F445173

General Info

Members Datasets Scaffolds Average Seq Length
443 245 886 246

Family's Representative Sequence

Representative Sequence 3300049587|Ga0501071_0227390|Ga0501071_0227390_17_886
Length 289
Sequence VRIVAPAWLPVECLDAWRYLVAIAIYAHRVRCGSVRSMTFNVAADAYDSFMGRYSRLLAPQMADLAGVRAGQRILDVGAGPGALTAELVRRVGAELVTAAEPSPPFVSALRARNPDITVAEASAEELPFDDDTFDASLAQLVVHFMTDPVAGLREMRRVTRPGGTVVASVWDLNEGQSPLERFWSAARSIDPGVADESELAGSRRGHLEELMTAAGLHDVTGAELWIETQHETFDDWWQPFEAGVGPAGAYFAQQTPERQAEIRELAQASVSEEPFVLRARAWAARGIA

Samples

Sample ID Description Type Environment
1 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
74 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
112 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
113 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
116 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
117 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
118 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
129 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
130 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
131 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
134 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
135 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
136 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
137 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
138 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
153 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
154 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
155 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
183 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
184 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
185 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
237 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
240 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
241 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
242 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
245 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 9.48
Rhizosphere 89.16
Stem 0
Stem Tuber 0
Unclassified 4.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501071_0227390 3300049587 Unclassified 1405
2 JGI25406J46586_10011105 3300003203 Bacteria 3961
3 Ga0070658_10065858 3300005327 Bacteria 2958
4 Ga0070683_100066318 3300005329 Bacteria 3362
5 Ga0070683_100133633 3300005329 Bacteria 2348
6 Ga0070683_100139568 3300005329 Bacteria 2296
7 Ga0070683_100329879 3300005329 Bacteria 1453
8 Ga0070680_100000001 3300005336 Bacteria 276263
9 Ga0070680_100077256 3300005336 Bacteria 2743
10 Ga0070682_100147632 3300005337 Bacteria 1610
11 Ga0070682_100372267 3300005337 Bacteria 1072
12 Ga0068868_100257336 3300005338 Bacteria 1471
13 Ga0070660_100002706 3300005339 Bacteria 12171
14 Ga0070660_100038346 3300005339 Bacteria 3638
15 Ga0070660_100148185 3300005339 Bacteria 1886
16 Ga0070660_100464832 3300005339 Bacteria 1050
17 Ga0070687_100034673 3300005343 Bacteria 2500
18 Ga0070687_100251133 3300005343 Bacteria 1099
19 Ga0070661_100032778 3300005344 Bacteria 3761
20 Ga0070661_100262634 3300005344 Bacteria 1335
21 Ga0070661_100269175 3300005344 Bacteria 1319
22 Ga0070692_10009268 3300005345 Bacteria 4433
23 Ga0070668_100395458 3300005347 Bacteria 1179
24 Ga0070671_100573797 3300005355 Bacteria 974
25 Ga0070659_100054060 3300005366 Bacteria 3162
26 Ga0070659_100066197 3300005366 Bacteria 2863
27 Ga0070667_100285031 3300005367 Bacteria 1484
28 Ga0070703_10003298 3300005406 Bacteria 4603
29 Ga0070709_10026218 3300005434 Bacteria 3452
30 Ga0070709_10254322 3300005434 Bacteria 1267
31 Ga0070714_100151272 3300005435 Bacteria 2092
32 Ga0070713_100116646 3300005436 Bacteria 2335
33 Ga0070713_100118534 3300005436 Bacteria 2318
34 Ga0070710_10097995 3300005437 Bacteria 1741
35 Ga0070710_10108303 3300005437 Unclassified 1665
36 Ga0070711_100064136 3300005439 Unclassified 2566
37 Ga0070700_100251846 3300005441 Bacteria 1267
38 Ga0070694_100027425 3300005444 Bacteria 3698
39 Ga0070694_100178194 3300005444 Unclassified 1570
40 Ga0070708_100002210 3300005445 Bacteria 15041
41 Ga0070708_100003539 3300005445 Bacteria 12236
42 Ga0070708_100062766 3300005445 Bacteria 3324
43 Ga0070708_100554058 3300005445 Unclassified 1084
44 Ga0070681_10026563 3300005458 Bacteria 5819
45 Ga0070681_10051764 3300005458 Bacteria 4095
46 Ga0070681_10062657 3300005458 Bacteria 3692
47 Ga0070706_100006113 3300005467 Bacteria 11388
48 Ga0070706_100020306 3300005467 Bacteria 6122
49 Ga0070706_100037790 3300005467 Bacteria 4458
50 Ga0070706_100080970 3300005467 Bacteria 3007
51 Ga0070707_100001560 3300005468 Bacteria 22257
52 Ga0070707_100027254 3300005468 Bacteria 5435
53 Ga0070707_100136567 3300005468 Bacteria 2385
54 Ga0070707_100391220 3300005468 Bacteria 1350
55 Ga0070707_100448359 3300005468 Bacteria 1251
56 Ga0070698_100017058 3300005471 Bacteria 7656
57 Ga0070698_100469445 3300005471 Bacteria 1195
58 Ga0070698_100742911 3300005471 Bacteria 924
59 Ga0070699_100004336 3300005518 Bacteria 12549
60 Ga0070699_100013140 3300005518 Bacteria 7140
61 Ga0070699_100037233 3300005518 Bacteria 4209
62 Ga0070699_100132041 3300005518 Bacteria 2201
63 Ga0070699_100204685 3300005518 Bacteria 1756
64 Ga0070699_100516073 3300005518 Bacteria 1086
65 Ga0070679_100031239 3300005530 Bacteria 5260
66 Ga0070679_100104328 3300005530 Bacteria 2821
67 Ga0070684_100074510 3300005535 Bacteria 2992
68 Ga0070684_100080696 3300005535 Bacteria 2878
69 Ga0070684_100224623 3300005535 Bacteria 1714
70 Ga0070684_100626123 3300005535 Bacteria 1001
71 Ga0070697_100062485 3300005536 Bacteria 3040
72 Ga0070697_100116103 3300005536 Bacteria 2235
73 Ga0070697_100524391 3300005536 Bacteria 1037
74 Ga0068853_100102675 3300005539 Bacteria 2530
75 Ga0070695_100015615 3300005545 Bacteria 4585
76 Ga0070695_100042488 3300005545 Unclassified 2886
77 Ga0070693_100014422 3300005547 Bacteria 4050
78 Ga0070665_100046179 3300005548 Bacteria 4375
79 Ga0070704_100033375 3300005549 Bacteria 3479
80 Ga0070704_100039859 3300005549 Bacteria 3228
81 Ga0070704_100538709 3300005549 Bacteria 1018
82 Ga0068855_100103243 3300005563 Bacteria 3280
83 Ga0068855_100153123 3300005563 Bacteria 2621
84 Ga0068855_100474118 3300005563 Bacteria 1363
85 Ga0070664_100339508 3300005564 Bacteria 1364
86 Ga0070664_100419650 3300005564 Bacteria 1225
87 Ga0068856_100045165 3300005614 Bacteria 4337
88 Ga0068856_100080845 3300005614 Bacteria 3224
89 Ga0070702_100006300 3300005615 Bacteria 5606
90 Ga0068852_100091121 3300005616 Bacteria 2728
91 Ga0068859_100265394 3300005617 Bacteria 1809
92 Ga0068863_100090594 3300005841 Bacteria 2900
93 Ga0068863_100541181 3300005841 Bacteria 1149
94 Ga0068860_100754051 3300005843 Bacteria 985
95 Ga0068862_100551966 3300005844 Bacteria 1100
96 Ga0081455_10005600 3300005937 Bacteria 13731
97 Ga0081538_10034459 3300005981 Bacteria 3347
98 Ga0070717_10024432 3300006028 Bacteria 4799
99 Ga0070717_10066344 3300006028 Bacteria 3001
100 Ga0070717_10348059 3300006028 Bacteria 1324
101 Ga0070716_100021437 3300006173 Unclassified 3405
102 Ga0070716_100145431 3300006173 Bacteria 1518
103 Ga0070712_100030396 3300006175 Bacteria 3628
104 Ga0070712_100039581 3300006175 Bacteria 3227
105 Ga0070712_100080915 3300006175 Unclassified 2352
106 Ga0068871_100468012 3300006358 Bacteria 1132
107 Ga0075430_100395787 3300006846 Bacteria 1140
108 Ga0068865_100177706 3300006881 Bacteria 1637
109 Ga0097620_100265384 3300006931 Bacteria 1809
110 Ga0075435_100396846 3300007076 Archaea 1186
111 Ga0075435_100756941 3300007076 Bacteria 845
112 Ga0105240_10498838 3300009093 Bacteria 1354
113 Ga0105240_10582497 3300009093 Bacteria 1234
114 Ga0111539_10032723 3300009094 Bacteria 6314
115 Ga0111539_10447440 3300009094 Bacteria 1504
116 Ga0105245_10058661 3300009098 Bacteria 3465
117 Ga0105243_10034120 3300009148 Bacteria 3938
118 Ga0105243_10956106 3300009148 Bacteria 856
119 Ga0105242_10051063 3300009176 Bacteria 3369
120 Ga0105242_10124240 3300009176 Bacteria 2219
121 Ga0105239_10000974 3300010375 Bacteria 40186
122 Ga0105246_10001013 3300011119 Bacteria 16151
123 Ga0105246_10098576 3300011119 Bacteria 2123
124 Ga0157370_10008190 3300013104 Bacteria 11296
125 Ga0157369_10017732 3300013105 Bacteria 7996
126 Ga0157374_10255707 3300013296 Bacteria 1724
127 Ga0163162_10015353 3300013306 Bacteria 7483
128 Ga0157372_10010602 3300013307 Bacteria 9804
129 Ga0157372_10784600 3300013307 Bacteria 1107
130 Ga0157372_10832875 3300013307 Bacteria 1071
131 Ga0163163_10154958 3300014325 Bacteria 2335
132 Ga0163163_10379456 3300014325 Bacteria 1471
133 Ga0157377_10076179 3300014745 Bacteria 1950
134 Ga0157379_10069127 3300014968 Bacteria 3158
135 Ga0206353_10291076 3300020082 Bacteria 2048
136 Ga0213874_10064696 3300021377 Bacteria 1154
137 Ga0207653_10000269 3300025885 Bacteria 30938
138 Ga0207692_10012855 3300025898 Bacteria 3610
139 Ga0207692_10221410 3300025898 Bacteria 1122
140 Ga0207688_10021458 3300025901 Bacteria 3529
141 Ga0207699_10067952 3300025906 Bacteria 2168
142 Ga0207699_10162735 3300025906 Bacteria 1487
143 Ga0207699_10206910 3300025906 Bacteria 1333
144 Ga0207705_10006686 3300025909 Bacteria 8528
145 Ga0207705_10234835 3300025909 Bacteria 1395
146 Ga0207705_10251579 3300025909 Bacteria 1348
147 Ga0207684_10004238 3300025910 Bacteria 13611
148 Ga0207684_10024920 3300025910 Bacteria 5097
149 Ga0207684_10200027 3300025910 Bacteria 1723
150 Ga0207684_10347528 3300025910 Unclassified 1277
151 Ga0207684_10375377 3300025910 Bacteria 1223
152 Ga0207707_10009080 3300025912 Bacteria 8638
153 Ga0207707_10156230 3300025912 Bacteria 1995
154 Ga0207707_10265668 3300025912 Bacteria 1488
155 Ga0207707_10276319 3300025912 Bacteria 1455
156 Ga0207693_10019920 3300025915 Bacteria 5335
157 Ga0207693_10103809 3300025915 Bacteria 2229
158 Ga0207663_10148547 3300025916 Bacteria 1641
159 Ga0207663_10190947 3300025916 Bacteria 1470
160 Ga0207660_10000001 3300025917 Bacteria 1034169
161 Ga0207660_10039932 3300025917 Bacteria 3283
162 Ga0207660_10063343 3300025917 Bacteria 2666
163 Ga0207662_10002719 3300025918 Bacteria 8926
164 Ga0207662_10020946 3300025918 Bacteria 3732
165 Ga0207657_10007719 3300025919 Bacteria 10987
166 Ga0207657_10012287 3300025919 Bacteria 8460
167 Ga0207657_10026709 3300025919 Bacteria 5299
168 Ga0207657_10027230 3300025919 Bacteria 5237
169 Ga0207657_10135459 3300025919 Bacteria 2016
170 Ga0207652_10051907 3300025921 Bacteria 3517
171 Ga0207652_10055650 3300025921 Bacteria 3403
172 Ga0207652_10063098 3300025921 Bacteria 3203
173 Ga0207652_10113691 3300025921 Bacteria 2403
174 Ga0207652_10177991 3300025921 Bacteria 1910
175 Ga0207652_10282973 3300025921 Bacteria 1496
176 Ga0207646_10012844 3300025922 Bacteria 8026
177 Ga0207646_10016295 3300025922 Bacteria 6974
178 Ga0207646_10176442 3300025922 Bacteria 1930
179 Ga0207646_10471615 3300025922 Bacteria 1132
180 Ga0207687_10003090 3300025927 Bacteria 11289
181 Ga0207700_10101411 3300025928 Bacteria 2296
182 Ga0207664_10020229 3300025929 Bacteria 4930
183 Ga0207664_10206869 3300025929 Bacteria 1696
184 Ga0207706_10698073 3300025933 Bacteria 867
185 Ga0207686_10029064 3300025934 Bacteria 3257
186 Ga0207709_10024642 3300025935 Bacteria 3437
187 Ga0207704_10088556 3300025938 Bacteria 2026
188 Ga0207665_10002508 3300025939 Bacteria 12346
189 Ga0207665_10153794 3300025939 Bacteria 1650
190 Ga0207665_10237580 3300025939 Bacteria 1341
191 Ga0207661_10023211 3300025944 Bacteria 4685
192 Ga0207661_10147173 3300025944 Bacteria 2033
193 Ga0207661_10188923 3300025944 Bacteria 1805
194 Ga0207661_10346790 3300025944 Bacteria 1339
195 Ga0207639_10339190 3300026041 Bacteria 1339
196 Ga0207708_10160070 3300026075 Bacteria 1777
197 Ga0207708_10390806 3300026075 Bacteria 1148
198 Ga0207702_10110456 3300026078 Bacteria 2443
199 Ga0207702_10130354 3300026078 Bacteria 2262
200 Ga0207641_10113460 3300026088 Bacteria 2407
201 Ga0207641_10189856 3300026088 Bacteria 1888
202 Ga0207648_10260974 3300026089 Bacteria 1546
203 Ga0207676_10003570 3300026095 Bacteria 10991
204 Ga0207676_10159099 3300026095 Bacteria 1955
205 Ga0207674_10019683 3300026116 Bacteria 7308
206 Ga0207675_100302845 3300026118 Bacteria 1557
207 Ga0207675_100463994 3300026118 Bacteria 1257
208 Ga0207698_10025902 3300026142 Bacteria 4141
209 Ga0207698_10078784 3300026142 Bacteria 2647
210 Ga0268266_10049788 3300028379 Bacteria 3594
211 Ga0268264_10023623 3300028381 Bacteria 5014
212 Ga0265336_10013399 3300028666 Bacteria 2735
213 Ga0307515_10093387 3300028794 Bacteria 3731
214 Ga0265338_10007997 3300028800 Bacteria 12944
215 Ga0265338_10048514 3300028800 Bacteria 3862
216 Ga0265324_10009051 3300029957 Bacteria 3908
217 Ga0265332_10020518 3300031238 Bacteria 2917
218 Ga0265320_10006793 3300031240 Bacteria 7171
219 Ga0265320_10060567 3300031240 Bacteria 1807
220 Ga0265325_10014037 3300031241 Bacteria 4542
221 Ga0265329_10003455 3300031242 Bacteria 6875
222 Ga0265339_10054270 3300031249 Bacteria 2177
223 Ga0265331_10072405 3300031250 Bacteria 1610
224 Ga0265327_10021793 3300031251 Bacteria 3855
225 Ga0265316_10097347 3300031344 Bacteria 2240
226 Ga0265313_10019299 3300031595 Bacteria 3798
227 Ga0265314_10043322 3300031711 Bacteria 3201
228 Ga0307405_10329392 3300031731 Bacteria 1170
229 Ga0307410_10208613 3300031852 Bacteria 1495
230 Ga0307406_10132408 3300031901 Bacteria 1752
231 Ga0307409_100005089 3300031995 Bacteria 7501
232 Ga0307409_100194091 3300031995 Bacteria 1810
233 Ga0307409_100212744 3300031995 Bacteria 1739
234 Ga0307409_100731568 3300031995 Bacteria 992
235 Ga0307416_100214729 3300032002 Bacteria 1839
236 Ga0307416_100438923 3300032002 Bacteria 1355
237 Ga0307416_100639818 3300032002 Bacteria 1147
238 Ga0307415_100197746 3300032126 Bacteria 1592
239 Ga0307415_100236679 3300032126 Bacteria 1474
240 Ga0373926_0004947 3300035083 Bacteria 4376
241 Ga0373934_0000003 3300035086 Bacteria 87823
242 Ga0373944_0000843 3300035089 Bacteria 7523
243 Ga0373923_0103244 3300035111 Bacteria 1259
244 Ga0373936_0001344 3300035113 Bacteria 8924
245 Ga0373945_0001070 3300035116 Bacteria 8226
246 Ga0373953_0000247 3300035117 Bacteria 14687
247 Ga0373954_0009828 3300035118 Bacteria 4210
248 Ga0373956_0002403 3300035119 Bacteria 7642
249 Ga0373957_0000418 3300035120 Bacteria 10759
250 Ga0373946_0000181 3300035171 Bacteria 19398
251 Ga0373955_0000057 3300035172 Bacteria 43330
252 Ga0373955_0134717 3300035172 Bacteria 1444
253 Ga0373924_0000135 3300035410 Bacteria 21359
254 Ga0373924_0038718 3300035410 Bacteria 1946
255 Ga0373935_0016054 3300035692 Bacteria 4531
256 Ga0373927_0001726 3300035695 Bacteria 16325
257 Ga0373933_0000003 3300035724 Bacteria 150420
258 Ga0373933_0052847 3300035724 Bacteria 2432
259 Ga0373947_0000679 3300035725 Bacteria 20226
260 Ga0373937_0000016 3300036401 Bacteria 145523
261 Ga0373925_0003078 3300037068 Bacteria 13095
262 Ga0395899_0020686 3300037312 Bacteria 4989
263 Ga0395900_0201327 3300037418 Bacteria 2014
264 Ga0395898_0059685 3300037466 Bacteria 3709
265 Ga0395901_0296864 3300038443 Bacteria 1676
266 Ga0436365_0773363 3300039437 Bacteria 1649
267 Ga0436363_0872694 3300039450 Bacteria 1094
268 Ga0439446_0019010 3300042156 Bacteria 1930
269 Ga0439434_0120117 3300042435 Bacteria 856
270 Ga0466972_0070104 3300044658 Unclassified 1673
271 Ga0466963_0084631 3300044694 Bacteria 2152
272 Ga0466963_0126918 3300044694 Bacteria 1759
273 Ga0466963_0191033 3300044694 Unclassified 1431
274 Ga0466970_0092404 3300044765 Bacteria 1643
275 Ga0466960_0118729 3300044901 Bacteria 1383
276 Ga0466959_0339479 3300045049 Bacteria 1025
277 Ga0466967_0326991 3300045976 Bacteria 1480
278 Ga0495592_0000116 3300046454 Bacteria 70091
279 Ga0495603_0055767 3300046455 Bacteria 2341
280 Ga0495629_0328418 3300046459 Bacteria 1045
281 Ga0495641_0019728 3300046461 Bacteria 3440
282 Ga0495641_0029307 3300046461 Bacteria 2653
283 Ga0495651_0000009 3300046462 Bacteria 150455
284 Ga0495651_0325017 3300046462 Bacteria 1024
285 Ga0495653_0001057 3300046463 Bacteria 21196
286 Ga0495653_0001260 3300046463 Bacteria 19609
287 Ga0495664_0000832 3300046477 Bacteria 15798
288 Ga0495664_0089736 3300046477 Bacteria 1848
289 Ga0495608_0000019 3300046511 Bacteria 180119
290 Ga0495608_0110942 3300046511 Bacteria 1764
291 Ga0495608_0128770 3300046511 Bacteria 1620
292 Ga0495618_0028321 3300046514 Bacteria 3491
293 Ga0495628_0000487 3300046516 Bacteria 36399
294 Ga0495630_0012533 3300046517 Bacteria 6158
295 Ga0495630_0169160 3300046517 Bacteria 1665
296 Ga0495652_0000430 3300046529 Bacteria 49080
297 Ga0495652_0108129 3300046529 Bacteria 2242
298 Ga0495640_0160605 3300046533 Bacteria 1440
299 Ga0495587_0000041 3300046536 Bacteria 110168
300 Ga0495587_0114272 3300046536 Bacteria 1549
301 Ga0495667_0000037 3300046559 Bacteria 133780
302 Ga0495667_0003630 3300046559 Bacteria 10377
303 Ga0495667_0101997 3300046559 Bacteria 1856
304 Ga0495656_0062604 3300046615 Bacteria 1628
305 Ga0495634_0019463 3300046642 Bacteria 4824
306 Ga0495635_0000190 3300046663 Bacteria 38869
307 Ga0495635_0103664 3300046663 Bacteria 1944
308 Ga0495635_0362991 3300046663 Bacteria 965
309 Ga0495657_0000094 3300046675 Bacteria 78779
310 Ga0495657_0212016 3300046675 Bacteria 1177
311 Ga0495599_0000040 3300046678 Bacteria 97423
312 Ga0495599_0027078 3300046678 Bacteria 3593
313 Ga0495623_0000284 3300046679 Bacteria 32990
314 Ga0495646_0006814 3300046680 Bacteria 7251
315 Ga0495624_0000442 3300046690 Bacteria 32670
316 Ga0495670_0305446 3300046691 Unclassified 853
317 Ga0495589_0157952 3300046794 Bacteria 1081
318 Ga0495600_0024472 3300046809 Bacteria 3887
319 Ga0495660_0163903 3300046810 Bacteria 1088
320 Ga0495581_0040714 3300047315 Bacteria 2688
321 Ga0495604_0000040 3300047317 Bacteria 120837
322 Ga0495674_0004773 3300047319 Bacteria 13034
323 Ga0495674_0088116 3300047319 Bacteria 2655
324 Ga0495674_0242830 3300047319 Bacteria 1484
325 Ga0495676_0011602 3300047321 Bacteria 7951
326 Ga0495680_0000010 3300047322 Bacteria 142931
327 Ga0495680_0018741 3300047322 Bacteria 5865
328 Ga0495680_0054142 3300047322 Bacteria 3117
329 Ga0495675_0000111 3300047444 Bacteria 58822
330 Ga0495684_0003540 3300047471 Bacteria 12215
331 Ga0495602_0000130 3300048088 Bacteria 71178
332 Ga0496100_0006749 3300048903 Bacteria 6285
333 Ga0496100_0066773 3300048903 Unclassified 2387
334 Ga0496101_0001471 3300048904 Bacteria 14069
335 Ga0496101_0010692 3300048904 Bacteria 6065
336 Ga0496102_0001470 3300048905 Bacteria 20809
337 Ga0496102_0025178 3300048905 Bacteria 5294
338 Ga0496102_0382784 3300048905 Bacteria 1324
339 Ga0496103_0012060 3300048906 Bacteria 5134
340 Ga0496103_0166721 3300048906 Bacteria 1413
341 Ga0496104_0002773 3300048907 Bacteria 15090
342 Ga0496104_0003954 3300048907 Bacteria 12835
343 Ga0496105_0034144 3300048908 Bacteria 4182
344 Ga0496105_0222013 3300048908 Bacteria 1538
345 Ga0496105_0227835 3300048908 Unclassified 1515
346 Ga0496106_0002515 3300048909 Bacteria 13652
347 Ga0496106_0060105 3300048909 Bacteria 2880
348 Ga0496106_0289633 3300048909 Bacteria 1313
349 Ga0496107_0002209 3300048910 Bacteria 12507
350 Ga0496108_0010610 3300048911 Bacteria 7475
351 Ga0496108_0025383 3300048911 Bacteria 4883
352 Ga0496108_0080262 3300048911 Unclassified 2763
353 Ga0496109_0001021 3300048912 Bacteria 23138
354 Ga0496109_0004962 3300048912 Bacteria 11115
355 Ga0496109_0672386 3300048912 Bacteria 973
356 Ga0496110_0010573 3300048913 Bacteria 7514
357 Ga0496110_0052866 3300048913 Bacteria 3569
358 Ga0496110_0098476 3300048913 Bacteria 2621
359 Ga0496110_0113552 3300048913 Bacteria 2436
360 Ga0496111_0001462 3300048914 Bacteria 13502
361 Ga0496111_0181414 3300048914 Bacteria 1565
362 Ga0496112_0009039 3300048915 Bacteria 8948
363 Ga0496112_0009458 3300048915 Bacteria 8784
364 Ga0496112_0012838 3300048915 Bacteria 7710
365 Ga0496112_0055521 3300048915 Bacteria 3895
366 Ga0496112_0214494 3300048915 Bacteria 1882
367 Ga0496113_0068284 3300048916 Bacteria 2697
368 Ga0496113_0484539 3300048916 Bacteria 993
369 Ga0496114_0000814 3300048917 Bacteria 23386
370 Ga0496114_0011588 3300048917 Bacteria 7047
371 Ga0496115_0000674 3300048918 Bacteria 25225
372 Ga0496115_0327253 3300048918 Bacteria 1253
373 Ga0496115_0344581 3300048918 Bacteria 1216
374 Ga0501031_0038481 3300049568 Bacteria 3121
375 Ga0501031_0193295 3300049568 Bacteria 1329
376 Ga0501032_0086178 3300049569 Bacteria 2088
377 Ga0501033_0100925 3300049570 Bacteria 2105
378 Ga0501034_0175526 3300049571 Bacteria 2109
379 Ga0501036_0057632 3300049572 Bacteria 3291
380 Ga0501036_0187178 3300049572 Bacteria 1742
381 Ga0501038_0035863 3300049574 Bacteria 4353
382 Ga0501039_0032853 3300049575 Bacteria 4002
383 Ga0501040_0037726 3300049576 Bacteria 3284
384 Ga0501040_0233989 3300049576 Bacteria 1308
385 Ga0501041_0050713 3300049577 Bacteria 2529
386 Ga0501041_0211697 3300049577 Bacteria 1216
387 Ga0501042_0066055 3300049578 Bacteria 2585
388 Ga0501042_0141921 3300049578 Bacteria 1732
389 Ga0501043_0077400 3300049579 Bacteria 2613
390 Ga0501046_0043774 3300049580 Bacteria 3563
391 Ga0501046_0466388 3300049580 Unclassified 907
392 Ga0501068_0025663 3300049584 Bacteria 3468
393 Ga0501069_0001327 3300049585 Bacteria 12126
394 Ga0501069_0059604 3300049585 Bacteria 2130
395 Ga0501069_0176051 3300049585 Bacteria 1236
396 Ga0501070_0002894 3300049586 Bacteria 14957
397 Ga0501070_0012086 3300049586 Bacteria 7286
398 Ga0501070_0042620 3300049586 Bacteria 3780
399 Ga0501070_0224269 3300049586 Bacteria 1541
400 Ga0501071_0030226 3300049587 Bacteria 3831
401 Ga0501071_0191861 3300049587 Bacteria 1532
402 Ga0501072_0009535 3300049588 Bacteria 7384
403 Ga0501072_0011073 3300049588 Bacteria 6882
404 Ga0501072_0073958 3300049588 Bacteria 2694
405 Ga0501072_0223747 3300049588 Unclassified 1500
406 Ga0501072_0249302 3300049588 Unclassified 1414
407 Ga0501073_0043260 3300049589 Bacteria 3176
408 Ga0501073_0106910 3300049589 Bacteria 1941
409 Ga0501074_0005283 3300049590 Bacteria 9298
410 Ga0501074_0086168 3300049590 Bacteria 2250
411 Ga0501074_0169677 3300049590 Bacteria 1558
412 Ga0501076_0008716 3300049592 Bacteria 7448
413 Ga0501076_0035306 3300049592 Bacteria 3912
414 Ga0501076_0097304 3300049592 Bacteria 2370
415 Ga0501077_0335903 3300049593 Bacteria 963
416 Ga0501077_0384409 3300049593 Bacteria 897
417 Ga0501079_0035899 3300049741 Bacteria 3817
418 Ga0501079_0233710 3300049741 Bacteria 1436
419 Ga0501080_0027722 3300049742 Bacteria 5267
420 Ga0501080_0047326 3300049742 Bacteria 4003
421 Ga0501080_0075196 3300049742 Bacteria 3142
422 Ga0501080_0559715 3300049742 Bacteria 1018
423 Ga0501081_0040195 3300049743 Bacteria 3202
424 Ga0501081_0107597 3300049743 Bacteria 1977
425 Ga0501081_0376992 3300049743 Bacteria 1048
426 Ga0501035_0242268 3300049822 Bacteria 1533
427 Ga0501045_0032394 3300049824 Bacteria 3787
428 Ga0501045_0035372 3300049824 Bacteria 3626
429 Ga0501045_0247721 3300049824 Bacteria 1326
430 nmdc:mga0qj67_380365_c1 3300050509 Bacteria 1140
431 nmdc:mga0rr50_419142_c1 3300050513 Bacteria 1132
432 Ga0495612_0005750 3300053078 Bacteria 5123
433 Ga0495595_0000857 3300053084 Bacteria 11668
434 Ga0495595_0070927 3300053084 Bacteria 1647
435 Ga0500556_0006980 3300053104 Bacteria 3220
436 Ga0500616_0029770 3300053153 Bacteria 3002
437 Ga0501084_0019030 3300054114 Bacteria 5718
438 Ga0501084_0020162 3300054114 Bacteria 5557
439 Ga0501084_0089263 3300054114 Bacteria 2587
440 Ga0501084_0173616 3300054114 Bacteria 1819
441 Ga0501082_0694035 3300060353 Unclassified 891
442 Ga0530510_0040338 3300061734 Bacteria 3369
443 Ga0530510_0161555 3300061734 Unclassified 1657
444 Ga0501071_0227390
445 JGI25406J46586_10011105
446 Ga0070658_10065858
447 Ga0070683_100066318
448 Ga0070683_100133633
449 Ga0070683_100139568
450 Ga0070683_100329879
451 Ga0070680_100000001
452 Ga0070680_100077256
453 Ga0070682_100147632
454 Ga0070682_100372267
455 Ga0068868_100257336
456 Ga0070660_100002706
457 Ga0070660_100038346
458 Ga0070660_100148185
459 Ga0070660_100464832
460 Ga0070687_100034673
461 Ga0070687_100251133
462 Ga0070661_100032778
463 Ga0070661_100262634
464 Ga0070661_100269175
465 Ga0070692_10009268
466 Ga0070668_100395458
467 Ga0070671_100573797
468 Ga0070659_100054060
469 Ga0070659_100066197
470 Ga0070667_100285031
471 Ga0070703_10003298
472 Ga0070709_10026218
473 Ga0070709_10254322
474 Ga0070714_100151272
475 Ga0070713_100116646
476 Ga0070713_100118534
477 Ga0070710_10097995
478 Ga0070710_10108303
479 Ga0070711_100064136
480 Ga0070700_100251846
481 Ga0070694_100027425
482 Ga0070694_100178194
483 Ga0070708_100002210
484 Ga0070708_100003539
485 Ga0070708_100062766
486 Ga0070708_100554058
487 Ga0070681_10026563
488 Ga0070681_10051764
489 Ga0070681_10062657
490 Ga0070706_100006113
491 Ga0070706_100020306
492 Ga0070706_100037790
493 Ga0070706_100080970
494 Ga0070707_100001560
495 Ga0070707_100027254
496 Ga0070707_100136567
497 Ga0070707_100391220
498 Ga0070707_100448359
499 Ga0070698_100017058
500 Ga0070698_100469445
501 Ga0070698_100742911
502 Ga0070699_100004336
503 Ga0070699_100013140
504 Ga0070699_100037233
505 Ga0070699_100132041
506 Ga0070699_100204685
507 Ga0070699_100516073
508 Ga0070679_100031239
509 Ga0070679_100104328
510 Ga0070684_100074510
511 Ga0070684_100080696
512 Ga0070684_100224623
513 Ga0070684_100626123
514 Ga0070697_100062485
515 Ga0070697_100116103
516 Ga0070697_100524391
517 Ga0068853_100102675
518 Ga0070695_100015615
519 Ga0070695_100042488
520 Ga0070693_100014422
521 Ga0070665_100046179
522 Ga0070704_100033375
523 Ga0070704_100039859
524 Ga0070704_100538709
525 Ga0068855_100103243
526 Ga0068855_100153123
527 Ga0068855_100474118
528 Ga0070664_100339508
529 Ga0070664_100419650
530 Ga0068856_100045165
531 Ga0068856_100080845
532 Ga0070702_100006300
533 Ga0068852_100091121
534 Ga0068859_100265394
535 Ga0068863_100090594
536 Ga0068863_100541181
537 Ga0068860_100754051
538 Ga0068862_100551966
539 Ga0081455_10005600
540 Ga0081538_10034459
541 Ga0070717_10024432
542 Ga0070717_10066344
543 Ga0070717_10348059
544 Ga0070716_100021437
545 Ga0070716_100145431
546 Ga0070712_100030396
547 Ga0070712_100039581
548 Ga0070712_100080915
549 Ga0068871_100468012
550 Ga0075430_100395787
551 Ga0068865_100177706
552 Ga0097620_100265384
553 Ga0075435_100396846
554 Ga0075435_100756941
555 Ga0105240_10498838
556 Ga0105240_10582497
557 Ga0111539_10032723
558 Ga0111539_10447440
559 Ga0105245_10058661
560 Ga0105243_10034120
561 Ga0105243_10956106
562 Ga0105242_10051063
563 Ga0105242_10124240
564 Ga0105239_10000974
565 Ga0105246_10001013
566 Ga0105246_10098576
567 Ga0157370_10008190
568 Ga0157369_10017732
569 Ga0157374_10255707
570 Ga0163162_10015353
571 Ga0157372_10010602
572 Ga0157372_10784600
573 Ga0157372_10832875
574 Ga0163163_10154958
575 Ga0163163_10379456
576 Ga0157377_10076179
577 Ga0157379_10069127
578 Ga0206353_10291076
579 Ga0213874_10064696
580 Ga0207653_10000269
581 Ga0207692_10012855
582 Ga0207692_10221410
583 Ga0207688_10021458
584 Ga0207699_10067952
585 Ga0207699_10162735
586 Ga0207699_10206910
587 Ga0207705_10006686
588 Ga0207705_10234835
589 Ga0207705_10251579
590 Ga0207684_10004238
591 Ga0207684_10024920
592 Ga0207684_10200027
593 Ga0207684_10347528
594 Ga0207684_10375377
595 Ga0207707_10009080
596 Ga0207707_10156230
597 Ga0207707_10265668
598 Ga0207707_10276319
599 Ga0207693_10019920
600 Ga0207693_10103809
601 Ga0207663_10148547
602 Ga0207663_10190947
603 Ga0207660_10000001
604 Ga0207660_10039932
605 Ga0207660_10063343
606 Ga0207662_10002719
607 Ga0207662_10020946
608 Ga0207657_10007719
609 Ga0207657_10012287
610 Ga0207657_10026709
611 Ga0207657_10027230
612 Ga0207657_10135459
613 Ga0207652_10051907
614 Ga0207652_10055650
615 Ga0207652_10063098
616 Ga0207652_10113691
617 Ga0207652_10177991
618 Ga0207652_10282973
619 Ga0207646_10012844
620 Ga0207646_10016295
621 Ga0207646_10176442
622 Ga0207646_10471615
623 Ga0207687_10003090
624 Ga0207700_10101411
625 Ga0207664_10020229
626 Ga0207664_10206869
627 Ga0207706_10698073
628 Ga0207686_10029064
629 Ga0207709_10024642
630 Ga0207704_10088556
631 Ga0207665_10002508
632 Ga0207665_10153794
633 Ga0207665_10237580
634 Ga0207661_10023211
635 Ga0207661_10147173
636 Ga0207661_10188923
637 Ga0207661_10346790
638 Ga0207639_10339190
639 Ga0207708_10160070
640 Ga0207708_10390806
641 Ga0207702_10110456
642 Ga0207702_10130354
643 Ga0207641_10113460
644 Ga0207641_10189856
645 Ga0207648_10260974
646 Ga0207676_10003570
647 Ga0207676_10159099
648 Ga0207674_10019683
649 Ga0207675_100302845
650 Ga0207675_100463994
651 Ga0207698_10025902
652 Ga0207698_10078784
653 Ga0268266_10049788
654 Ga0268264_10023623
655 Ga0265336_10013399
656 Ga0307515_10093387
657 Ga0265338_10007997
658 Ga0265338_10048514
659 Ga0265324_10009051
660 Ga0265332_10020518
661 Ga0265320_10006793
662 Ga0265320_10060567
663 Ga0265325_10014037
664 Ga0265329_10003455
665 Ga0265339_10054270
666 Ga0265331_10072405
667 Ga0265327_10021793
668 Ga0265316_10097347
669 Ga0265313_10019299
670 Ga0265314_10043322
671 Ga0307405_10329392
672 Ga0307410_10208613
673 Ga0307406_10132408
674 Ga0307409_100005089
675 Ga0307409_100194091
676 Ga0307409_100212744
677 Ga0307409_100731568
678 Ga0307416_100214729
679 Ga0307416_100438923
680 Ga0307416_100639818
681 Ga0307415_100197746
682 Ga0307415_100236679
683 Ga0373926_0004947
684 Ga0373934_0000003
685 Ga0373944_0000843
686 Ga0373923_0103244
687 Ga0373936_0001344
688 Ga0373945_0001070
689 Ga0373953_0000247
690 Ga0373954_0009828
691 Ga0373956_0002403
692 Ga0373957_0000418
693 Ga0373946_0000181
694 Ga0373955_0000057
695 Ga0373955_0134717
696 Ga0373924_0000135
697 Ga0373924_0038718
698 Ga0373935_0016054
699 Ga0373927_0001726
700 Ga0373933_0000003
701 Ga0373933_0052847
702 Ga0373947_0000679
703 Ga0373937_0000016
704 Ga0373925_0003078
705 Ga0395899_0020686
706 Ga0395900_0201327
707 Ga0395898_0059685
708 Ga0395901_0296864
709 Ga0436365_0773363
710 Ga0436363_0872694
711 Ga0439446_0019010
712 Ga0439434_0120117
713 Ga0466972_0070104
714 Ga0466963_0084631
715 Ga0466963_0126918
716 Ga0466963_0191033
717 Ga0466970_0092404
718 Ga0466960_0118729
719 Ga0466959_0339479
720 Ga0466967_0326991
721 Ga0495592_0000116
722 Ga0495603_0055767
723 Ga0495629_0328418
724 Ga0495641_0019728
725 Ga0495641_0029307
726 Ga0495651_0000009
727 Ga0495651_0325017
728 Ga0495653_0001057
729 Ga0495653_0001260
730 Ga0495664_0000832
731 Ga0495664_0089736
732 Ga0495608_0000019
733 Ga0495608_0110942
734 Ga0495608_0128770
735 Ga0495618_0028321
736 Ga0495628_0000487
737 Ga0495630_0012533
738 Ga0495630_0169160
739 Ga0495652_0000430
740 Ga0495652_0108129
741 Ga0495640_0160605
742 Ga0495587_0000041
743 Ga0495587_0114272
744 Ga0495667_0000037
745 Ga0495667_0003630
746 Ga0495667_0101997
747 Ga0495656_0062604
748 Ga0495634_0019463
749 Ga0495635_0000190
750 Ga0495635_0103664
751 Ga0495635_0362991
752 Ga0495657_0000094
753 Ga0495657_0212016
754 Ga0495599_0000040
755 Ga0495599_0027078
756 Ga0495623_0000284
757 Ga0495646_0006814
758 Ga0495624_0000442
759 Ga0495670_0305446
760 Ga0495589_0157952
761 Ga0495600_0024472
762 Ga0495660_0163903
763 Ga0495581_0040714
764 Ga0495604_0000040
765 Ga0495674_0004773
766 Ga0495674_0088116
767 Ga0495674_0242830
768 Ga0495676_0011602
769 Ga0495680_0000010
770 Ga0495680_0018741
771 Ga0495680_0054142
772 Ga0495675_0000111
773 Ga0495684_0003540
774 Ga0495602_0000130
775 Ga0496100_0006749
776 Ga0496100_0066773
777 Ga0496101_0001471
778 Ga0496101_0010692
779 Ga0496102_0001470
780 Ga0496102_0025178
781 Ga0496102_0382784
782 Ga0496103_0012060
783 Ga0496103_0166721
784 Ga0496104_0002773
785 Ga0496104_0003954
786 Ga0496105_0034144
787 Ga0496105_0222013
788 Ga0496105_0227835
789 Ga0496106_0002515
790 Ga0496106_0060105
791 Ga0496106_0289633
792 Ga0496107_0002209
793 Ga0496108_0010610
794 Ga0496108_0025383
795 Ga0496108_0080262
796 Ga0496109_0001021
797 Ga0496109_0004962
798 Ga0496109_0672386
799 Ga0496110_0010573
800 Ga0496110_0052866
801 Ga0496110_0098476
802 Ga0496110_0113552
803 Ga0496111_0001462
804 Ga0496111_0181414
805 Ga0496112_0009039
806 Ga0496112_0009458
807 Ga0496112_0012838
808 Ga0496112_0055521
809 Ga0496112_0214494
810 Ga0496113_0068284
811 Ga0496113_0484539
812 Ga0496114_0000814
813 Ga0496114_0011588
814 Ga0496115_0000674
815 Ga0496115_0327253
816 Ga0496115_0344581
817 Ga0501031_0038481
818 Ga0501031_0193295
819 Ga0501032_0086178
820 Ga0501033_0100925
821 Ga0501034_0175526
822 Ga0501036_0057632
823 Ga0501036_0187178
824 Ga0501038_0035863
825 Ga0501039_0032853
826 Ga0501040_0037726
827 Ga0501040_0233989
828 Ga0501041_0050713
829 Ga0501041_0211697
830 Ga0501042_0066055
831 Ga0501042_0141921
832 Ga0501043_0077400
833 Ga0501046_0043774
834 Ga0501046_0466388
835 Ga0501068_0025663
836 Ga0501069_0001327
837 Ga0501069_0059604
838 Ga0501069_0176051
839 Ga0501070_0002894
840 Ga0501070_0012086
841 Ga0501070_0042620
842 Ga0501070_0224269
843 Ga0501071_0030226
844 Ga0501071_0191861
845 Ga0501072_0009535
846 Ga0501072_0011073
847 Ga0501072_0073958
848 Ga0501072_0223747
849 Ga0501072_0249302
850 Ga0501073_0043260
851 Ga0501073_0106910
852 Ga0501074_0005283
853 Ga0501074_0086168
854 Ga0501074_0169677
855 Ga0501076_0008716
856 Ga0501076_0035306
857 Ga0501076_0097304
858 Ga0501077_0335903
859 Ga0501077_0384409
860 Ga0501079_0035899
861 Ga0501079_0233710
862 Ga0501080_0027722
863 Ga0501080_0047326
864 Ga0501080_0075196
865 Ga0501080_0559715
866 Ga0501081_0040195
867 Ga0501081_0107597
868 Ga0501081_0376992
869 Ga0501035_0242268
870 Ga0501045_0032394
871 Ga0501045_0035372
872 Ga0501045_0247721
873 nmdc:mga0qj67_380365_c1
874 nmdc:mga0rr50_419142_c1
875 Ga0495612_0005750
876 Ga0495595_0000857
877 Ga0495595_0070927
878 Ga0500556_0006980
879 Ga0500616_0029770
880 Ga0501084_0019030
881 Ga0501084_0020162
882 Ga0501084_0089263
883 Ga0501084_0173616
884 Ga0501082_0694035
885 Ga0530510_0040338
886 Ga0530510_0161555

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

75

168

0.95

PF13649

Methyltransf_25

Methyltransferase domain

74

164

0.95

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

38

173

0.89

PF13847

Methyltransf_31

Methyltransferase domain

68

216

0.87

PF08242

Methyltransf_12

Methyltransferase domain

75

166

0.79

PF13489

Methyltransf_23

Methyltransferase domain

47

197

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wzg-assembly1.cif.gz_F cypemycin n-terminal methyltransferase cypm 0.8229 30 159
1ve3-assembly1.cif.gz_A-3 crystal structure of ph0226 protein from pyrococcus horikoshii ot3 0.804 44 160
6zxy-assembly1.cif.gz_B structure of archaeoglobus fulgidus trm11 m2g10 trna methyltransferase enzyme 0.8015 45 157
3i9f-assembly1.cif.gz_B crystal structure of a putative type 11 methyltransferase from sulfolobus solfataricus 0.7992 50 168
3tma-assembly1.cif.gz_A crystal structure of trmn from thermus thermophilus 0.7898 45 157
ID Description Score Start End Superfamily
af_A0A0R0HV62_55_242_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9203 34 158 3.40.50.150
af_Q8IJC4_363_592_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8934 56 158 3.40.50.150
2o57A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.873 45 155 3.40.50.150
af_Q553T0_166_421_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8711 24 158 3.40.50.150
af_A0A0P0Y1E1_35_188_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.87 42 155 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2R7Y1C0-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9425 60 157 GO:0008757
AF-A0A528KWT0-F1-model_v4 Methyltransferase domain-containing protein 0.9191 31 276 GO:0008757
GO:0032259
AF-A0A535T4T0-F1-model_v4 Methyltransferase domain-containing protein 0.9123 31 155 GO:0008757
GO:0032259
AF-A0A3B6JDB9-F1-model_v4 MPBQ/MBSQ family SAM-binding methyltransferase profile domain-containing protein 0.9121 43 158 GO:0032259
GO:0051741
AF-A0A538A9A7-F1-model_v4 Methyltransferase domain-containing protein 0.9067 30 275 GO:0008757
GO:0032259

Map