F445102

General Info

Members Datasets Scaffolds Average Seq Length
443 243 886 372

Family's Representative Sequence

Representative Sequence 3300028380|Ga0268265_10133410|Ga0268265_101334102
Length 399
Sequence MSDDRARILVVDDVPENVRLLEAVLDAHGYDVVSATDGRAALDLALSAKPDLVLLDVMMPPPDGLAVCKRLREMEETAVLPVIMLTASEGSEKTTAIEAGADDFLPKPFNREELLTRIRSLLRIKRYHDTIKAQAAELLSLNRTLEDRVQTQLEELGRLQRLRRFLSPQLADAIVSSGDESILRSHRRQVSMFFADLRGWTNFVDTVEPEELMRVLGEFHGTIGGLVDRFDATVGFIEGDGVQLFFNDPIEVPDPALRAVRLGCALREEMAELTALWQKRGYSLDFGAGIALGYATCGEVGFESRSDYAAIGAVTNLASRLADEAAAGQILISQRLYAEIEDEVDAEPVGEFTLKGFQRPVAAFNVIAIREPATELPSGSDSGHGDGAEPAQPLRTAEP

Samples

Sample ID Description Type Environment
1 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
133 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
134 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
135 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
149 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
161 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
164 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
165 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
166 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
176 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
180 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
181 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
192 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
218 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
228 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.32
Rhizosphere 93.68
Stem 0
Stem Tuber 0
Unclassified 4.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268265_10133410 3300028380 Unclassified 2068
2 JGI24033J26618_1001669 3300002155 Bacteria 2207
3 JGI24751J29686_10000223 3300002459 Bacteria 23798
4 JGI24751J29686_10007378 3300002459 Bacteria 2246
5 Ga0070683_100001131 3300005329 Bacteria 20182
6 Ga0070683_100011873 3300005329 Bacteria 7550
7 Ga0070683_100013383 3300005329 Bacteria 7154
8 Ga0070683_100087096 3300005329 Bacteria 2929
9 Ga0070683_100117836 3300005329 Bacteria 2507
10 Ga0070683_100138825 3300005329 Bacteria 2302
11 Ga0070670_100011290 3300005331 Bacteria 7635
12 Ga0070670_100127803 3300005331 Bacteria 2193
13 Ga0068869_100199092 3300005334 Bacteria 1578
14 Ga0070680_100023700 3300005336 Bacteria 4898
15 Ga0070680_100032404 3300005336 Bacteria 4207
16 Ga0070682_100131238 3300005337 Bacteria 1696
17 Ga0068868_100029932 3300005338 Bacteria 4173
18 Ga0070660_100126703 3300005339 Bacteria 2041
19 Ga0070687_100065373 3300005343 Bacteria 1935
20 Ga0070692_10042393 3300005345 Bacteria 2337
21 Ga0070668_100122997 3300005347 Bacteria 2076
22 Ga0070668_100177352 3300005347 Bacteria 1738
23 Ga0070675_100073619 3300005354 Bacteria 2836
24 Ga0070675_100187551 3300005354 Bacteria 1791
25 Ga0070674_100006099 3300005356 Bacteria 7009
26 Ga0070674_100009469 3300005356 Bacteria 5831
27 Ga0070673_100036857 3300005364 Bacteria 3722
28 Ga0070673_100100796 3300005364 Bacteria 2378
29 Ga0070688_100009091 3300005365 Bacteria 5419
30 Ga0070703_10003075 3300005406 Bacteria 4772
31 Ga0070703_10020978 3300005406 Bacteria 1906
32 Ga0070713_100160823 3300005436 Bacteria 2004
33 Ga0070700_100019689 3300005441 Bacteria 3899
34 Ga0070700_100110277 3300005441 Bacteria 1828
35 Ga0070708_100246732 3300005445 Bacteria 1677
36 Ga0070663_100085589 3300005455 Bacteria 2326
37 Ga0070678_100080894 3300005456 Bacteria 2461
38 Ga0070678_100107550 3300005456 Bacteria 2175
39 Ga0070681_10004315 3300005458 Bacteria 13511
40 Ga0070681_10014813 3300005458 Bacteria 7755
41 Ga0068867_100066769 3300005459 Bacteria 2680
42 Ga0068867_100114305 3300005459 Bacteria 2078
43 Ga0070698_100023227 3300005471 Bacteria 6482
44 Ga0070698_100038037 3300005471 Bacteria 4959
45 Ga0070698_100204161 3300005471 Bacteria 1911
46 Ga0070679_100009379 3300005530 Bacteria 9253
47 Ga0070679_100085037 3300005530 Bacteria 3150
48 Ga0070684_100000718 3300005535 Bacteria 22923
49 Ga0070684_100008288 3300005535 Bacteria 8118
50 Ga0070684_100110415 3300005535 Bacteria 2465
51 Ga0070684_100128526 3300005535 Bacteria 2284
52 Ga0070684_100135774 3300005535 Bacteria 2222
53 Ga0070684_100138515 3300005535 Bacteria 2199
54 Ga0070684_100193799 3300005535 Bacteria 1850
55 Ga0070697_100021631 3300005536 Bacteria 5098
56 Ga0070697_100140243 3300005536 Unclassified 2033
57 Ga0070672_100011868 3300005543 Bacteria 6088
58 Ga0070686_100084381 3300005544 Bacteria 2110
59 Ga0070695_100077719 3300005545 Bacteria 2187
60 Ga0070696_100097058 3300005546 Bacteria 2107
61 Ga0070665_100026962 3300005548 Bacteria 5785
62 Ga0070704_100001582 3300005549 Bacteria 12291
63 Ga0070704_100236631 3300005549 Bacteria 1493
64 Ga0068855_100019062 3300005563 Bacteria 8249
65 Ga0070664_100019961 3300005564 Bacteria 5517
66 Ga0070664_100098038 3300005564 Bacteria 2546
67 Ga0068857_100027256 3300005577 Bacteria 5039
68 Ga0068857_100048240 3300005577 Bacteria 3781
69 Ga0068857_100174190 3300005577 Bacteria 1956
70 Ga0068854_100169841 3300005578 Bacteria 1696
71 Ga0068856_100246521 3300005614 Bacteria 1802
72 Ga0068856_100271507 3300005614 Unclassified 1712
73 Ga0070702_100159756 3300005615 Unclassified 1455
74 Ga0068852_100091564 3300005616 Bacteria 2721
75 Ga0068859_100042738 3300005617 Bacteria 4553
76 Ga0068864_100080192 3300005618 Bacteria 2859
77 Ga0068864_100150585 3300005618 Bacteria 2107
78 Ga0068866_10062500 3300005718 Unclassified 1937
79 Ga0068866_10165344 3300005718 Bacteria 1294
80 Ga0068861_100004620 3300005719 Bacteria 9242
81 Ga0068851_10145605 3300005834 Bacteria 1291
82 Ga0068870_10004753 3300005840 Bacteria 5871
83 Ga0068870_10007440 3300005840 Bacteria 4881
84 Ga0068870_10063658 3300005840 Bacteria 1990
85 Ga0068870_10087930 3300005840 Bacteria 1731
86 Ga0068863_100028952 3300005841 Bacteria 5290
87 Ga0068858_100154774 3300005842 Bacteria 2157
88 Ga0068860_100136828 3300005843 Bacteria 2353
89 Ga0068860_100325648 3300005843 Bacteria 1508
90 Ga0068862_100076290 3300005844 Bacteria 2901
91 Ga0081455_10015172 3300005937 Bacteria 7498
92 Ga0081455_10023102 3300005937 Bacteria 5793
93 Ga0081455_10051279 3300005937 Bacteria 3540
94 Ga0081455_10169928 3300005937 Bacteria 1662
95 Ga0081538_10084753 3300005981 Bacteria 1668
96 Ga0081540_1000879 3300005983 Bacteria 27145
97 Ga0081539_10002754 3300005985 Bacteria 23660
98 Ga0070717_10020221 3300006028 Bacteria 5232
99 Ga0070717_10046917 3300006028 Bacteria 3537
100 Ga0075432_10001799 3300006058 Bacteria 7065
101 Ga0070712_100039241 3300006175 Bacteria 3240
102 Ga0097621_100120527 3300006237 Bacteria 2224
103 Ga0068871_100303981 3300006358 Bacteria 1401
104 Ga0075428_100007325 3300006844 Bacteria 12225
105 Ga0075428_100024429 3300006844 Bacteria 6687
106 Ga0075428_100033997 3300006844 Bacteria 5624
107 Ga0075428_100039421 3300006844 Bacteria 5199
108 Ga0075428_100068594 3300006844 Bacteria 3879
109 Ga0075430_100010189 3300006846 Bacteria 7960
110 Ga0075430_100082386 3300006846 Bacteria 2696
111 Ga0075431_100010011 3300006847 Bacteria 9525
112 Ga0075431_100055559 3300006847 Bacteria 4084
113 Ga0075433_10000149 3300006852 Bacteria 37279
114 Ga0075433_10011686 3300006852 Bacteria 7070
115 Ga0075433_10021142 3300006852 Bacteria 5454
116 Ga0075433_10088345 3300006852 Bacteria 2739
117 Ga0075434_100005828 3300006871 Bacteria 11253
118 Ga0075434_100007538 3300006871 Bacteria 10078
119 Ga0075434_100073068 3300006871 Bacteria 3422
120 Ga0075429_100214842 3300006880 Bacteria 1685
121 Ga0068865_100098550 3300006881 Bacteria 2136
122 Ga0068865_100206360 3300006881 Unclassified 1528
123 Ga0097620_100042737 3300006931 Bacteria 4553
124 Ga0075435_100032344 3300007076 Bacteria 4130
125 Ga0075435_100066195 3300007076 Bacteria 2939
126 Ga0105240_10038750 3300009093 Bacteria 6111
127 Ga0111539_10010042 3300009094 Bacteria 11933
128 Ga0111539_10277101 3300009094 Bacteria 1952
129 Ga0111539_10284180 3300009094 Bacteria 1925
130 Ga0105245_10146555 3300009098 Bacteria 2228
131 Ga0105245_10247230 3300009098 Unclassified 1731
132 Ga0105245_10347320 3300009098 Bacteria 1469
133 Ga0105245_10411143 3300009098 Bacteria 1354
134 Ga0105247_10023979 3300009101 Bacteria 3676
135 Ga0114129_10000667 3300009147 Bacteria 43086
136 Ga0114129_10004092 3300009147 Bacteria 20601
137 Ga0114129_10089440 3300009147 Bacteria 4268
138 Ga0105243_10006839 3300009148 Bacteria 8790
139 Ga0105243_10009871 3300009148 Bacteria 7261
140 Ga0105243_10032066 3300009148 Bacteria 4056
141 Ga0105243_10079721 3300009148 Bacteria 2669
142 Ga0105242_10009376 3300009176 Bacteria 7511
143 Ga0105242_10092488 3300009176 Bacteria 2548
144 Ga0105242_10301250 3300009176 Bacteria 1463
145 Ga0105248_10011530 3300009177 Bacteria 9743
146 Ga0105248_10031295 3300009177 Bacteria 5947
147 Ga0105238_10015628 3300009551 Bacteria 7682
148 Ga0105238_10035931 3300009551 Bacteria 5037
149 Ga0105249_10123526 3300009553 Bacteria 2463
150 Ga0105249_10343266 3300009553 Bacteria 1510
151 Ga0105239_10113594 3300010375 Bacteria 3003
152 Ga0105246_10022863 3300011119 Bacteria 4040
153 Ga0157370_10245694 3300013104 Bacteria 1656
154 Ga0157374_10175068 3300013296 Bacteria 2094
155 Ga0163162_10201780 3300013306 Bacteria 2117
156 Ga0157372_10394827 3300013307 Bacteria 1612
157 Ga0163163_10263831 3300014325 Bacteria 1773
158 Ga0163163_10355333 3300014325 Bacteria 1522
159 Ga0157380_10004114 3300014326 Bacteria 10043
160 Ga0157380_10025600 3300014326 Bacteria 4476
161 Ga0157380_10267225 3300014326 Unclassified 1557
162 Ga0157377_10037023 3300014745 Bacteria 2687
163 Ga0157379_10101297 3300014968 Bacteria 2585
164 Ga0207656_10011064 3300025321 Bacteria 3399
165 Ga0207653_10001669 3300025885 Bacteria 7115
166 Ga0207642_10148628 3300025899 Bacteria 1244
167 Ga0207710_10005058 3300025900 Bacteria 5714
168 Ga0207688_10005746 3300025901 Bacteria 6748
169 Ga0207688_10010940 3300025901 Bacteria 4937
170 Ga0207688_10017894 3300025901 Bacteria 3856
171 Ga0207645_10087416 3300025907 Bacteria 2003
172 Ga0207643_10005135 3300025908 Bacteria 7003
173 Ga0207643_10114293 3300025908 Bacteria 1593
174 Ga0207707_10032030 3300025912 Bacteria 4603
175 Ga0207707_10141291 3300025912 Bacteria 2105
176 Ga0207693_10052205 3300025915 Bacteria 3206
177 Ga0207693_10092683 3300025915 Bacteria 2367
178 Ga0207662_10043290 3300025918 Bacteria 2656
179 Ga0207657_10025802 3300025919 Bacteria 5412
180 Ga0207659_10358582 3300025926 Bacteria 1211
181 Ga0207687_10072029 3300025927 Bacteria 2471
182 Ga0207687_10083177 3300025927 Bacteria 2317
183 Ga0207687_10181771 3300025927 Bacteria 1630
184 Ga0207700_10216674 3300025928 Bacteria 1621
185 Ga0207706_10037083 3300025933 Bacteria 4329
186 Ga0207706_10100779 3300025933 Unclassified 2541
187 Ga0207686_10190860 3300025934 Bacteria 1460
188 Ga0207686_10195907 3300025934 Bacteria 1444
189 Ga0207709_10128340 3300025935 Bacteria 1724
190 Ga0207670_10017826 3300025936 Bacteria 4300
191 Ga0207670_10115103 3300025936 Bacteria 1945
192 Ga0207669_10020000 3300025937 Bacteria 3499
193 Ga0207691_10012079 3300025940 Bacteria 8282
194 Ga0207711_10030829 3300025941 Bacteria 4524
195 Ga0207689_10024119 3300025942 Bacteria 5104
196 Ga0207661_10003786 3300025944 Bacteria 10550
197 Ga0207661_10011462 3300025944 Bacteria 6425
198 Ga0207661_10043525 3300025944 Bacteria 3543
199 Ga0207667_10314505 3300025949 Bacteria 1599
200 Ga0207712_10037324 3300025961 Bacteria 3314
201 Ga0207640_10119660 3300025981 Bacteria 1884
202 Ga0207677_10091353 3300026023 Bacteria 2214
203 Ga0207703_10059681 3300026035 Bacteria 3116
204 Ga0207678_10043858 3300026067 Bacteria 3869
205 Ga0207708_10011411 3300026075 Bacteria 6616
206 Ga0207708_10019504 3300026075 Bacteria 5113
207 Ga0207702_10214253 3300026078 Bacteria 1792
208 Ga0207648_10012528 3300026089 Bacteria 7936
209 Ga0207648_10137370 3300026089 Bacteria 2153
210 Ga0207676_10001154 3300026095 Bacteria 19868
211 Ga0207674_10000474 3300026116 Bacteria 52766
212 Ga0207674_10002131 3300026116 Bacteria 25008
213 Ga0207674_10022430 3300026116 Bacteria 6778
214 Ga0207674_10180838 3300026116 Bacteria 2060
215 Ga0207675_100094356 3300026118 Bacteria 2815
216 Ga0207675_100133465 3300026118 Unclassified 2354
217 Ga0207683_10021066 3300026121 Bacteria 5579
218 Ga0207428_10000597 3300027907 Bacteria 42692
219 Ga0207428_10000612 3300027907 Bacteria 42181
220 Ga0207428_10036615 3300027907 Bacteria 4001
221 Ga0207428_10066471 3300027907 Bacteria 2841
222 Ga0268265_10041936 3300028380 Bacteria 3392
223 Ga0268264_10267588 3300028381 Bacteria 1595
224 Ga0265327_10004847 3300031251 Bacteria 11661
225 Ga0307405_10089568 3300031731 Bacteria 2033
226 Ga0307416_100028459 3300032002 Bacteria 4156
227 Ga0373958_0016516 3300034819 Bacteria 1317
228 Ga0373949_0028378 3300035090 Bacteria 1320
229 Ga0373957_0043644 3300035120 Bacteria 1695
230 Ga0373924_0036460 3300035410 Bacteria 1999
231 Ga0373931_0123775 3300035691 Bacteria 1481
232 Ga0373935_0073386 3300035692 Bacteria 2211
233 Ga0373927_0063614 3300035695 Bacteria 2386
234 Ga0373933_0086191 3300035724 Bacteria 1932
235 Ga0373947_0068045 3300035725 Bacteria 2177
236 Ga0373947_0068108 3300035725 Bacteria 2176
237 Ga0373937_0030316 3300036401 Bacteria 4899
238 Ga0373925_0076798 3300037068 Bacteria 2534
239 Ga0395899_0003576 3300037312 Bacteria 12306
240 Ga0395899_0003704 3300037312 Bacteria 12092
241 Ga0395899_0005616 3300037312 Bacteria 9733
242 Ga0395899_0020638 3300037312 Bacteria 4994
243 Ga0395899_0024678 3300037312 Bacteria 4544
244 Ga0395899_0079865 3300037312 Unclassified 2382
245 Ga0395900_0002509 3300037418 Bacteria 20165
246 Ga0395900_0003775 3300037418 Bacteria 16230
247 Ga0395900_0006012 3300037418 Bacteria 12662
248 Ga0395900_0011358 3300037418 Bacteria 9111
249 Ga0395900_0020004 3300037418 Bacteria 6824
250 Ga0395900_0025384 3300037418 Bacteria 6067
251 Ga0395900_0032470 3300037418 Bacteria 5369
252 Ga0395900_0035599 3300037418 Bacteria 5128
253 Ga0395900_0044769 3300037418 Bacteria 4559
254 Ga0395900_0095862 3300037418 Bacteria 3048
255 Ga0395900_0114443 3300037418 Bacteria 2768
256 Ga0395900_0182108 3300037418 Bacteria 2134
257 Ga0395900_0266194 3300037418 Bacteria 1710
258 Ga0395898_0008185 3300037466 Bacteria 11064
259 Ga0395898_0010957 3300037466 Bacteria 9454
260 Ga0395898_0027496 3300037466 Bacteria 5709
261 Ga0395898_0031515 3300037466 Bacteria 5296
262 Ga0395898_0039142 3300037466 Bacteria 4694
263 Ga0395898_0214444 3300037466 Bacteria 1836
264 Ga0395898_0223399 3300037466 Bacteria 1796
265 Ga0395898_0268485 3300037466 Bacteria 1627
266 Ga0395905_0014012 3300037471 Bacteria 7667
267 Ga0395905_0017698 3300037471 Bacteria 6766
268 Ga0395905_0020103 3300037471 Bacteria 6326
269 Ga0395905_0021749 3300037471 Bacteria 6067
270 Ga0395905_0024628 3300037471 Bacteria 5678
271 Ga0395905_0100693 3300037471 Bacteria 2713
272 Ga0395905_0238415 3300037471 Bacteria 1700
273 Ga0395905_0260712 3300037471 Bacteria 1618
274 Ga0395901_0004795 3300038443 Bacteria 13643
275 Ga0395901_0014998 3300038443 Bacteria 7876
276 Ga0395901_0019865 3300038443 Bacteria 6872
277 Ga0395901_0031459 3300038443 Bacteria 5472
278 Ga0395901_0054431 3300038443 Bacteria 4159
279 Ga0395901_0087819 3300038443 Bacteria 3251
280 Ga0395901_0100214 3300038443 Bacteria 3038
281 Ga0395901_0244301 3300038443 Bacteria 1871
282 Ga0395901_0251348 3300038443 Bacteria 1841
283 Ga0395901_0305862 3300038443 Bacteria 1648
284 Ga0395901_0329392 3300038443 Bacteria 1579
285 Ga0436360_0422562 3300039438 Bacteria 2478
286 Ga0436360_0560791 3300039438 Bacteria 1839
287 Ga0439460_0017901 3300042461 Bacteria 1903
288 Ga0466963_0005521 3300044694 Bacteria 7402
289 Ga0466964_0002782 3300044706 Bacteria 6287
290 Ga0466964_0055804 3300044706 Bacteria 1632
291 Ga0466957_0009060 3300044842 Bacteria 5674
292 Ga0451576_0098706 3300045051 Unclassified 3038
293 Ga0466967_0005143 3300045976 Bacteria 8998
294 Ga0466967_0082101 3300045976 Bacteria 2912
295 Ga0466967_0155314 3300045976 Bacteria 2142
296 Ga0466967_0182474 3300045976 Bacteria 1980
297 Ga0466967_0201087 3300045976 Bacteria 1887
298 Ga0466967_0418870 3300045976 Bacteria 1305
299 Ga0495592_0019579 3300046454 Bacteria 5148
300 Ga0495629_0021760 3300046459 Bacteria 4575
301 Ga0495651_0144538 3300046462 Bacteria 1721
302 Ga0495653_0027976 3300046463 Bacteria 4512
303 Ga0495585_0074859 3300046492 Bacteria 1842
304 Ga0495608_0003819 3300046511 Bacteria 10827
305 Ga0495618_0070772 3300046514 Bacteria 2219
306 Ga0495630_0049785 3300046517 Bacteria 3135
307 Ga0495637_0029404 3300046520 Bacteria 2446
308 Ga0495644_0065961 3300046523 Unclassified 1360
309 Ga0495663_0044208 3300046525 Viruses 1363
310 Ga0495642_0098470 3300046528 Unclassified 1243
311 Ga0495640_0052554 3300046533 Bacteria 2797
312 Ga0495587_0045090 3300046536 Bacteria 2622
313 Ga0495609_0054158 3300046538 Unclassified 1782
314 Ga0495609_0111969 3300046538 Bacteria 1178
315 Ga0495667_0012022 3300046559 Bacteria 5863
316 Ga0495634_0055350 3300046642 Bacteria 2652
317 Ga0495635_0106627 3300046663 Bacteria 1914
318 Ga0495657_0020035 3300046675 Bacteria 4814
319 Ga0495657_0100762 3300046675 Bacteria 1841
320 Ga0495599_0004930 3300046678 Bacteria 7930
321 Ga0495623_0047549 3300046679 Bacteria 2723
322 Ga0495646_0028999 3300046680 Bacteria 3462
323 Ga0495658_0036304 3300046683 Bacteria 2718
324 Ga0495613_0012660 3300046689 Bacteria 6271
325 Ga0495613_0025165 3300046689 Bacteria 4436
326 Ga0495624_0029664 3300046690 Bacteria 3567
327 Ga0495624_0096050 3300046690 Bacteria 1826
328 Ga0495671_0039722 3300046692 Bacteria 2375
329 Ga0495589_0025551 3300046794 Bacteria 2997
330 Ga0495600_0007954 3300046809 Bacteria 6497
331 Ga0495600_0098998 3300046809 Bacteria 1901
332 Ga0495581_0133934 3300047315 Bacteria 1444
333 Ga0495604_0008367 3300047317 Bacteria 8180
334 Ga0495674_0117234 3300047319 Bacteria 2252
335 Ga0495676_0155735 3300047321 Bacteria 1621
336 Ga0495680_0007687 3300047322 Bacteria 9840
337 Ga0495680_0023256 3300047322 Bacteria 5155
338 Ga0495675_0005148 3300047444 Bacteria 7957
339 Ga0495677_0086599 3300047445 Unclassified 1178
340 Ga0495684_0032603 3300047471 Bacteria 4000
341 Ga0495684_0066809 3300047471 Bacteria 2734
342 Ga0495602_0013823 3300048088 Bacteria 8229
343 Ga0495602_0056568 3300048088 Bacteria 3448
344 Ga0495602_0069823 3300048088 Bacteria 3010
345 Ga0495626_0134369 3300048091 Unclassified 1054
346 Ga0496101_0031048 3300048904 Bacteria 3752
347 Ga0496101_0056633 3300048904 Bacteria 2834
348 Ga0496102_0220402 3300048905 Bacteria 1788
349 Ga0496103_0150855 3300048906 Unclassified 1489
350 Ga0496104_0007884 3300048907 Bacteria 9444
351 Ga0496104_0049875 3300048907 Bacteria 3948
352 Ga0496104_0387987 3300048907 Bacteria 1309
353 Ga0496105_0009769 3300048908 Bacteria 7515
354 Ga0496105_0198469 3300048908 Bacteria 1638
355 Ga0496106_0020958 3300048909 Bacteria 4850
356 Ga0496107_0040804 3300048910 Bacteria 3332
357 Ga0496108_0041709 3300048911 Bacteria 3832
358 Ga0496108_0061648 3300048911 Bacteria 3156
359 Ga0496108_0080591 3300048911 Bacteria 2758
360 Ga0496108_0113713 3300048911 Bacteria 2317
361 Ga0496108_0117937 3300048911 Bacteria 2275
362 Ga0496109_0020397 3300048912 Bacteria 5854
363 Ga0496109_0021245 3300048912 Bacteria 5739
364 Ga0496109_0043225 3300048912 Bacteria 4084
365 Ga0496109_0076056 3300048912 Bacteria 3088
366 Ga0496109_0360097 3300048912 Bacteria 1374
367 Ga0496110_0015243 3300048913 Bacteria 6392
368 Ga0496110_0036616 3300048913 Bacteria 4261
369 Ga0496110_0049636 3300048913 Bacteria 3682
370 Ga0496111_0065900 3300048914 Bacteria 2629
371 Ga0496114_0014274 3300048917 Bacteria 6373
372 Ga0496114_0126572 3300048917 Bacteria 2203
373 Ga0496115_0010598 3300048918 Bacteria 6894
374 Ga0501031_0017160 3300049568 Bacteria 4704
375 Ga0501032_0009499 3300049569 Bacteria 7048
376 Ga0501036_0002911 3300049572 Bacteria 13584
377 Ga0501036_0023454 3300049572 Bacteria 5199
378 Ga0501037_0136568 3300049573 Bacteria 1756
379 Ga0501037_0230025 3300049573 Bacteria 1302
380 Ga0501039_0005424 3300049575 Bacteria 9641
381 Ga0501039_0031596 3300049575 Bacteria 4082
382 Ga0501039_0141218 3300049575 Bacteria 1892
383 Ga0501040_0189141 3300049576 Bacteria 1460
384 Ga0501041_0008515 3300049577 Bacteria 6037
385 Ga0501041_0030363 3300049577 Bacteria 3261
386 Ga0501042_0003550 3300049578 Bacteria 9815
387 Ga0501043_0027956 3300049579 Bacteria 4427
388 Ga0501046_0006355 3300049580 Bacteria 10477
389 Ga0501048_0061804 3300049582 Bacteria 2651
390 Ga0501068_0012067 3300049584 Bacteria 4890
391 Ga0501069_0054532 3300049585 Bacteria 2226
392 Ga0501071_0002637 3300049587 Bacteria 10978
393 Ga0501071_0011103 3300049587 Bacteria 6054
394 Ga0501072_0022731 3300049588 Bacteria 4865
395 Ga0501074_0013222 3300049590 Bacteria 6001
396 Ga0501074_0029295 3300049590 Bacteria 3988
397 Ga0501075_0030898 3300049591 Bacteria 3971
398 Ga0501075_0047023 3300049591 Bacteria 3242
399 Ga0501076_0002533 3300049592 Bacteria 12573
400 Ga0501076_0024282 3300049592 Bacteria 4683
401 Ga0501077_0002613 3300049593 Bacteria 10786
402 Ga0501077_0020436 3300049593 Bacteria 4191
403 Ga0501079_0003011 3300049741 Bacteria 12323
404 Ga0501079_0037053 3300049741 Bacteria 3757
405 Ga0501080_0006559 3300049742 Bacteria 10460
406 Ga0501080_0055563 3300049742 Bacteria 3688
407 Ga0501081_0008667 3300049743 Bacteria 6607
408 Ga0501083_0006107 3300049744 Bacteria 8538
409 Ga0501083_0017440 3300049744 Bacteria 5004
410 Ga0501044_0157716 3300049823 Bacteria 2248
411 Ga0501045_0004481 3300049824 Bacteria 9648
412 Ga0501045_0013202 3300049824 Bacteria 5826
413 Ga0501045_0094963 3300049824 Bacteria 2206
414 nmdc:mga05p37_134912_c1 3300050507 Bacteria 3028
415 nmdc:mga05p37_200162_c1 3300050507 Bacteria 2420
416 nmdc:mga05p37_223309_c1 3300050507 Bacteria 2273
417 nmdc:mga05p37_4582_c1 3300050507 Bacteria 16162
418 nmdc:mga09592_298439_c1 3300050508 Bacteria 1397
419 nmdc:mga09592_48952_c1 3300050508 Bacteria 3563
420 nmdc:mga0qj67_2994_c1 3300050509 Bacteria 12123
421 nmdc:mga0qj67_4158_c1 3300050509 Bacteria 10490
422 nmdc:mga06r32_195905_c1 3300050510 Bacteria 2008
423 nmdc:mga06r32_30480_c1 3300050510 Bacteria 5061
424 nmdc:mga08y16_126060_c1 3300050511 Bacteria 2664
425 nmdc:mga08y16_138664_c1 3300050511 Bacteria 2529
426 nmdc:mga08y16_17248_c1 3300050511 Bacteria 7601
427 nmdc:mga08y16_60836_c1 3300050511 Bacteria 3944
428 nmdc:mga08y16_7663_c1 3300050511 Bacteria 11299
429 nmdc:mga0n895_14265_c1 3300050512 Bacteria 7210
430 nmdc:mga0n895_156849_c1 3300050512 Bacteria 2307
431 nmdc:mga0n895_387574_c1 3300050512 Bacteria 1414
432 nmdc:mga0rr50_59331_c1 3300050513 Bacteria 2872
433 nmdc:mga0a205_24400_c1 3300050515 Bacteria 5750
434 nmdc:mga0a205_398206_c1 3300050515 Bacteria 1241
435 nmdc:mga0a205_51265_c1 3300050515 Bacteria 3984
436 Ga0495601_0117903 3300053077 Bacteria 1722
437 Ga0495601_0177239 3300053077 Bacteria 1394
438 Ga0495619_0005547 3300053085 Bacteria 8005
439 Ga0501084_0064556 3300054114 Bacteria 3063
440 Ga0501084_0099502 3300054114 Bacteria 2442
441 Ga0501084_0413579 3300054114 Bacteria 1140
442 Ga0501082_0006790 3300060353 Bacteria 9890
443 Ga0530510_0003120 3300061734 Bacteria 11372
444 Ga0268265_10133410
445 JGI24033J26618_1001669
446 JGI24751J29686_10000223
447 JGI24751J29686_10007378
448 Ga0070683_100001131
449 Ga0070683_100011873
450 Ga0070683_100013383
451 Ga0070683_100087096
452 Ga0070683_100117836
453 Ga0070683_100138825
454 Ga0070670_100011290
455 Ga0070670_100127803
456 Ga0068869_100199092
457 Ga0070680_100023700
458 Ga0070680_100032404
459 Ga0070682_100131238
460 Ga0068868_100029932
461 Ga0070660_100126703
462 Ga0070687_100065373
463 Ga0070692_10042393
464 Ga0070668_100122997
465 Ga0070668_100177352
466 Ga0070675_100073619
467 Ga0070675_100187551
468 Ga0070674_100006099
469 Ga0070674_100009469
470 Ga0070673_100036857
471 Ga0070673_100100796
472 Ga0070688_100009091
473 Ga0070703_10003075
474 Ga0070703_10020978
475 Ga0070713_100160823
476 Ga0070700_100019689
477 Ga0070700_100110277
478 Ga0070708_100246732
479 Ga0070663_100085589
480 Ga0070678_100080894
481 Ga0070678_100107550
482 Ga0070681_10004315
483 Ga0070681_10014813
484 Ga0068867_100066769
485 Ga0068867_100114305
486 Ga0070698_100023227
487 Ga0070698_100038037
488 Ga0070698_100204161
489 Ga0070679_100009379
490 Ga0070679_100085037
491 Ga0070684_100000718
492 Ga0070684_100008288
493 Ga0070684_100110415
494 Ga0070684_100128526
495 Ga0070684_100135774
496 Ga0070684_100138515
497 Ga0070684_100193799
498 Ga0070697_100021631
499 Ga0070697_100140243
500 Ga0070672_100011868
501 Ga0070686_100084381
502 Ga0070695_100077719
503 Ga0070696_100097058
504 Ga0070665_100026962
505 Ga0070704_100001582
506 Ga0070704_100236631
507 Ga0068855_100019062
508 Ga0070664_100019961
509 Ga0070664_100098038
510 Ga0068857_100027256
511 Ga0068857_100048240
512 Ga0068857_100174190
513 Ga0068854_100169841
514 Ga0068856_100246521
515 Ga0068856_100271507
516 Ga0070702_100159756
517 Ga0068852_100091564
518 Ga0068859_100042738
519 Ga0068864_100080192
520 Ga0068864_100150585
521 Ga0068866_10062500
522 Ga0068866_10165344
523 Ga0068861_100004620
524 Ga0068851_10145605
525 Ga0068870_10004753
526 Ga0068870_10007440
527 Ga0068870_10063658
528 Ga0068870_10087930
529 Ga0068863_100028952
530 Ga0068858_100154774
531 Ga0068860_100136828
532 Ga0068860_100325648
533 Ga0068862_100076290
534 Ga0081455_10015172
535 Ga0081455_10023102
536 Ga0081455_10051279
537 Ga0081455_10169928
538 Ga0081538_10084753
539 Ga0081540_1000879
540 Ga0081539_10002754
541 Ga0070717_10020221
542 Ga0070717_10046917
543 Ga0075432_10001799
544 Ga0070712_100039241
545 Ga0097621_100120527
546 Ga0068871_100303981
547 Ga0075428_100007325
548 Ga0075428_100024429
549 Ga0075428_100033997
550 Ga0075428_100039421
551 Ga0075428_100068594
552 Ga0075430_100010189
553 Ga0075430_100082386
554 Ga0075431_100010011
555 Ga0075431_100055559
556 Ga0075433_10000149
557 Ga0075433_10011686
558 Ga0075433_10021142
559 Ga0075433_10088345
560 Ga0075434_100005828
561 Ga0075434_100007538
562 Ga0075434_100073068
563 Ga0075429_100214842
564 Ga0068865_100098550
565 Ga0068865_100206360
566 Ga0097620_100042737
567 Ga0075435_100032344
568 Ga0075435_100066195
569 Ga0105240_10038750
570 Ga0111539_10010042
571 Ga0111539_10277101
572 Ga0111539_10284180
573 Ga0105245_10146555
574 Ga0105245_10247230
575 Ga0105245_10347320
576 Ga0105245_10411143
577 Ga0105247_10023979
578 Ga0114129_10000667
579 Ga0114129_10004092
580 Ga0114129_10089440
581 Ga0105243_10006839
582 Ga0105243_10009871
583 Ga0105243_10032066
584 Ga0105243_10079721
585 Ga0105242_10009376
586 Ga0105242_10092488
587 Ga0105242_10301250
588 Ga0105248_10011530
589 Ga0105248_10031295
590 Ga0105238_10015628
591 Ga0105238_10035931
592 Ga0105249_10123526
593 Ga0105249_10343266
594 Ga0105239_10113594
595 Ga0105246_10022863
596 Ga0157370_10245694
597 Ga0157374_10175068
598 Ga0163162_10201780
599 Ga0157372_10394827
600 Ga0163163_10263831
601 Ga0163163_10355333
602 Ga0157380_10004114
603 Ga0157380_10025600
604 Ga0157380_10267225
605 Ga0157377_10037023
606 Ga0157379_10101297
607 Ga0207656_10011064
608 Ga0207653_10001669
609 Ga0207642_10148628
610 Ga0207710_10005058
611 Ga0207688_10005746
612 Ga0207688_10010940
613 Ga0207688_10017894
614 Ga0207645_10087416
615 Ga0207643_10005135
616 Ga0207643_10114293
617 Ga0207707_10032030
618 Ga0207707_10141291
619 Ga0207693_10052205
620 Ga0207693_10092683
621 Ga0207662_10043290
622 Ga0207657_10025802
623 Ga0207659_10358582
624 Ga0207687_10072029
625 Ga0207687_10083177
626 Ga0207687_10181771
627 Ga0207700_10216674
628 Ga0207706_10037083
629 Ga0207706_10100779
630 Ga0207686_10190860
631 Ga0207686_10195907
632 Ga0207709_10128340
633 Ga0207670_10017826
634 Ga0207670_10115103
635 Ga0207669_10020000
636 Ga0207691_10012079
637 Ga0207711_10030829
638 Ga0207689_10024119
639 Ga0207661_10003786
640 Ga0207661_10011462
641 Ga0207661_10043525
642 Ga0207667_10314505
643 Ga0207712_10037324
644 Ga0207640_10119660
645 Ga0207677_10091353
646 Ga0207703_10059681
647 Ga0207678_10043858
648 Ga0207708_10011411
649 Ga0207708_10019504
650 Ga0207702_10214253
651 Ga0207648_10012528
652 Ga0207648_10137370
653 Ga0207676_10001154
654 Ga0207674_10000474
655 Ga0207674_10002131
656 Ga0207674_10022430
657 Ga0207674_10180838
658 Ga0207675_100094356
659 Ga0207675_100133465
660 Ga0207683_10021066
661 Ga0207428_10000597
662 Ga0207428_10000612
663 Ga0207428_10036615
664 Ga0207428_10066471
665 Ga0268265_10041936
666 Ga0268264_10267588
667 Ga0265327_10004847
668 Ga0307405_10089568
669 Ga0307416_100028459
670 Ga0373958_0016516
671 Ga0373949_0028378
672 Ga0373957_0043644
673 Ga0373924_0036460
674 Ga0373931_0123775
675 Ga0373935_0073386
676 Ga0373927_0063614
677 Ga0373933_0086191
678 Ga0373947_0068045
679 Ga0373947_0068108
680 Ga0373937_0030316
681 Ga0373925_0076798
682 Ga0395899_0003576
683 Ga0395899_0003704
684 Ga0395899_0005616
685 Ga0395899_0020638
686 Ga0395899_0024678
687 Ga0395899_0079865
688 Ga0395900_0002509
689 Ga0395900_0003775
690 Ga0395900_0006012
691 Ga0395900_0011358
692 Ga0395900_0020004
693 Ga0395900_0025384
694 Ga0395900_0032470
695 Ga0395900_0035599
696 Ga0395900_0044769
697 Ga0395900_0095862
698 Ga0395900_0114443
699 Ga0395900_0182108
700 Ga0395900_0266194
701 Ga0395898_0008185
702 Ga0395898_0010957
703 Ga0395898_0027496
704 Ga0395898_0031515
705 Ga0395898_0039142
706 Ga0395898_0214444
707 Ga0395898_0223399
708 Ga0395898_0268485
709 Ga0395905_0014012
710 Ga0395905_0017698
711 Ga0395905_0020103
712 Ga0395905_0021749
713 Ga0395905_0024628
714 Ga0395905_0100693
715 Ga0395905_0238415
716 Ga0395905_0260712
717 Ga0395901_0004795
718 Ga0395901_0014998
719 Ga0395901_0019865
720 Ga0395901_0031459
721 Ga0395901_0054431
722 Ga0395901_0087819
723 Ga0395901_0100214
724 Ga0395901_0244301
725 Ga0395901_0251348
726 Ga0395901_0305862
727 Ga0395901_0329392
728 Ga0436360_0422562
729 Ga0436360_0560791
730 Ga0439460_0017901
731 Ga0466963_0005521
732 Ga0466964_0002782
733 Ga0466964_0055804
734 Ga0466957_0009060
735 Ga0451576_0098706
736 Ga0466967_0005143
737 Ga0466967_0082101
738 Ga0466967_0155314
739 Ga0466967_0182474
740 Ga0466967_0201087
741 Ga0466967_0418870
742 Ga0495592_0019579
743 Ga0495629_0021760
744 Ga0495651_0144538
745 Ga0495653_0027976
746 Ga0495585_0074859
747 Ga0495608_0003819
748 Ga0495618_0070772
749 Ga0495630_0049785
750 Ga0495637_0029404
751 Ga0495644_0065961
752 Ga0495663_0044208
753 Ga0495642_0098470
754 Ga0495640_0052554
755 Ga0495587_0045090
756 Ga0495609_0054158
757 Ga0495609_0111969
758 Ga0495667_0012022
759 Ga0495634_0055350
760 Ga0495635_0106627
761 Ga0495657_0020035
762 Ga0495657_0100762
763 Ga0495599_0004930
764 Ga0495623_0047549
765 Ga0495646_0028999
766 Ga0495658_0036304
767 Ga0495613_0012660
768 Ga0495613_0025165
769 Ga0495624_0029664
770 Ga0495624_0096050
771 Ga0495671_0039722
772 Ga0495589_0025551
773 Ga0495600_0007954
774 Ga0495600_0098998
775 Ga0495581_0133934
776 Ga0495604_0008367
777 Ga0495674_0117234
778 Ga0495676_0155735
779 Ga0495680_0007687
780 Ga0495680_0023256
781 Ga0495675_0005148
782 Ga0495677_0086599
783 Ga0495684_0032603
784 Ga0495684_0066809
785 Ga0495602_0013823
786 Ga0495602_0056568
787 Ga0495602_0069823
788 Ga0495626_0134369
789 Ga0496101_0031048
790 Ga0496101_0056633
791 Ga0496102_0220402
792 Ga0496103_0150855
793 Ga0496104_0007884
794 Ga0496104_0049875
795 Ga0496104_0387987
796 Ga0496105_0009769
797 Ga0496105_0198469
798 Ga0496106_0020958
799 Ga0496107_0040804
800 Ga0496108_0041709
801 Ga0496108_0061648
802 Ga0496108_0080591
803 Ga0496108_0113713
804 Ga0496108_0117937
805 Ga0496109_0020397
806 Ga0496109_0021245
807 Ga0496109_0043225
808 Ga0496109_0076056
809 Ga0496109_0360097
810 Ga0496110_0015243
811 Ga0496110_0036616
812 Ga0496110_0049636
813 Ga0496111_0065900
814 Ga0496114_0014274
815 Ga0496114_0126572
816 Ga0496115_0010598
817 Ga0501031_0017160
818 Ga0501032_0009499
819 Ga0501036_0002911
820 Ga0501036_0023454
821 Ga0501037_0136568
822 Ga0501037_0230025
823 Ga0501039_0005424
824 Ga0501039_0031596
825 Ga0501039_0141218
826 Ga0501040_0189141
827 Ga0501041_0008515
828 Ga0501041_0030363
829 Ga0501042_0003550
830 Ga0501043_0027956
831 Ga0501046_0006355
832 Ga0501048_0061804
833 Ga0501068_0012067
834 Ga0501069_0054532
835 Ga0501071_0002637
836 Ga0501071_0011103
837 Ga0501072_0022731
838 Ga0501074_0013222
839 Ga0501074_0029295
840 Ga0501075_0030898
841 Ga0501075_0047023
842 Ga0501076_0002533
843 Ga0501076_0024282
844 Ga0501077_0002613
845 Ga0501077_0020436
846 Ga0501079_0003011
847 Ga0501079_0037053
848 Ga0501080_0006559
849 Ga0501080_0055563
850 Ga0501081_0008667
851 Ga0501083_0006107
852 Ga0501083_0017440
853 Ga0501044_0157716
854 Ga0501045_0004481
855 Ga0501045_0013202
856 Ga0501045_0094963
857 nmdc:mga05p37_134912_c1
858 nmdc:mga05p37_200162_c1
859 nmdc:mga05p37_223309_c1
860 nmdc:mga05p37_4582_c1
861 nmdc:mga09592_298439_c1
862 nmdc:mga09592_48952_c1
863 nmdc:mga0qj67_2994_c1
864 nmdc:mga0qj67_4158_c1
865 nmdc:mga06r32_195905_c1
866 nmdc:mga06r32_30480_c1
867 nmdc:mga08y16_126060_c1
868 nmdc:mga08y16_138664_c1
869 nmdc:mga08y16_17248_c1
870 nmdc:mga08y16_60836_c1
871 nmdc:mga08y16_7663_c1
872 nmdc:mga0n895_14265_c1
873 nmdc:mga0n895_156849_c1
874 nmdc:mga0n895_387574_c1
875 nmdc:mga0rr50_59331_c1
876 nmdc:mga0a205_24400_c1
877 nmdc:mga0a205_398206_c1
878 nmdc:mga0a205_51265_c1
879 Ga0495601_0117903
880 Ga0495601_0177239
881 Ga0495619_0005547
882 Ga0501084_0064556
883 Ga0501084_0099502
884 Ga0501084_0413579
885 Ga0501082_0006790
886 Ga0530510_0003120

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

8

119

0.96

PF00211

Guanylate_cyc

Adenylate and Guanylate cyclase catalytic domain

183

368

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3t6k-assembly2.cif.gz_B crystal structure of a putative response regulator (caur_3799) from chloroflexus aurantiacus j-10-fl at 1.86 a resolution 0.9606 5 121
6rh1-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7 0.9594 4 120
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9568 6 121
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9563 6 121
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9489 4 124
ID Description Score Start End Superfamily
af_I1NCE1_621_722_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9662 5 72 3.40.50.2300
af_P30855_946_1081_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9459 5 119 3.40.50.2300
4nicD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9458 6 121 3.40.50.2300
1nxoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9451 6 121 3.40.50.2300
3gt7A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9429 4 121 3.40.50.2300
ID Description Score Start End GO Terms
AF-L9PJN4-F1-model_v4 deleted 0.9783 5 136
AF-A0A358QP21-F1-model_v4 Hybrid sensor histidine kinase/response regulator 0.9757 9 122 GO:0000160
GO:0016301
AF-A0A7C4UQ69-F1-model_v4 Response regulator 0.975 4 118 GO:0000160
AF-A0A7C3H2C9-F1-model_v4 Response regulator 0.9707 4 121 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A0F9CXP9-F1-model_v4 Response regulatory domain-containing protein 0.9704 4 127 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0010181
GO:0032993

Map