F445204

General Info

Members Datasets Scaffolds Average Seq Length
444 260 888 211

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10193624|rootL2_101936243
Length 234
Sequence MFPKTNHIDALANGSSPSILRAMNIGIIGSGEVAQTLGGGFAKHGHAVMLGTREPAKLADWAKTVRGARVGSFAETARFGEVLVLAVKGSVVEQALRAAGVENLASKVVIDATNPIADQPPTNGVLAFTTNLSESMMERLQREFPRARFVKAFNSVGSACMVNPQFPGGKPTMFICGNDDAAKKTVASLLDQFGWETEDMGKVEAARAIEPLCILWCIPGFLRNDWVHAFKMLR

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
99 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
155 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
156 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
157 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
158 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
159 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
160 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
161 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
162 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
163 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
164 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
165 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
166 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
167 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
170 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
173 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
174 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
175 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
176 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
199 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
200 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
201 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
207 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
208 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
213 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
214 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
253 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
254 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
255 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
256 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
258 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
259 2738541278 Niastella sp. CF465 Isolate Unclassified
260 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 0.45
Isolates 0.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.7
Nodule 0
Rhizoplane 0.23
Rhizosphere 94.82
Stem 0
Stem Tuber 0
Unclassified 13.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10193624 3300003322 Unclassified 3424
2 JGI24751J29686_10000521 3300002459 Bacteria 11034
3 rootH2_10019078 3300003320 Bacteria 10480
4 rootH2_10023354 3300003320 Bacteria 3134
5 rootL2_10248158 3300003322 Bacteria 1720
6 rootH1_10051194 3300003323 Bacteria 12062
7 rootH1_10062555 3300003323 Bacteria 4134
8 JGI25160J50197_1008798 3300003354 Bacteria 3810
9 Ga0065712_10242335 3300005290 Bacteria 981
10 Ga0065715_10130088 3300005293 Bacteria 2033
11 Ga0070658_10023380 3300005327 Bacteria 4961
12 Ga0070676_10075357 3300005328 Bacteria 2034
13 Ga0070683_100001753 3300005329 Bacteria 16903
14 Ga0070683_100002150 3300005329 Bacteria 15576
15 Ga0070683_100007665 3300005329 Bacteria 9135
16 Ga0070683_100306117 3300005329 Bacteria 1512
17 Ga0070690_100021007 3300005330 Bacteria 3983
18 Ga0070670_100003899 3300005331 Bacteria 12444
19 Ga0070670_100069456 3300005331 Bacteria 3024
20 Ga0070670_100168879 3300005331 Unclassified 1897
21 Ga0070670_100512089 3300005331 Bacteria 1068
22 Ga0068869_100003245 3300005334 Bacteria 9943
23 Ga0068869_100713936 3300005334 Unclassified 856
24 Ga0070666_10314562 3300005335 Bacteria 1116
25 Ga0070680_100110526 3300005336 Bacteria 2288
26 Ga0068868_100000062 3300005338 Bacteria 61833
27 Ga0068868_100066264 3300005338 Bacteria 2871
28 Ga0070660_100207432 3300005339 Bacteria 1590
29 Ga0070689_100004251 3300005340 Bacteria 9651
30 Ga0070689_100423734 3300005340 Bacteria 1128
31 Ga0070661_100000673 3300005344 Bacteria 25107
32 Ga0070661_100032635 3300005344 Bacteria 3768
33 Ga0070661_100170038 3300005344 Bacteria 1655
34 Ga0070675_100063510 3300005354 Bacteria 3053
35 Ga0070671_100008119 3300005355 Bacteria 8405
36 Ga0070671_100595914 3300005355 Bacteria 955
37 Ga0070673_100051646 3300005364 Bacteria 3221
38 Ga0070688_100000971 3300005365 Bacteria 14355
39 Ga0070688_100002447 3300005365 Bacteria 9386
40 Ga0070659_100013267 3300005366 Bacteria 6128
41 Ga0070659_100061280 3300005366 Bacteria 2973
42 Ga0070667_100003064 3300005367 Bacteria 14372
43 Ga0070714_100561441 3300005435 Bacteria 1093
44 Ga0070713_100051569 3300005436 Bacteria 3403
45 Ga0070705_100088934 3300005440 Bacteria 1919
46 Ga0070694_100225579 3300005444 Bacteria 1407
47 Ga0070708_100008340 3300005445 Bacteria 8321
48 Ga0070663_100236541 3300005455 Bacteria 1440
49 Ga0070662_100033109 3300005457 Bacteria 3637
50 Ga0070681_10005678 3300005458 Bacteria 12063
51 Ga0068867_100174795 3300005459 Bacteria 1703
52 Ga0070685_10018698 3300005466 Bacteria 3730
53 Ga0070706_100006253 3300005467 Bacteria 11262
54 Ga0070707_100448551 3300005468 Unclassified 1251
55 Ga0070698_100031898 3300005471 Bacteria 5461
56 Ga0070679_100307238 3300005530 Bacteria 1536
57 Ga0070684_100000308 3300005535 Bacteria 33720
58 Ga0070684_100024863 3300005535 Bacteria 5027
59 Ga0070684_100043930 3300005535 Unclassified 3862
60 Ga0068853_100000957 3300005539 Bacteria 20289
61 Ga0068853_100027344 3300005539 Bacteria 4792
62 Ga0068853_100113811 3300005539 Bacteria 2406
63 Ga0068853_100432219 3300005539 Bacteria 1236
64 Ga0070672_100210846 3300005543 Bacteria 1627
65 Ga0070695_100090929 3300005545 Bacteria 2038
66 Ga0070693_100085245 3300005547 Bacteria 1893
67 Ga0070665_100622661 3300005548 Bacteria 1092
68 Ga0068855_100011690 3300005563 Bacteria 10608
69 Ga0068855_100384224 3300005563 Bacteria 1541
70 Ga0068855_100541455 3300005563 Bacteria 1261
71 Ga0070664_100000958 3300005564 Bacteria 22561
72 Ga0070664_100053139 3300005564 Bacteria 3433
73 Ga0070664_100061033 3300005564 Bacteria 3212
74 Ga0070664_100184528 3300005564 Bacteria 1856
75 Ga0068857_100003744 3300005577 Bacteria 12777
76 Ga0068857_100200769 3300005577 Bacteria 1818
77 Ga0068857_100258034 3300005577 Bacteria 1599
78 Ga0068857_100289826 3300005577 Bacteria 1507
79 Ga0068857_100834577 3300005577 Bacteria 881
80 Ga0068854_100898773 3300005578 Unclassified 778
81 Ga0068856_100003368 3300005614 Bacteria 16197
82 Ga0068856_100149584 3300005614 Unclassified 2344
83 Ga0068856_100190918 3300005614 Bacteria 2062
84 Ga0068856_100717041 3300005614 Bacteria 1020
85 Ga0068852_100012927 3300005616 Bacteria 6366
86 Ga0068852_100045799 3300005616 Bacteria 3723
87 Ga0068859_100005532 3300005617 Bacteria 12867
88 Ga0068859_100452777 3300005617 Bacteria 1380
89 Ga0068864_100018520 3300005618 Bacteria 5819
90 Ga0068864_100036344 3300005618 Bacteria 4198
91 Ga0068864_100055845 3300005618 Bacteria 3411
92 Ga0068864_100858506 3300005618 Bacteria 895
93 Ga0068864_100925226 3300005618 Unclassified 862
94 Ga0068851_10018564 3300005834 Bacteria 3351
95 Ga0068863_100003463 3300005841 Bacteria 15567
96 Ga0068863_100933743 3300005841 Unclassified 869
97 Ga0068858_100016948 3300005842 Bacteria 6840
98 Ga0068858_100094769 3300005842 Unclassified 2781
99 Ga0068860_100001338 3300005843 Bacteria 26804
100 Ga0068860_100020337 3300005843 Bacteria 6429
101 Ga0075363_100118598 3300006048 Bacteria 1476
102 Ga0075364_10254514 3300006051 Bacteria 1193
103 Ga0075362_10025058 3300006177 Bacteria 2535
104 Ga0097621_100010637 3300006237 Bacteria 6742
105 Ga0097621_100046336 3300006237 Bacteria 3518
106 Ga0097621_100264475 3300006237 Bacteria 1510
107 Ga0068871_100003816 3300006358 Bacteria 10390
108 Ga0068871_100022149 3300006358 Bacteria 4898
109 Ga0075428_100029946 3300006844 Bacteria 6021
110 Ga0075428_100198281 3300006844 Bacteria 2171
111 Ga0075430_100007829 3300006846 Bacteria 9028
112 Ga0075430_100034494 3300006846 Bacteria 4294
113 Ga0075431_100019195 3300006847 Bacteria 6968
114 Ga0075431_100023428 3300006847 Bacteria 6316
115 Ga0075431_101059177 3300006847 Bacteria 776
116 Ga0075434_100030185 3300006871 Bacteria 5337
117 Ga0075434_100314217 3300006871 Bacteria 1587
118 Ga0075429_100003535 3300006880 Bacteria 13310
119 Ga0075436_100006015 3300006914 Bacteria 8330
120 Ga0097620_100005532 3300006931 Bacteria 12867
121 Ga0097620_100452769 3300006931 Bacteria 1380
122 Ga0075435_100324440 3300007076 Unclassified 1318
123 Ga0105240_10001229 3300009093 Bacteria 44532
124 Ga0105240_10313590 3300009093 Bacteria 1790
125 Ga0105240_10452278 3300009093 Bacteria 1437
126 Ga0111539_10192315 3300009094 Bacteria 2381
127 Ga0111539_10801238 3300009094 Bacteria 1096
128 Ga0105245_10002214 3300009098 Bacteria 17597
129 Ga0105247_10003653 3300009101 Bacteria 9994
130 Ga0105247_10022808 3300009101 Bacteria 3770
131 Ga0114129_10171051 3300009147 Bacteria 2962
132 Ga0114129_10194926 3300009147 Bacteria 2748
133 Ga0114129_10284338 3300009147 Bacteria 2209
134 Ga0105241_10003386 3300009174 Bacteria 11875
135 Ga0105242_10235776 3300009176 Bacteria 1642
136 Ga0105242_10321563 3300009176 Bacteria 1419
137 Ga0105248_10024590 3300009177 Bacteria 6697
138 Ga0105248_10033051 3300009177 Bacteria 5778
139 Ga0105248_10183197 3300009177 Bacteria 2360
140 Ga0105237_10008153 3300009545 Bacteria 11375
141 Ga0105238_10092738 3300009551 Bacteria 3008
142 Ga0105238_10186356 3300009551 Unclassified 2052
143 Ga0105249_10001852 3300009553 Bacteria 18368
144 Ga0105249_10153476 3300009553 Bacteria 2219
145 Ga0105239_10049883 3300010375 Bacteria 4590
146 Ga0105239_10109378 3300010375 Bacteria 3063
147 Ga0105246_10003821 3300011119 Bacteria 9130
148 Ga0157373_10007851 3300013100 Bacteria 7936
149 Ga0157373_10081911 3300013100 Bacteria 2275
150 Ga0157371_10008983 3300013102 Bacteria 7902
151 Ga0157371_10138258 3300013102 Bacteria 1735
152 Ga0157370_10007482 3300013104 Bacteria 11862
153 Ga0157370_10139733 3300013104 Bacteria 2257
154 Ga0157369_10015758 3300013105 Bacteria 8517
155 Ga0157369_10085847 3300013105 Bacteria 3362
156 Ga0157369_10186197 3300013105 Bacteria 2183
157 Ga0157369_10632850 3300013105 Bacteria 1104
158 Ga0157374_10012934 3300013296 Bacteria 7273
159 Ga0157374_10068954 3300013296 Bacteria 3329
160 Ga0157374_10387326 3300013296 Bacteria 1393
161 Ga0157374_10778258 3300013296 Bacteria 972
162 Ga0157378_10009847 3300013297 Bacteria 8333
163 Ga0157378_10011826 3300013297 Bacteria 7640
164 Ga0163162_10001051 3300013306 Bacteria 25638
165 Ga0163162_10127727 3300013306 Unclassified 2650
166 Ga0157372_10000617 3300013307 Bacteria 38817
167 Ga0157372_10049790 3300013307 Bacteria 4660
168 Ga0157372_10106486 3300013307 Bacteria 3207
169 Ga0157372_10279817 3300013307 Unclassified 1940
170 Ga0157372_10556604 3300013307 Bacteria 1337
171 Ga0157375_10024293 3300013308 Bacteria 5606
172 Ga0157375_10628797 3300013308 Bacteria 1231
173 Ga0163163_10001503 3300014325 Bacteria 19711
174 Ga0157380_10139346 3300014326 Bacteria 2081
175 Ga0157380_10321329 3300014326 Bacteria 1435
176 Ga0157380_10543335 3300014326 Unclassified 1138
177 Ga0157380_10619534 3300014326 Bacteria 1074
178 Ga0157379_10004876 3300014968 Bacteria 11525
179 Ga0157379_10497947 3300014968 Bacteria 1129
180 Ga0157376_10009671 3300014969 Bacteria 7016
181 Ga0163161_10020562 3300017792 Unclassified 4634
182 Ga0209436_101240 3300025208 Bacteria 9208
183 Ga0209130_1000912 3300025284 Bacteria 23794
184 Ga0207426_1000310 3300025302 Bacteria 96036
185 Ga0207656_10044881 3300025321 Bacteria 1889
186 Ga0207656_10193134 3300025321 Bacteria 981
187 Ga0207710_10000509 3300025900 Bacteria 24244
188 Ga0207710_10005141 3300025900 Bacteria 5657
189 Ga0207680_10225794 3300025903 Bacteria 1285
190 Ga0207645_10562819 3300025907 Unclassified 773
191 Ga0207643_10014642 3300025908 Bacteria 4264
192 Ga0207705_10013699 3300025909 Bacteria 5850
193 Ga0207705_10032356 3300025909 Bacteria 3737
194 Ga0207654_10000637 3300025911 Bacteria 19819
195 Ga0207707_10009098 3300025912 Bacteria 8629
196 Ga0207707_10301683 3300025912 Bacteria 1385
197 Ga0207695_10000752 3300025913 Bacteria 62273
198 Ga0207695_10234542 3300025913 Bacteria 1738
199 Ga0207695_10525148 3300025913 Bacteria 1065
200 Ga0207671_10000376 3300025914 Bacteria 63349
201 Ga0207660_10117878 3300025917 Bacteria 2007
202 Ga0207662_10001794 3300025918 Bacteria 10537
203 Ga0207657_10008680 3300025919 Bacteria 10288
204 Ga0207657_10490568 3300025919 Unclassified 963
205 Ga0207649_10000652 3300025920 Bacteria 23164
206 Ga0207649_10026624 3300025920 Bacteria 3385
207 Ga0207649_10065383 3300025920 Bacteria 2302
208 Ga0207649_10105985 3300025920 Bacteria 1869
209 Ga0207652_10264122 3300025921 Bacteria 1553
210 Ga0207681_10134782 3300025923 Bacteria 1831
211 Ga0207681_10360728 3300025923 Bacteria 1165
212 Ga0207694_10000302 3300025924 Bacteria 46415
213 Ga0207650_10001852 3300025925 Bacteria 14913
214 Ga0207650_10153161 3300025925 Unclassified 1821
215 Ga0207659_10228776 3300025926 Bacteria 1499
216 Ga0207687_10002395 3300025927 Bacteria 12709
217 Ga0207700_10046928 3300025928 Bacteria 3199
218 Ga0207664_10012516 3300025929 Bacteria 6071
219 Ga0207664_10091897 3300025929 Unclassified 2490
220 Ga0207644_10000375 3300025931 Bacteria 29123
221 Ga0207690_10022376 3300025932 Bacteria 3932
222 Ga0207706_10001772 3300025933 Bacteria 21192
223 Ga0207686_10127479 3300025934 Bacteria 1741
224 Ga0207686_10173028 3300025934 Bacteria 1525
225 Ga0207686_10695665 3300025934 Bacteria 808
226 Ga0207670_10000052 3300025936 Bacteria 86188
227 Ga0207670_10002813 3300025936 Bacteria 9171
228 Ga0207670_10225169 3300025936 Unclassified 1438
229 Ga0207704_10098400 3300025938 Bacteria 1943
230 Ga0207665_10231443 3300025939 Bacteria 1358
231 Ga0207691_10523293 3300025940 Bacteria 1006
232 Ga0207711_10029244 3300025941 Bacteria 4645
233 Ga0207711_10117518 3300025941 Unclassified 2371
234 Ga0207711_10122088 3300025941 Bacteria 2327
235 Ga0207689_10001909 3300025942 Bacteria 19703
236 Ga0207689_10041495 3300025942 Bacteria 3808
237 Ga0207689_10166722 3300025942 Bacteria 1815
238 Ga0207689_10261224 3300025942 Unclassified 1432
239 Ga0207689_10534208 3300025942 Unclassified 984
240 Ga0207661_10000183 3300025944 Bacteria 40561
241 Ga0207661_10169065 3300025944 Bacteria 1902
242 Ga0207661_10278193 3300025944 Bacteria 1495
243 Ga0207661_10295193 3300025944 Unclassified 1451
244 Ga0207679_10000308 3300025945 Bacteria 36802
245 Ga0207679_10037593 3300025945 Bacteria 3442
246 Ga0207679_10160416 3300025945 Bacteria 1841
247 Ga0207667_10364108 3300025949 Bacteria 1474
248 Ga0207667_10366105 3300025949 Bacteria 1470
249 Ga0207667_10723600 3300025949 Bacteria 996
250 Ga0207712_10026479 3300025961 Bacteria 3864
251 Ga0207712_10102188 3300025961 Bacteria 2133
252 Ga0207712_10112020 3300025961 Bacteria 2048
253 Ga0207640_10367443 3300025981 Bacteria 1161
254 Ga0207658_10000783 3300025986 Bacteria 27170
255 Ga0207658_10012889 3300025986 Bacteria 5709
256 Ga0207677_10000052 3300026023 Bacteria 99952
257 Ga0207677_10476472 3300026023 Bacteria 1074
258 Ga0207703_10007784 3300026035 Bacteria 8479
259 Ga0207639_10000781 3300026041 Bacteria 21658
260 Ga0207678_10178183 3300026067 Bacteria 1815
261 Ga0207678_10330031 3300026067 Bacteria 1313
262 Ga0207702_10001507 3300026078 Bacteria 23025
263 Ga0207702_10046484 3300026078 Bacteria 3654
264 Ga0207702_10161648 3300026078 Bacteria 2045
265 Ga0207702_10520455 3300026078 Unclassified 1161
266 Ga0207702_10710618 3300026078 Bacteria 991
267 Ga0207641_10001408 3300026088 Bacteria 23720
268 Ga0207641_10791580 3300026088 Bacteria 938
269 Ga0207648_10053072 3300026089 Bacteria 3544
270 Ga0207676_10013766 3300026095 Bacteria 5807
271 Ga0207676_10044805 3300026095 Unclassified 3415
272 Ga0207676_10174627 3300026095 Bacteria 1875
273 Ga0207676_10378633 3300026095 Bacteria 1317
274 Ga0207676_10786006 3300026095 Bacteria 928
275 Ga0207674_10000701 3300026116 Bacteria 43653
276 Ga0207674_10020863 3300026116 Bacteria 7070
277 Ga0207674_10283769 3300026116 Bacteria 1604
278 Ga0207674_10339529 3300026116 Bacteria 1452
279 Ga0207674_10825313 3300026116 Bacteria 894
280 Ga0207675_100228817 3300026118 Bacteria 1793
281 Ga0207675_100867115 3300026118 Unclassified 918
282 Ga0207683_10272310 3300026121 Bacteria 1547
283 Ga0207428_10511065 3300027907 Bacteria 872
284 Ga0268266_10128227 3300028379 Unclassified 2267
285 Ga0268265_10505948 3300028380 Bacteria 1139
286 Ga0268264_10000953 3300028381 Bacteria 29838
287 Ga0268264_10017622 3300028381 Bacteria 5848
288 Ga0268264_10777864 3300028381 Bacteria 955
289 Ga0265337_1014517 3300028556 Bacteria 2609
290 Ga0265319_1056805 3300028563 Bacteria 1278
291 Ga0265334_10055467 3300028573 Bacteria 1508
292 Ga0265318_10012621 3300028577 Bacteria 3588
293 Ga0265322_10096655 3300028654 Bacteria 840
294 Ga0265338_10007281 3300028800 Bacteria 13807
295 Ga0265338_10226563 3300028800 Bacteria 1393
296 Ga0265324_10001238 3300029957 Bacteria 15096
297 Ga0265332_10060242 3300031238 Unclassified 1624
298 Ga0265328_10016483 3300031239 Bacteria 2873
299 Ga0265320_10005441 3300031240 Bacteria 8178
300 Ga0265331_10008757 3300031250 Bacteria 5735
301 Ga0265316_10000886 3300031344 Bacteria 32806
302 Ga0265316_10001324 3300031344 Bacteria 26657
303 Ga0265316_10438047 3300031344 Bacteria 938
304 Ga0307516_10005394 3300031730 Bacteria 15348
305 Ga0316592_1073765 3300033524 Unclassified 773
306 Ga0316596_1122123 3300033541 Unclassified 709
307 Ga0373951_0029625 3300035091 Bacteria 1286
308 Ga0373923_0111102 3300035111 Bacteria 1217
309 Ga0373936_0098038 3300035113 Bacteria 1235
310 Ga0373953_0001749 3300035117 Bacteria 6412
311 Ga0373953_0182948 3300035117 Unclassified 904
312 Ga0373954_0050048 3300035118 Bacteria 1960
313 Ga0373956_0004181 3300035119 Bacteria 5785
314 Ga0373955_0094750 3300035172 Bacteria 1706
315 Ga0316574_0008708 3300035398 Bacteria 5646
316 Ga0316574_0344997 3300035398 Unclassified 943
317 Ga0373933_0004830 3300035724 Bacteria 7364
318 Ga0373937_0002065 3300036401 Bacteria 16794
319 Ga0373937_0059177 3300036401 Bacteria 3520
320 Ga0373937_0769476 3300036401 Unclassified 910
321 Ga0316584_0004090 3300036712 Bacteria 9614
322 Ga0373925_0054708 3300037068 Bacteria 2986
323 Ga0395900_0745191 3300037418 Bacteria 910
324 Ga0395905_0693679 3300037471 Unclassified 920
325 Ga0451853_1249476 3300041512 Bacteria 901
326 Ga0451577_0006199 3300042876 Bacteria 11999
327 Ga0451577_0246610 3300042876 Bacteria 1616
328 Ga0453683_0002067 3300044673 Bacteria 16078
329 Ga0453683_0011027 3300044673 Bacteria 5976
330 Ga0453683_0320458 3300044673 Unclassified 993
331 Ga0466966_0063550 3300044684 Bacteria 2326
332 Ga0466966_0374952 3300044684 Unclassified 855
333 Ga0453684_0001308 3300044712 Bacteria 73691
334 Ga0453684_0004835 3300044712 Bacteria 27650
335 Ga0453684_0007816 3300044712 Bacteria 19501
336 Ga0453684_0010322 3300044712 Bacteria 15988
337 Ga0453684_0014930 3300044712 Bacteria 12348
338 Ga0453684_0195417 3300044712 Unclassified 2363
339 Ga0453684_1061323 3300044712 Unclassified 858
340 Ga0466957_0319672 3300044842 Bacteria 1047
341 Ga0451576_0000076 3300045051 Bacteria 245246
342 Ga0451576_0014516 3300045051 Bacteria 8762
343 Ga0451576_0038684 3300045051 Bacteria 5049
344 Ga0451576_0049043 3300045051 Bacteria 4431
345 Ga0451576_0274292 3300045051 Bacteria 1763
346 Ga0451576_0342394 3300045051 Bacteria 1565
347 Ga0451576_0682641 3300045051 Unclassified 1079
348 Ga0451576_1367544 3300045051 Unclassified 737
349 Ga0466958_0079223 3300045836 Bacteria 2020
350 Ga0466967_0208728 3300045976 Bacteria 1852
351 Ga0495592_0061961 3300046454 Bacteria 2747
352 Ga0495651_0150731 3300046462 Bacteria 1676
353 Ga0495653_0310178 3300046463 Bacteria 1026
354 Ga0495580_0032972 3300046472 Unclassified 3732
355 Ga0495580_0082895 3300046472 Unclassified 2235
356 Ga0495582_0053116 3300046473 Bacteria 2235
357 Ga0495664_0130547 3300046477 Bacteria 1521
358 Ga0495584_0055531 3300046491 Bacteria 1993
359 Ga0495608_0008798 3300046511 Bacteria 7063
360 Ga0495608_0009997 3300046511 Bacteria 6622
361 Ga0495610_0026876 3300046512 Bacteria 3067
362 Ga0495620_0033341 3300046515 Bacteria 2339
363 Ga0495628_0002036 3300046516 Bacteria 18318
364 Ga0495628_0054339 3300046516 Bacteria 3158
365 Ga0495628_0066212 3300046516 Bacteria 2824
366 Ga0495630_0162797 3300046517 Bacteria 1698
367 Ga0495643_0031757 3300046522 Bacteria 2936
368 Ga0495652_0387863 3300046529 Bacteria 992
369 Ga0495665_0112237 3300046531 Bacteria 1429
370 Ga0495640_0052582 3300046533 Bacteria 2796
371 Ga0495587_0026081 3300046536 Bacteria 3566
372 Ga0495645_0123535 3300046543 Bacteria 1821
373 Ga0495667_0032694 3300046559 Bacteria 3484
374 Ga0495667_0088544 3300046559 Bacteria 2006
375 Ga0495635_0181934 3300046663 Bacteria 1428
376 Ga0495657_0012852 3300046675 Bacteria 6204
377 Ga0495657_0104462 3300046675 Bacteria 1801
378 Ga0495623_0106921 3300046679 Unclassified 1699
379 Ga0495623_0125032 3300046679 Bacteria 1545
380 Ga0495646_0142619 3300046680 Bacteria 1338
381 Ga0495658_0016574 3300046683 Unclassified 3792
382 Ga0495613_0136236 3300046689 Bacteria 1756
383 Ga0495613_0407965 3300046689 Unclassified 926
384 Ga0495624_0155793 3300046690 Bacteria 1396
385 Ga0495600_0052472 3300046809 Bacteria 2663
386 Ga0495600_0471384 3300046809 Bacteria 774
387 Ga0495581_0263069 3300047315 Unclassified 1009
388 Ga0495604_0185402 3300047317 Bacteria 1453
389 Ga0495674_0193662 3300047319 Bacteria 1688
390 Ga0495680_0100968 3300047322 Bacteria 2149
391 Ga0495680_0140623 3300047322 Bacteria 1766
392 Ga0495680_0220505 3300047322 Unclassified 1354
393 Ga0495680_0281876 3300047322 Bacteria 1171
394 Ga0495675_0000882 3300047444 Bacteria 18342
395 Ga0495675_0113706 3300047444 Bacteria 1688
396 Ga0495684_0524531 3300047471 Bacteria 810
397 Ga0495602_0609152 3300048088 Bacteria 750
398 Ga0496114_0166210 3300048917 Bacteria 1921
399 Ga0495682_0093408 3300049460 Bacteria 1080
400 Ga0501034_0193182 3300049571 Bacteria 1997
401 Ga0501046_0168965 3300049580 Bacteria 1642
402 Ga0501047_0765624 3300049581 Unclassified 781
403 Ga0501048_0076633 3300049582 Bacteria 2360
404 Ga0501067_0011286 3300049583 Bacteria 4946
405 Ga0501068_0097435 3300049584 Unclassified 1820
406 Ga0501069_0114258 3300049585 Bacteria 1539
407 Ga0501070_0095944 3300049586 Bacteria 2453
408 Ga0501071_0037330 3300049587 Bacteria 3469
409 Ga0501073_0060017 3300049589 Bacteria 2655
410 Ga0501073_0214043 3300049589 Unclassified 1331
411 Ga0501074_0176236 3300049590 Unclassified 1526
412 Ga0501074_0293104 3300049590 Viruses 1156
413 Ga0501079_0127348 3300049741 Bacteria 1981
414 Ga0501080_0006148 3300049742 Bacteria 10774
415 Ga0501080_0190602 3300049742 Unclassified 1884
416 Ga0501080_0245199 3300049742 Unclassified 1634
417 Ga0501083_0039108 3300049744 Unclassified 3222
418 Ga0501083_0040093 3300049744 Bacteria 3179
419 Ga0501044_0497151 3300049823 Unclassified 1121
420 Ga0501045_0098943 3300049824 Bacteria 2158
421 nmdc:mga03683_329674_c1 3300050489 Unclassified 720
422 nmdc:mga05p37_113712_c1 3300050507 Bacteria 3328
423 nmdc:mga05p37_188382_c1 3300050507 Bacteria 2507
424 nmdc:mga05p37_326773_c1 3300050507 Bacteria 1813
425 nmdc:mga09592_227312_c1 3300050508 Bacteria 1617
426 nmdc:mga09592_76213_c1 3300050508 Bacteria 2852
427 nmdc:mga06r32_194783_c1 3300050510 Bacteria 2014
428 nmdc:mga06r32_35503_c1 3300050510 Bacteria 4704
429 nmdc:mga08y16_110839_c1 3300050511 Bacteria 2857
430 nmdc:mga08y16_391360_c1 3300050511 Bacteria 1424
431 nmdc:mga0n895_38236_c1 3300050512 Bacteria 4648
432 nmdc:mga0n895_688228_c1 3300050512 Bacteria 1019
433 nmdc:mga08x19_633511_c1 3300050514 Bacteria 758
434 nmdc:mga0a205_358267_c1 3300050515 Bacteria 1325
435 Ga0495595_0009342 3300053084 Bacteria 4053
436 Ga0500642_0251271 3300053130 Bacteria 812
437 Ga0500658_0009592 3300053134 Bacteria 3569
438 Ga0500568_0202461 3300053139 Unclassified 727
439 Ga0500587_000803 3300053739 Bacteria 4090
440 Ga0501084_0132695 3300054114 Bacteria 2097
441 Ga0501084_0539643 3300054114 Unclassified 985
442 2587756823 2585428062 Bacteria 6842168
443 2738725960 2738541278 Bacteria 9755573
444 2819682077 2818991460 Bacteria 7595395
445 rootL2_10193624
446 JGI24751J29686_10000521
447 rootH2_10019078
448 rootH2_10023354
449 rootL2_10248158
450 rootH1_10051194
451 rootH1_10062555
452 JGI25160J50197_1008798
453 Ga0065712_10242335
454 Ga0065715_10130088
455 Ga0070658_10023380
456 Ga0070676_10075357
457 Ga0070683_100001753
458 Ga0070683_100002150
459 Ga0070683_100007665
460 Ga0070683_100306117
461 Ga0070690_100021007
462 Ga0070670_100003899
463 Ga0070670_100069456
464 Ga0070670_100168879
465 Ga0070670_100512089
466 Ga0068869_100003245
467 Ga0068869_100713936
468 Ga0070666_10314562
469 Ga0070680_100110526
470 Ga0068868_100000062
471 Ga0068868_100066264
472 Ga0070660_100207432
473 Ga0070689_100004251
474 Ga0070689_100423734
475 Ga0070661_100000673
476 Ga0070661_100032635
477 Ga0070661_100170038
478 Ga0070675_100063510
479 Ga0070671_100008119
480 Ga0070671_100595914
481 Ga0070673_100051646
482 Ga0070688_100000971
483 Ga0070688_100002447
484 Ga0070659_100013267
485 Ga0070659_100061280
486 Ga0070667_100003064
487 Ga0070714_100561441
488 Ga0070713_100051569
489 Ga0070705_100088934
490 Ga0070694_100225579
491 Ga0070708_100008340
492 Ga0070663_100236541
493 Ga0070662_100033109
494 Ga0070681_10005678
495 Ga0068867_100174795
496 Ga0070685_10018698
497 Ga0070706_100006253
498 Ga0070707_100448551
499 Ga0070698_100031898
500 Ga0070679_100307238
501 Ga0070684_100000308
502 Ga0070684_100024863
503 Ga0070684_100043930
504 Ga0068853_100000957
505 Ga0068853_100027344
506 Ga0068853_100113811
507 Ga0068853_100432219
508 Ga0070672_100210846
509 Ga0070695_100090929
510 Ga0070693_100085245
511 Ga0070665_100622661
512 Ga0068855_100011690
513 Ga0068855_100384224
514 Ga0068855_100541455
515 Ga0070664_100000958
516 Ga0070664_100053139
517 Ga0070664_100061033
518 Ga0070664_100184528
519 Ga0068857_100003744
520 Ga0068857_100200769
521 Ga0068857_100258034
522 Ga0068857_100289826
523 Ga0068857_100834577
524 Ga0068854_100898773
525 Ga0068856_100003368
526 Ga0068856_100149584
527 Ga0068856_100190918
528 Ga0068856_100717041
529 Ga0068852_100012927
530 Ga0068852_100045799
531 Ga0068859_100005532
532 Ga0068859_100452777
533 Ga0068864_100018520
534 Ga0068864_100036344
535 Ga0068864_100055845
536 Ga0068864_100858506
537 Ga0068864_100925226
538 Ga0068851_10018564
539 Ga0068863_100003463
540 Ga0068863_100933743
541 Ga0068858_100016948
542 Ga0068858_100094769
543 Ga0068860_100001338
544 Ga0068860_100020337
545 Ga0075363_100118598
546 Ga0075364_10254514
547 Ga0075362_10025058
548 Ga0097621_100010637
549 Ga0097621_100046336
550 Ga0097621_100264475
551 Ga0068871_100003816
552 Ga0068871_100022149
553 Ga0075428_100029946
554 Ga0075428_100198281
555 Ga0075430_100007829
556 Ga0075430_100034494
557 Ga0075431_100019195
558 Ga0075431_100023428
559 Ga0075431_101059177
560 Ga0075434_100030185
561 Ga0075434_100314217
562 Ga0075429_100003535
563 Ga0075436_100006015
564 Ga0097620_100005532
565 Ga0097620_100452769
566 Ga0075435_100324440
567 Ga0105240_10001229
568 Ga0105240_10313590
569 Ga0105240_10452278
570 Ga0111539_10192315
571 Ga0111539_10801238
572 Ga0105245_10002214
573 Ga0105247_10003653
574 Ga0105247_10022808
575 Ga0114129_10171051
576 Ga0114129_10194926
577 Ga0114129_10284338
578 Ga0105241_10003386
579 Ga0105242_10235776
580 Ga0105242_10321563
581 Ga0105248_10024590
582 Ga0105248_10033051
583 Ga0105248_10183197
584 Ga0105237_10008153
585 Ga0105238_10092738
586 Ga0105238_10186356
587 Ga0105249_10001852
588 Ga0105249_10153476
589 Ga0105239_10049883
590 Ga0105239_10109378
591 Ga0105246_10003821
592 Ga0157373_10007851
593 Ga0157373_10081911
594 Ga0157371_10008983
595 Ga0157371_10138258
596 Ga0157370_10007482
597 Ga0157370_10139733
598 Ga0157369_10015758
599 Ga0157369_10085847
600 Ga0157369_10186197
601 Ga0157369_10632850
602 Ga0157374_10012934
603 Ga0157374_10068954
604 Ga0157374_10387326
605 Ga0157374_10778258
606 Ga0157378_10009847
607 Ga0157378_10011826
608 Ga0163162_10001051
609 Ga0163162_10127727
610 Ga0157372_10000617
611 Ga0157372_10049790
612 Ga0157372_10106486
613 Ga0157372_10279817
614 Ga0157372_10556604
615 Ga0157375_10024293
616 Ga0157375_10628797
617 Ga0163163_10001503
618 Ga0157380_10139346
619 Ga0157380_10321329
620 Ga0157380_10543335
621 Ga0157380_10619534
622 Ga0157379_10004876
623 Ga0157379_10497947
624 Ga0157376_10009671
625 Ga0163161_10020562
626 Ga0209436_101240
627 Ga0209130_1000912
628 Ga0207426_1000310
629 Ga0207656_10044881
630 Ga0207656_10193134
631 Ga0207710_10000509
632 Ga0207710_10005141
633 Ga0207680_10225794
634 Ga0207645_10562819
635 Ga0207643_10014642
636 Ga0207705_10013699
637 Ga0207705_10032356
638 Ga0207654_10000637
639 Ga0207707_10009098
640 Ga0207707_10301683
641 Ga0207695_10000752
642 Ga0207695_10234542
643 Ga0207695_10525148
644 Ga0207671_10000376
645 Ga0207660_10117878
646 Ga0207662_10001794
647 Ga0207657_10008680
648 Ga0207657_10490568
649 Ga0207649_10000652
650 Ga0207649_10026624
651 Ga0207649_10065383
652 Ga0207649_10105985
653 Ga0207652_10264122
654 Ga0207681_10134782
655 Ga0207681_10360728
656 Ga0207694_10000302
657 Ga0207650_10001852
658 Ga0207650_10153161
659 Ga0207659_10228776
660 Ga0207687_10002395
661 Ga0207700_10046928
662 Ga0207664_10012516
663 Ga0207664_10091897
664 Ga0207644_10000375
665 Ga0207690_10022376
666 Ga0207706_10001772
667 Ga0207686_10127479
668 Ga0207686_10173028
669 Ga0207686_10695665
670 Ga0207670_10000052
671 Ga0207670_10002813
672 Ga0207670_10225169
673 Ga0207704_10098400
674 Ga0207665_10231443
675 Ga0207691_10523293
676 Ga0207711_10029244
677 Ga0207711_10117518
678 Ga0207711_10122088
679 Ga0207689_10001909
680 Ga0207689_10041495
681 Ga0207689_10166722
682 Ga0207689_10261224
683 Ga0207689_10534208
684 Ga0207661_10000183
685 Ga0207661_10169065
686 Ga0207661_10278193
687 Ga0207661_10295193
688 Ga0207679_10000308
689 Ga0207679_10037593
690 Ga0207679_10160416
691 Ga0207667_10364108
692 Ga0207667_10366105
693 Ga0207667_10723600
694 Ga0207712_10026479
695 Ga0207712_10102188
696 Ga0207712_10112020
697 Ga0207640_10367443
698 Ga0207658_10000783
699 Ga0207658_10012889
700 Ga0207677_10000052
701 Ga0207677_10476472
702 Ga0207703_10007784
703 Ga0207639_10000781
704 Ga0207678_10178183
705 Ga0207678_10330031
706 Ga0207702_10001507
707 Ga0207702_10046484
708 Ga0207702_10161648
709 Ga0207702_10520455
710 Ga0207702_10710618
711 Ga0207641_10001408
712 Ga0207641_10791580
713 Ga0207648_10053072
714 Ga0207676_10013766
715 Ga0207676_10044805
716 Ga0207676_10174627
717 Ga0207676_10378633
718 Ga0207676_10786006
719 Ga0207674_10000701
720 Ga0207674_10020863
721 Ga0207674_10283769
722 Ga0207674_10339529
723 Ga0207674_10825313
724 Ga0207675_100228817
725 Ga0207675_100867115
726 Ga0207683_10272310
727 Ga0207428_10511065
728 Ga0268266_10128227
729 Ga0268265_10505948
730 Ga0268264_10000953
731 Ga0268264_10017622
732 Ga0268264_10777864
733 Ga0265337_1014517
734 Ga0265319_1056805
735 Ga0265334_10055467
736 Ga0265318_10012621
737 Ga0265322_10096655
738 Ga0265338_10007281
739 Ga0265338_10226563
740 Ga0265324_10001238
741 Ga0265332_10060242
742 Ga0265328_10016483
743 Ga0265320_10005441
744 Ga0265331_10008757
745 Ga0265316_10000886
746 Ga0265316_10001324
747 Ga0265316_10438047
748 Ga0307516_10005394
749 Ga0316592_1073765
750 Ga0316596_1122123
751 Ga0373951_0029625
752 Ga0373923_0111102
753 Ga0373936_0098038
754 Ga0373953_0001749
755 Ga0373953_0182948
756 Ga0373954_0050048
757 Ga0373956_0004181
758 Ga0373955_0094750
759 Ga0316574_0008708
760 Ga0316574_0344997
761 Ga0373933_0004830
762 Ga0373937_0002065
763 Ga0373937_0059177
764 Ga0373937_0769476
765 Ga0316584_0004090
766 Ga0373925_0054708
767 Ga0395900_0745191
768 Ga0395905_0693679
769 Ga0451853_1249476
770 Ga0451577_0006199
771 Ga0451577_0246610
772 Ga0453683_0002067
773 Ga0453683_0011027
774 Ga0453683_0320458
775 Ga0466966_0063550
776 Ga0466966_0374952
777 Ga0453684_0001308
778 Ga0453684_0004835
779 Ga0453684_0007816
780 Ga0453684_0010322
781 Ga0453684_0014930
782 Ga0453684_0195417
783 Ga0453684_1061323
784 Ga0466957_0319672
785 Ga0451576_0000076
786 Ga0451576_0014516
787 Ga0451576_0038684
788 Ga0451576_0049043
789 Ga0451576_0274292
790 Ga0451576_0342394
791 Ga0451576_0682641
792 Ga0451576_1367544
793 Ga0466958_0079223
794 Ga0466967_0208728
795 Ga0495592_0061961
796 Ga0495651_0150731
797 Ga0495653_0310178
798 Ga0495580_0032972
799 Ga0495580_0082895
800 Ga0495582_0053116
801 Ga0495664_0130547
802 Ga0495584_0055531
803 Ga0495608_0008798
804 Ga0495608_0009997
805 Ga0495610_0026876
806 Ga0495620_0033341
807 Ga0495628_0002036
808 Ga0495628_0054339
809 Ga0495628_0066212
810 Ga0495630_0162797
811 Ga0495643_0031757
812 Ga0495652_0387863
813 Ga0495665_0112237
814 Ga0495640_0052582
815 Ga0495587_0026081
816 Ga0495645_0123535
817 Ga0495667_0032694
818 Ga0495667_0088544
819 Ga0495635_0181934
820 Ga0495657_0012852
821 Ga0495657_0104462
822 Ga0495623_0106921
823 Ga0495623_0125032
824 Ga0495646_0142619
825 Ga0495658_0016574
826 Ga0495613_0136236
827 Ga0495613_0407965
828 Ga0495624_0155793
829 Ga0495600_0052472
830 Ga0495600_0471384
831 Ga0495581_0263069
832 Ga0495604_0185402
833 Ga0495674_0193662
834 Ga0495680_0100968
835 Ga0495680_0140623
836 Ga0495680_0220505
837 Ga0495680_0281876
838 Ga0495675_0000882
839 Ga0495675_0113706
840 Ga0495684_0524531
841 Ga0495602_0609152
842 Ga0496114_0166210
843 Ga0495682_0093408
844 Ga0501034_0193182
845 Ga0501046_0168965
846 Ga0501047_0765624
847 Ga0501048_0076633
848 Ga0501067_0011286
849 Ga0501068_0097435
850 Ga0501069_0114258
851 Ga0501070_0095944
852 Ga0501071_0037330
853 Ga0501073_0060017
854 Ga0501073_0214043
855 Ga0501074_0176236
856 Ga0501074_0293104
857 Ga0501079_0127348
858 Ga0501080_0006148
859 Ga0501080_0190602
860 Ga0501080_0245199
861 Ga0501083_0039108
862 Ga0501083_0040093
863 Ga0501044_0497151
864 Ga0501045_0098943
865 nmdc:mga03683_329674_c1
866 nmdc:mga05p37_113712_c1
867 nmdc:mga05p37_188382_c1
868 nmdc:mga05p37_326773_c1
869 nmdc:mga09592_227312_c1
870 nmdc:mga09592_76213_c1
871 nmdc:mga06r32_194783_c1
872 nmdc:mga06r32_35503_c1
873 nmdc:mga08y16_110839_c1
874 nmdc:mga08y16_391360_c1
875 nmdc:mga0n895_38236_c1
876 nmdc:mga0n895_688228_c1
877 nmdc:mga08x19_633511_c1
878 nmdc:mga0a205_358267_c1
879 Ga0495595_0009342
880 Ga0500642_0251271
881 Ga0500658_0009592
882 Ga0500568_0202461
883 Ga0500587_000803
884 Ga0501084_0132695
885 Ga0501084_0539643
886 2587756823
887 2738725960
888 2819682077

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

24

115

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x6r-assembly2.cif.gz_B crystal structure of saccharomyces cerevisiae kmo in complex with ro 61-8048 0.9924 1 28
6j38-assembly1.cif.gz_B-2 crystal structure of cmis2 0.9696 1 32
6j39-assembly1.cif.gz_A crystal structure of cmis2 with inhibitor 0.9654 1 32
3dtt-assembly1.cif.gz_A crystal structure of a putative f420 dependent nadp-reductase (arth_0613) from arthrobacter sp. fb24 at 1.70 a resolution 0.9379 1 214
3dtt-assembly1.cif.gz_B crystal structure of a putative f420 dependent nadp-reductase (arth_0613) from arthrobacter sp. fb24 at 1.70 a resolution 0.9302 1 214
ID Description Score Start End Superfamily
af_O15229_1_369_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9796 2 28 3.50.50.60
3dttA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9151 1 214 3.40.50.720
3dttA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.911 1 214 3.40.50.720
af_Q58582_1_364_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9099 1 33 3.50.50.60
af_Q687X5_19_201_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8799 2 190 3.40.50.720
ID Description Score Start End GO Terms
AF-M6X3P1-F1-model_v4 deleted 0.9993 51 214
AF-A0A1T4SKR5-F1-model_v4 Pyrroline-5-carboxylate reductase catalytic N-terminal domain-containing protein 0.9951 1 214 GO:0005886
GO:0008823
GO:0015677
GO:0052851
AF-A0A1G3IN80-F1-model_v4 DNA-binding protein 0.9931 1 192 GO:0003677
AF-N1U9W5-F1-model_v4 NADP oxidoreductase coenzyme F420-dependent 0.993 69 214
AF-A0A1T4SKR5-F1-model_v4 Pyrroline-5-carboxylate reductase catalytic N-terminal domain-containing protein 0.9905 1 214 GO:0005886
GO:0008823
GO:0015677
GO:0052851

Map