048913 Bacteria 1687
378 Ga0496111_0049167 3300048914 Bacteria 3040
379 Ga0496111_0118689 3300048914 Bacteria 1953
380 Ga0496111_0134674 3300048914 Bacteria 1830
381 Ga0496112_0000018 3300048915 Bacteria 188820
382 Ga0496112_0124879 3300048915 Bacteria 2544
383 Ga0496112_0132685 3300048915 Bacteria 2461
384 Ga0496112_0431224 3300048915 Bacteria 1256
385 Ga0496113_0080339 3300048916 Bacteria 2498
386 Ga0496113_0104182 3300048916 Bacteria 2201
387 Ga0496113_0280986 3300048916 Bacteria 1331
388 Ga0496114_0081276 3300048917 Bacteria 2737
389 Ga0496114_0108135 3300048917 Bacteria 2380
390 Ga0496115_0000999 3300048918 Bacteria 20514
391 Ga0496115_0023565 3300048918 Bacteria 4776
392 Ga0496115_0072199 3300048918 Bacteria 2800
393 Ga0496115_0393366 3300048918 Bacteria 1125
394 Ga0496126_0231771 3300048929 Bacteria 1547
395 nmdc:mga03683_21361_c1 3300050489 Bacteria 2494
396 nmdc:mga03n38_100_c1 3300050490 Bacteria 19063
397 nmdc:mga03n38_1955_c1 3300050490 Bacteria 6183
398 nmdc:mga00v17_23308_c1 3300050491 Bacteria 3580
399 nmdc:mga0yw44_19516_c1 3300050492 Bacteria 3740
400 nmdc:mga0yw44_3055_c1 3300050492 Bacteria 7326
401 nmdc:mga06z11_52066_c1 3300050494 Bacteria 2099
402 nmdc:mga06z11_65421_c1 3300050494 Bacteria 1908
403 nmdc:mga04h51_11829_c1 3300050495 Bacteria 2433
404 nmdc:mga07m45_56726_c1 3300050496 Bacteria 2214
405 nmdc:mga07m45_985_c1 3300050496 Bacteria 12546
406 nmdc:mga05p37_1087_c1 3300050507 Bacteria 31201
407 nmdc:mga05p37_260215_c1 3300050507 Bacteria 2077
408 nmdc:mga05p37_30102_c1 3300050507 Bacteria 6624
409 nmdc:mga05p37_6148_c1 3300050507 Bacteria 14129
410 nmdc:mga09592_119001_c1 3300050508 Bacteria 2268
411 nmdc:mga09592_28219_c1 3300050508 Bacteria 4234
412 nmdc:mga0qj67_21651_c1 3300050509 Bacteria 4932
413 nmdc:mga0qj67_6420_c1 3300050509 Bacteria 8641
414 nmdc:mga06r32_1256_c1 3300050510 Bacteria 22789
415 nmdc:mga06r32_4239_c1 3300050510 Bacteria 12849
416 nmdc:mga06r32_46706_c1 3300050510 Bacteria 4132
417 nmdc:mga06r32_79896_c1 3300050510 Bacteria 3182
418 nmdc:mga08y16_130304_c1 3300050511 Bacteria 2616
419 nmdc:mga08y16_190048_c1 3300050511 Bacteria 2130
420 nmdc:mga08y16_24996_c1 3300050511 Bacteria 6301
421 nmdc:mga08y16_275980_c1 3300050511 Bacteria 1734
422 nmdc:mga08y16_378_c1 3300050511 Bacteria 40548
423 nmdc:mga08y16_39841_c1 3300050511 Bacteria 4928
424 nmdc:mga08y16_95856_c1 3300050511 Bacteria 3090
425 nmdc:mga0n895_12048_c1 3300050512 Bacteria 7741
426 nmdc:mga0n895_49350_c1 3300050512 Bacteria 4123
427 nmdc:mga0rr50_12572_c1 3300050513 Bacteria 5478
428 nmdc:mga08x19_10243_c1 3300050514 Bacteria 5625
429 nmdc:mga0a205_13619_c1 3300050515 Bacteria 7577
430 nmdc:mga0a205_2606_c1 3300050515 Bacteria 15926
431 Ga0495601_0075222 3300053077 Bacteria 2161
432 Ga0495601_0120187 3300053077 Bacteria 1706
433 Ga0495601_0217002 3300053077 Bacteria 1249
434 Ga0495612_0023576 3300053078 Bacteria 2470
435 Ga0495612_0126996 3300053078 Bacteria 1100
436 Ga0495619_0008723 3300053085 Bacteria 6411
437 Ga0495619_0189439 3300053085 Bacteria 1424
438 Ga0495619_0195612 3300053085 Bacteria 1400
439 Ga0495619_0266134 3300053085 Unclassified 1188
440 Ga0500646_0016577 3300053090 Bacteria 1925
441 Ga0500641_0016521 3300053096 Bacteria 2749
442 Ga0500589_116279 3300053147 Bacteria 1139
443 Ga0500645_038948 3300053730 Bacteria 1409
444 2922364565 2922361189 Bacteria 7436256
445 Ga0081455_10252611
446 Ga0070683_100118697
447 Ga0070670_100086499
448 Ga0070677_10004327
449 Ga0070680_100012612
450 Ga0070680_100059584
451 Ga0070691_10022774
452 Ga0070661_100132015
453 Ga0070675_100241223
454 Ga0070671_100037932
455 Ga0070674_100002285
456 Ga0070674_100041844
457 Ga0070674_100076339
458 Ga0070674_100395441
459 Ga0070688_100155479
460 Ga0070659_100193128
461 Ga0070703_10059151
462 Ga0070709_10037466
463 Ga0070709_10257899
464 Ga0070714_100189183
465 Ga0070713_100016936
466 Ga0070713_100104412
467 Ga0070694_100087070
468 Ga0070708_100027678
469 Ga0070708_100096092
470 Ga0070678_100006177
471 Ga0070662_100222737
472 Ga0070662_100235870
473 Ga0070681_10050801
474 Ga0070681_10051746
475 Ga0070706_100037824
476 Ga0070706_100093078
477 Ga0070707_100064482
478 Ga0070707_100080550
479 Ga0070707_100304491
480 Ga0070698_100026261
481 Ga0070698_100037683
482 Ga0070698_100138537
483 Ga0070698_100140702
484 Ga0070698_100225714
485 Ga0070699_100101629
486 Ga0070699_100360520
487 Ga0070679_100006392
488 Ga0070679_100041834
489 Ga0070684_100007810
490 Ga0070697_100017773
491 Ga0070697_100096522
492 Ga0070697_100174329
493 Ga0070697_100277865
494 Ga0070672_100416927
495 Ga0070686_100330929
496 Ga0070695_100007726
497 Ga0070665_100003540
498 Ga0070665_100058674
499 Ga0068855_100098261
500 Ga0068855_100220165
501 Ga0070664_100150389
502 Ga0070664_100160502
503 Ga0070664_100173824
504 Ga0068852_100319422
505 Ga0068859_100482382
506 Ga0068863_100071429
507 Ga0081455_10007366
508 Ga0081455_10010462
509 Ga0081455_10011190
510 Ga0081455_10056999
511 Ga0081455_10063747
512 Ga0081455_10088801
513 Ga0081455_10137570
514 Ga0081455_10225078
515 Ga0081540_1000544
516 Ga0081540_1002136
517 Ga0081540_1003603
518 Ga0081540_1006790
519 Ga0081540_1006999
520 Ga0081540_1027403
521 Ga0081539_10000349
522 Ga0070717_10014721
523 Ga0070717_10017948
524 Ga0070717_10051144
525 Ga0070717_10134836
526 Ga0070717_10221529
527 Ga0075365_10006962
528 Ga0075365_10013465
529 Ga0075368_10016726
530 Ga0075363_100000598
531 Ga0075363_100002599
532 Ga0075363_100075212
533 Ga0075364_10011289
534 Ga0070715_10013807
535 Ga0070716_100004138
536 Ga0075362_10046876
537 Ga0097621_100171917
538 Ga0075370_10007192
539 Ga0068871_100075615
540 Ga0075428_100073970
541 Ga0075428_100128638
542 Ga0075428_100201819
543 Ga0075428_100391980
544 Ga0075428_100480532
545 Ga0075428_100553242
546 Ga0075430_100003193
547 Ga0075430_100088570
548 Ga0075430_100129706
549 Ga0075431_100000947
550 Ga0075431_100004344
551 Ga0075431_100006046
552 Ga0075431_100044322
553 Ga0075431_100091634
554 Ga0075431_100457138
555 Ga0075433_10004731
556 Ga0075433_10029204
557 Ga0075434_100045634
558 Ga0075434_100268453
559 Ga0075429_100011015
560 Ga0075429_100025543
561 Ga0075429_100111788
562 Ga0075436_100014720
563 Ga0075436_100183606
564 Ga0097620_100482411
565 Ga0075435_100021858
566 Ga0075435_100089584
567 Ga0075435_100295611
568 Ga0099794_10017602
569 Ga0099795_10000918
570 Ga0099795_10005860
571 Ga0099795_10015846
572 Ga0099795_10024124
573 Ga0105240_10305568
574 Ga0111539_10005180
575 Ga0111539_10023449
576 Ga0111539_10045817
577 Ga0111539_10112347
578 Ga0111539_10507895
579 Ga0105245_10012692
580 Ga0105247_10017231
581 Ga0105247_10107663
582 Ga0114129_10015591
583 Ga0114129_10071368
584 Ga0114129_10330086
585 Ga0114129_10908463
586 Ga0105243_10105702
587 Ga0105241_10060150
588 Ga0105248_10163786
589 Ga0105248_10368368
590 Ga0105249_10045411
591 Ga0099796_10015110
592 Ga0099796_10017919
593 Ga0099796_10090866
594 Ga0105239_10042725
595 Ga0105239_10132217
596 Ga0105246_10040524
597 Ga0157369_10043913
598 Ga0163162_10051650
599 Ga0157372_10186059
600 Ga0157375_10013598
601 Ga0157375_10062627
602 Ga0157375_10676248
603 Ga0163163_10077677
604 Ga0157379_10085308
605 Ga0157376_10034654
606 Ga0163161_10032272
607 Ga0163161_10055912
608 Ga0213871_10012152
609 Ga0207682_10003304
610 Ga0207692_10039921
611 Ga0207643_10280128
612 Ga0207705_10262546
613 Ga0207684_10019430
614 Ga0207684_10022991
615 Ga0207684_10073369
616 Ga0207684_10094193
617 Ga0207707_10000316
618 Ga0207707_10099729
619 Ga0207693_10118646
620 Ga0207693_10128935
621 Ga0207660_10048754
622 Ga0207662_10053946
623 Ga0207657_10088504
624 Ga0207652_10006025
625 Ga0207652_10211057
626 Ga0207646_10053417
627 Ga0207646_10228177
628 Ga0207694_10383468
629 Ga0207650_10253850
630 Ga0207659_10094310
631 Ga0207659_10180551
632 Ga0207700_10035767
633 Ga0207700_10078060
634 Ga0207700_10155649
635 Ga0207700_10271084
636 Ga0207664_10033925
637 Ga0207664_10042978
638 Ga0207690_10195695
639 Ga0207706_10020051
640 Ga0207706_10091693
641 Ga0207706_10439939
642 Ga0207686_10124122
643 Ga0207686_10186390
644 Ga0207709_10076904
645 Ga0207670_10343834
646 Ga0207669_10007774
647 Ga0207669_10025696
648 Ga0207704_10047456
649 Ga0207704_10062910
650 Ga0207691_10008622
651 Ga0207691_10485366
652 Ga0207711_10057375
653 Ga0207711_10132131
654 Ga0207689_10218536
655 Ga0207661_10002592
656 Ga0207661_10082244
657 Ga0207679_10088714
658 Ga0207679_10178509
659 Ga0207679_10382459
660 Ga0207667_10130970
661 Ga0207712_10269726
662 Ga0207668_10197199
663 Ga0207677_10137778
664 Ga0207639_10026875
665 Ga0207639_10233526
666 Ga0207708_10042408
667 Ga0207708_10089687
668 Ga0207641_10145279
669 Ga0207676_10063948
670 Ga0207676_10118826
671 Ga0207674_10077408
672 Ga0207675_100076363
673 Ga0207683_10005950
674 Ga0207683_10026040
675 Ga0207683_10053069
676 Ga0209588_1007089
677 Ga0207428_10069535
678 Ga0207428_10243375
679 Ga0268266_10001477
680 Ga0268266_10041790
681 Ga0268266_10068008
682 Ga0307515_10015628
683 Ga0265338_10023854
684 Ga0265763_1000457
685 Ga0265330_10004459
686 Ga0265325_10003580
687 Ga0265325_10012094
688 Ga0265339_10020772
689 Ga0307513_10053540
690 Ga0265313_10049064
691 Ga0265313_10087719
692 Ga0307508_10248798
693 Ga0265314_10190335
694 Ga0307410_10368946
695 Ga0373938_0013333
696 Ga0373926_0004418
697 Ga0373926_0018526
698 Ga0373929_0004260
699 Ga0373934_0027667
700 Ga0373944_0013978
701 Ga0373944_0019823
702 Ga0373944_0037262
703 Ga0373936_0076315
704 Ga0373939_0036948
705 Ga0373945_0039601
706 Ga0373956_0038541
707 Ga0373957_0059509
708 Ga0373943_0036286
709 Ga0373943_0092171
710 Ga0373946_0038766
711 Ga0373946_0061561
712 Ga0373961_0031546
713 Ga0373931_0028868
714 Ga0373931_0083459
715 Ga0373935_0074161
716 Ga0373935_0107795
717 Ga0373935_0217312
718 Ga0373927_0017773
719 Ga0373927_0108929
720 Ga0373927_0137719
721 Ga0373927_0201945
722 Ga0373927_0267350
723 Ga0373947_0008412
724 Ga0373947_0076912
725 Ga0373947_0168455
726 Ga0373947_0267981
727 Ga0373925_0007875
728 Ga0373925_0058926
729 Ga0395898_0404496
730 Ga0436365_0925272
731 Ga0436360_0766529
732 Ga0436363_1192890
733 Ga0451853_2358198
734 Ga0495603_0031861
735 Ga0495603_0067652
736 Ga0495629_0017644
737 Ga0495629_0025372
738 Ga0495638_0018852
739 Ga0495641_0026228
740 Ga0495651_0238765
741 Ga0495580_0237378
742 Ga0495580_0254253
743 Ga0495582_0004088
744 Ga0495582_0022856
745 Ga0495639_0023246
746 Ga0495662_0051211
747 Ga0495662_0061572
748 Ga0495664_0082305
749 Ga0495584_0062708
750 Ga0495594_0027346
751 Ga0495618_0155694
752 Ga0495628_0137503
753 Ga0495630_0005819
754 Ga0495630_0141849
755 Ga0495630_0169359
756 Ga0495644_0026702
757 Ga0495666_0006992
758 Ga0495666_0032540
759 Ga0495666_0097408
760 Ga0495652_0031188
761 Ga0495665_0110461
762 Ga0495640_0026230
763 Ga0495640_0031527
764 Ga0495640_0106910
765 Ga0495586_0047878
766 Ga0495587_0141551
767 Ga0495598_0018815
768 Ga0495645_0084768
769 Ga0495622_0093191
770 Ga0495622_0118644
771 Ga0495667_0098607
772 Ga0495656_0064839
773 Ga0495634_0150248
774 Ga0495635_0046826
775 Ga0495588_0016581
776 Ga0495646_0127944
777 Ga0495647_0003932
778 Ga0495647_0004537
779 Ga0495647_0059955
780 Ga0495658_0004145
781 Ga0495613_0026330
782 Ga0495613_0186790
783 Ga0495624_0022474
784 Ga0495624_0032827
785 Ga0495670_0204730
786 Ga0495589_0143302
787 Ga0495581_0026938
788 Ga0495581_0091523
789 Ga0495636_0132131
790 Ga0495674_0027349
791 Ga0495674_0126767
792 Ga0495674_0232801
793 Ga0495676_0047848
794 Ga0495680_0190298
795 Ga0495685_065304
796 Ga0495684_0018627
797 Ga0495684_0326002
798 Ga0495593_0123881
799 Ga0495615_0004059
800 Ga0496100_0003516
801 Ga0496100_0124596
802 Ga0496101_0000882
803 Ga0496102_0007445
804 Ga0496103_0023399
805 Ga0496104_0004310
806 Ga0496104_0030818
807 Ga0496104_0036622
808 Ga0496104_0261436
809 Ga0496104_0485798
810 Ga0496105_0009965
811 Ga0496105_0121015
812 Ga0496107_0002052
813 Ga0496108_0030426
814 Ga0496108_0180491
815 Ga0496108_0259090
816 Ga0496109_0033579
817 Ga0496109_0090284
818 Ga0496110_0043359
819 Ga0496110_0050274
820 Ga0496110_0102532
821 Ga0496110_0229802
822 Ga0496111_0049167
823 Ga0496111_0118689
824 Ga0496111_0134674
825 Ga0496112_0000018
826 Ga0496112_0124879
827 Ga0496112_0132685
828 Ga0496112_0431224
829 Ga0496113_0080339
830 Ga0496113_0104182
831 Ga0496113_0280986
832 Ga0496114_0081276
833 Ga0496114_0108135
834 Ga0496115_0000999
835 Ga0496115_0023565
836 Ga0496115_0072199
837 Ga0496115_0393366
838 Ga0496126_0231771
839 nmdc:mga03683_21361_c1
840 nmdc:mga03n38_100_c1
841 nmdc:mga03n38_1955_c1
842 nmdc:mga00v17_23308_c1
843 nmdc:mga0yw44_19516_c1
844 nmdc:mga0yw44_3055_c1
845 nmdc:mga06z11_52066_c1
846 nmdc:mga06z11_65421_c1
847 nmdc:mga04h51_11829_c1
848 nmdc:mga07m45_56726_c1
849 nmdc:mga07m45_985_c1
850 nmdc:mga05p37_1087_c1
851 nmdc:mga05p37_260215_c1
852 nmdc:mga05p37_30102_c1
853 nmdc:mga05p37_6148_c1
854 nmdc:mga09592_119001_c1
855 nmdc:mga09592_28219_c1
856 nmdc:mga0qj67_21651_c1
857 nmdc:mga0qj67_6420_c1
858 nmdc:mga06r32_1256_c1
859 nmdc:mga06r32_4239_c1
860 nmdc:mga06r32_46706_c1
861 nmdc:mga06r32_79896_c1
862 nmdc:mga08y16_130304_c1
863 nmdc:mga08y16_190048_c1
864 nmdc:mga08y16_24996_c1
865 nmdc:mga08y16_275980_c1
866 nmdc:mga08y16_378_c1
867 nmdc:mga08y16_39841_c1
868 nmdc:mga08y16_95856_c1
869 nmdc:mga0n895_12048_c1
870 nmdc:mga0n895_49350_c1
871 nmdc:mga0rr50_12572_c1
872 nmdc:mga08x19_10243_c1
873 nmdc:mga0a205_13619_c1
874 nmdc:mga0a205_2606_c1
875 Ga0495601_0075222
876 Ga0495601_0120187
877 Ga0495601_0217002
878 Ga0495612_0023576
879 Ga0495612_0126996
880 Ga0495619_0008723
881 Ga0495619_0189439
882 Ga0495619_0195612
883 Ga0495619_0266134
884 Ga0500646_0016577
885 Ga0500641_0016521
886 Ga0500589_116279
887 Ga0500645_038948
888 2922364565

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

50

320

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9519 31 325
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9466 30 323
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9457 31 325
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9348 30 325
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9324 34 325
ID Description Score Start End Superfamily
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.961 129 250 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9576 129 243 3.40.190.10
2dvzA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9491 128 243 3.40.190.10
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9437 30 325 3.40.190.150
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9387 129 250 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A519I8E8-F1-model_v4 deleted 0.9821 105 325
AF-A0A208XL05-F1-model_v4 LacI family transcriptional regulator 0.9785 30 325
AF-A0A439F197-F1-model_v4 deleted 0.9784 84 325
AF-A0A261UKM0-F1-model_v4 ABC transporter substrate-binding protein 0.9776 30 325
AF-A0A2R4XH22-F1-model_v4 LacI family transcriptional regulator 0.9766 27 325

Map