F445099

General Info

Members Datasets Scaffolds Average Seq Length
443 233 886 292

Family's Representative Sequence

Representative Sequence 3300025935|Ga0207709_10037611|Ga0207709_100376113
Length 327
Sequence VPGQLTRQAIAAQPEWLAQVPERVGDRRLPDGARVLFTGCGTSFHAARACGNAAQALEIVLGRAHEADVLVAISHEGGTRLTHEAISGFAGETWLVTGAADSAIAKSVDHVVVATPAIEESYCHTVSYTCAIAAGRALQGEDVSRLPAEVFRELDREPFGVSEHGRFVVAGAGRDTATALEAVLKLREGAHVAAEAHHTEQLLHGHLAAIDSSVRCFVLEGGGRAAERAVDAMRALGELGCDALLVPTTHPVVDIVRFQLLTCDLADAGGIDPDMIRWDEEPWDRARQAQDWTSGETDSELDRAQSASKVSLRFQTSPRPESGLDGA

Samples

Sample ID Description Type Environment
1 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
114 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
115 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
120 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
121 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
130 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
131 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
132 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
133 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
136 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
137 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
138 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
164 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
167 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
228 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
233 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.32
Rhizosphere 93.68
Stem 0
Stem Tuber 0
Unclassified 8.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207709_10037611 3300025935 Unclassified 2877
2 JGI25407J50210_10001363 3300003373 Bacteria 5527
3 Ga0070658_10194577 3300005327 Bacteria 1710
4 Ga0070676_10220942 3300005328 Unclassified 1251
5 Ga0070676_10374053 3300005328 Bacteria 985
6 Ga0070683_100188760 3300005329 Bacteria 1957
7 Ga0070690_100138266 3300005330 Bacteria 1651
8 Ga0070670_100016363 3300005331 Bacteria 6369
9 Ga0070670_100034408 3300005331 Bacteria 4359
10 Ga0070680_100127779 3300005336 Bacteria 2124
11 Ga0068868_100085882 3300005338 Bacteria 2529
12 Ga0068868_100280198 3300005338 Bacteria 1411
13 Ga0070660_100443461 3300005339 Bacteria 1076
14 Ga0070689_100055732 3300005340 Bacteria 3064
15 Ga0070661_100043315 3300005344 Bacteria 3288
16 Ga0070668_100013366 3300005347 Bacteria 6127
17 Ga0070675_100008900 3300005354 Bacteria 7804
18 Ga0070675_100190294 3300005354 Unclassified 1778
19 Ga0070671_100112420 3300005355 Bacteria 2288
20 Ga0070674_100009669 3300005356 Bacteria 5786
21 Ga0070674_100226023 3300005356 Bacteria 1458
22 Ga0070688_100003343 3300005365 Bacteria 8221
23 Ga0070659_100044532 3300005366 Bacteria 3475
24 Ga0070659_100233333 3300005366 Bacteria 1521
25 Ga0070709_10005545 3300005434 Bacteria 6830
26 Ga0070709_10321278 3300005434 Unclassified 1136
27 Ga0070714_100009560 3300005435 Bacteria 7630
28 Ga0070714_100031708 3300005435 Bacteria 4411
29 Ga0070713_100003557 3300005436 Bacteria 10294
30 Ga0070713_100468874 3300005436 Bacteria 1185
31 Ga0070710_10005327 3300005437 Bacteria 6101
32 Ga0070710_10014156 3300005437 Bacteria 4008
33 Ga0070711_100489928 3300005439 Unclassified 1012
34 Ga0070705_100056468 3300005440 Bacteria 2312
35 Ga0070708_100491745 3300005445 Bacteria 1157
36 Ga0070678_100015946 3300005456 Bacteria 4789
37 Ga0070678_100069335 3300005456 Unclassified 2633
38 Ga0070662_100263997 3300005457 Unclassified 1388
39 Ga0070681_10047131 3300005458 Bacteria 4308
40 Ga0070681_10367190 3300005458 Bacteria 1349
41 Ga0068867_100045549 3300005459 Unclassified 3218
42 Ga0070685_10003556 3300005466 Bacteria 7909
43 Ga0070707_100001067 3300005468 Bacteria 27041
44 Ga0070707_100223253 3300005468 Bacteria 1835
45 Ga0070699_100133868 3300005518 Unclassified 2186
46 Ga0070679_100243264 3300005530 Bacteria 1756
47 Ga0070684_100031992 3300005535 Bacteria 4481
48 Ga0070684_100060233 3300005535 Bacteria 3320
49 Ga0070672_100181187 3300005543 Bacteria 1756
50 Ga0070693_100126871 3300005547 Bacteria 1590
51 Ga0070665_100023409 3300005548 Bacteria 6218
52 Ga0070704_100027393 3300005549 Bacteria 3780
53 Ga0070664_100294299 3300005564 Bacteria 1466
54 Ga0068857_100042118 3300005577 Bacteria 4050
55 Ga0068854_100071894 3300005578 Bacteria 2532
56 Ga0068856_100148569 3300005614 Bacteria 2351
57 Ga0070702_100032855 3300005615 Bacteria 2850
58 Ga0070702_100068758 3300005615 Bacteria 2085
59 Ga0068852_100038725 3300005616 Bacteria 4008
60 Ga0068866_10107226 3300005718 Bacteria 1552
61 Ga0068870_10006075 3300005840 Bacteria 5305
62 Ga0068870_10118680 3300005840 Bacteria 1521
63 Ga0068858_100307599 3300005842 Bacteria 1513
64 Ga0068862_100453853 3300005844 Bacteria 1209
65 Ga0081455_10025593 3300005937 Bacteria 5444
66 Ga0081455_10035367 3300005937 Bacteria 4466
67 Ga0081538_10000846 3300005981 Bacteria 33031
68 Ga0081538_10001503 3300005981 Bacteria 23933
69 Ga0081538_10002830 3300005981 Bacteria 16602
70 Ga0081538_10006517 3300005981 Bacteria 10261
71 Ga0081538_10010472 3300005981 Bacteria 7604
72 Ga0081538_10013832 3300005981 Bacteria 6366
73 Ga0081538_10046096 3300005981 Bacteria 2694
74 Ga0081539_10001603 3300005985 Bacteria 37270
75 Ga0070717_10003830 3300006028 Bacteria 10824
76 Ga0070717_10005289 3300006028 Bacteria 9411
77 Ga0070717_10007559 3300006028 Bacteria 8075
78 Ga0070717_10030270 3300006028 Bacteria 4348
79 Ga0070715_10001244 3300006163 Bacteria 7307
80 Ga0070716_100005283 3300006173 Bacteria 6244
81 Ga0070716_100243095 3300006173 Unclassified 1222
82 Ga0070712_100063671 3300006175 Bacteria 2612
83 Ga0075428_100056844 3300006844 Bacteria 4284
84 Ga0075430_100000493 3300006846 Bacteria 29659
85 Ga0075431_100020311 3300006847 Bacteria 6784
86 Ga0105240_10032312 3300009093 Bacteria 6778
87 Ga0105245_10035074 3300009098 Bacteria 4451
88 Ga0105245_10086552 3300009098 Bacteria 2874
89 Ga0114129_10058599 3300009147 Bacteria 5386
90 Ga0114129_10324079 3300009147 Unclassified 2047
91 Ga0114129_10760746 3300009147 Unclassified 1239
92 Ga0105243_10029441 3300009148 Bacteria 4222
93 Ga0105243_10045063 3300009148 Bacteria 3464
94 Ga0105243_10111270 3300009148 Bacteria 2292
95 Ga0105243_10356163 3300009148 Unclassified 1345
96 Ga0105242_10009936 3300009176 Bacteria 7288
97 Ga0105242_10106097 3300009176 Bacteria 2387
98 Ga0105237_10092363 3300009545 Bacteria 3016
99 Ga0105237_10396082 3300009545 Unclassified 1386
100 Ga0105237_10561905 3300009545 Unclassified 1148
101 Ga0105238_10100802 3300009551 Bacteria 2870
102 Ga0105249_10307027 3300009553 Bacteria 1593
103 Ga0105246_10016395 3300011119 Bacteria 4692
104 Ga0157369_10069975 3300013105 Bacteria 3769
105 Ga0157369_10107319 3300013105 Bacteria 2971
106 Ga0157374_10073674 3300013296 Bacteria 3223
107 Ga0157375_10010432 3300013308 Bacteria 8178
108 Ga0163163_10029081 3300014325 Bacteria 5314
109 Ga0157377_10019791 3300014745 Bacteria 3519
110 Ga0157376_10306380 3300014969 Bacteria 1505
111 Ga0163161_10558807 3300017792 Bacteria 939
112 Ga0206353_12011138 3300020082 Bacteria 2191
113 Ga0207692_10003468 3300025898 Bacteria 6165
114 Ga0207692_10009959 3300025898 Bacteria 3987
115 Ga0207642_10018151 3300025899 Bacteria 2694
116 Ga0207688_10002164 3300025901 Bacteria 10568
117 Ga0207685_10069468 3300025905 Bacteria 1423
118 Ga0207699_10005220 3300025906 Bacteria 6213
119 Ga0207699_10326886 3300025906 Unclassified 1077
120 Ga0207645_10051625 3300025907 Bacteria 2627
121 Ga0207643_10010327 3300025908 Bacteria 5026
122 Ga0207643_10048919 3300025908 Bacteria 2396
123 Ga0207695_10046394 3300025913 Bacteria 4606
124 Ga0207693_10000586 3300025915 Bacteria 32620
125 Ga0207693_10001266 3300025915 Bacteria 22523
126 Ga0207663_10002844 3300025916 Bacteria 8363
127 Ga0207663_10157531 3300025916 Bacteria 1599
128 Ga0207657_10025356 3300025919 Bacteria 5468
129 Ga0207657_10128537 3300025919 Bacteria 2079
130 Ga0207652_10180830 3300025921 Bacteria 1895
131 Ga0207646_10008654 3300025922 Bacteria 10165
132 Ga0207650_10018619 3300025925 Bacteria 4875
133 Ga0207650_10034959 3300025925 Bacteria 3646
134 Ga0207659_10095833 3300025926 Bacteria 2226
135 Ga0207659_10380863 3300025926 Bacteria 1176
136 Ga0207700_10014591 3300025928 Bacteria 5153
137 Ga0207700_10022763 3300025928 Bacteria 4304
138 Ga0207700_10293039 3300025928 Bacteria 1403
139 Ga0207664_10003398 3300025929 Bacteria 10600
140 Ga0207664_10014224 3300025929 Bacteria 5739
141 Ga0207664_10015732 3300025929 Bacteria 5501
142 Ga0207664_10030052 3300025929 Bacteria 4146
143 Ga0207664_10129143 3300025929 Bacteria 2125
144 Ga0207644_10066186 3300025931 Bacteria 2630
145 Ga0207644_10148808 3300025931 Bacteria 1810
146 Ga0207690_10251763 3300025932 Bacteria 1365
147 Ga0207706_10231378 3300025933 Bacteria 1617
148 Ga0207686_10240390 3300025934 Unclassified 1318
149 Ga0207709_10037256 3300025935 Bacteria 2889
150 Ga0207669_10038598 3300025937 Bacteria 2751
151 Ga0207665_10000793 3300025939 Bacteria 21330
152 Ga0207665_10328309 3300025939 Unclassified 1150
153 Ga0207689_10218048 3300025942 Bacteria 1576
154 Ga0207661_10027448 3300025944 Bacteria 4349
155 Ga0207651_10388390 3300025960 Bacteria 1185
156 Ga0207668_10046142 3300025972 Bacteria 2976
157 Ga0207640_10130195 3300025981 Bacteria 1818
158 Ga0207677_10076287 3300026023 Bacteria 2386
159 Ga0207648_10034674 3300026089 Bacteria 4448
160 Ga0207674_10292344 3300026116 Bacteria 1578
161 Ga0207675_100049472 3300026118 Bacteria 3923
162 Ga0207675_100253411 3300026118 Bacteria 1704
163 Ga0207683_10010532 3300026121 Bacteria 7890
164 Ga0207683_10020522 3300026121 Bacteria 5652
165 Ga0207683_10136808 3300026121 Bacteria 2205
166 Ga0207428_10039569 3300027907 Bacteria 3829
167 Ga0268265_10182106 3300028380 Bacteria 1806
168 Ga0265318_10059499 3300028577 Unclassified 1425
169 Ga0265338_10000938 3300028800 Bacteria 49159
170 Ga0265338_10014772 3300028800 Bacteria 8645
171 Ga0265338_10100801 3300028800 Unclassified 2353
172 Ga0265325_10067206 3300031241 Bacteria 1806
173 Ga0265340_10139163 3300031247 Unclassified 1111
174 Ga0265339_10015589 3300031249 Bacteria 4552
175 Ga0265327_10044963 3300031251 Bacteria 2350
176 Ga0265314_10068174 3300031711 Bacteria 2392
177 Ga0307416_100732262 3300032002 Bacteria 1080
178 Ga0373926_0009010 3300035083 Bacteria 3328
179 Ga0373934_0075746 3300035086 Bacteria 1349
180 Ga0373956_0016102 3300035119 Bacteria 3136
181 Ga0373931_0003615 3300035691 Bacteria 6985
182 Ga0373937_0012833 3300036401 Bacteria 7378
183 Ga0395899_0032529 3300037312 Bacteria 3918
184 Ga0395900_0005451 3300037418 Bacteria 13328
185 Ga0395900_0086125 3300037418 Bacteria 3229
186 Ga0395898_0065951 3300037466 Bacteria 3509
187 Ga0395905_0039706 3300037471 Bacteria 4416
188 Ga0395901_0044412 3300038443 Bacteria 4609
189 Ga0395901_0435443 3300038443 Bacteria 1343
190 Ga0436360_0848909 3300039438 Bacteria 5228
191 Ga0450920_011686 3300042122 Unclassified 1639
192 Ga0439435_0020266 3300042436 Bacteria 1714
193 Ga0450918_009660 3300042531 Bacteria 1689
194 Ga0466972_0055333 3300044658 Bacteria 1908
195 Ga0466961_0009423 3300044693 Bacteria 6216
196 Ga0466963_0000248 3300044694 Bacteria 23565
197 Ga0466963_0000707 3300044694 Bacteria 16303
198 Ga0466963_0000854 3300044694 Bacteria 15384
199 Ga0466963_0001302 3300044694 Bacteria 13256
200 Ga0466963_0009044 3300044694 Bacteria 5985
201 Ga0466963_0045240 3300044694 Bacteria 2899
202 Ga0466963_0088661 3300044694 Bacteria 2104
203 Ga0466963_0095045 3300044694 Bacteria 2034
204 Ga0466963_0222489 3300044694 Bacteria 1322
205 Ga0466964_0000511 3300044706 Bacteria 12093
206 Ga0466971_0112497 3300044719 Bacteria 1257
207 Ga0466971_0242147 3300044719 Bacteria 858
208 Ga0466968_0011330 3300044735 Bacteria 3471
209 Ga0466968_0043312 3300044735 Bacteria 1905
210 Ga0466957_0007646 3300044842 Bacteria 6112
211 Ga0466957_0012064 3300044842 Bacteria 4996
212 Ga0466957_0039650 3300044842 Bacteria 2842
213 Ga0466957_0055460 3300044842 Unclassified 2422
214 Ga0466960_0009169 3300044901 Bacteria 4071
215 Ga0466959_0110489 3300045049 Bacteria 1962
216 Ga0466958_0004956 3300045836 Bacteria 7106
217 Ga0466958_0010017 3300045836 Bacteria 5295
218 Ga0466958_0022359 3300045836 Unclassified 3703
219 Ga0466958_0157727 3300045836 Bacteria 1432
220 Ga0466958_0199228 3300045836 Bacteria 1274
221 Ga0466967_0000219 3300045976 Bacteria 24460
222 Ga0466967_0001803 3300045976 Bacteria 12843
223 Ga0466967_0010387 3300045976 Bacteria 6982
224 Ga0466967_0018537 3300045976 Bacteria 5567
225 Ga0466967_0019478 3300045976 Bacteria 5456
226 Ga0466967_0022055 3300045976 Bacteria 5187
227 Ga0466967_0040194 3300045976 Bacteria 4026
228 Ga0466967_0040825 3300045976 Bacteria 3996
229 Ga0466967_0058872 3300045976 Bacteria 3397
230 Ga0466967_0076323 3300045976 Bacteria 3014
231 Ga0466967_0082178 3300045976 Bacteria 2911
232 Ga0495592_0001003 3300046454 Bacteria 19611
233 Ga0495641_0021545 3300046461 Bacteria 3242
234 Ga0495651_0000038 3300046462 Bacteria 97248
235 Ga0495653_0005636 3300046463 Bacteria 10222
236 Ga0495653_0061363 3300046463 Bacteria 2845
237 Ga0495653_0063475 3300046463 Bacteria 2787
238 Ga0495582_0107118 3300046473 Bacteria 1568
239 Ga0495605_0042235 3300046474 Bacteria 2268
240 Ga0495618_0003127 3300046514 Bacteria 10414
241 Ga0495618_0185500 3300046514 Bacteria 1321
242 Ga0495628_0000025 3300046516 Bacteria 127935
243 Ga0495628_0013474 3300046516 Bacteria 6878
244 Ga0495628_0019379 3300046516 Bacteria 5625
245 Ga0495628_0187647 3300046516 Bacteria 1562
246 Ga0495630_0029963 3300046517 Bacteria 4046
247 Ga0495630_0382744 3300046517 Bacteria 1078
248 Ga0495652_0000088 3300046529 Bacteria 98865
249 Ga0495652_0046656 3300046529 Bacteria 3718
250 Ga0495640_0191383 3300046533 Bacteria 1300
251 Ga0495587_0002061 3300046536 Bacteria 13422
252 Ga0495587_0142305 3300046536 Bacteria 1368
253 Ga0495645_0000024 3300046543 Bacteria 125065
254 Ga0495645_0096000 3300046543 Unclassified 2112
255 Ga0495656_0000856 3300046615 Bacteria 9830
256 Ga0495634_0043809 3300046642 Bacteria 3032
257 Ga0495634_0073248 3300046642 Bacteria 2252
258 Ga0495611_0024372 3300046648 Bacteria 2632
259 Ga0495635_0043077 3300046663 Bacteria 3115
260 Ga0495635_0143972 3300046663 Bacteria 1623
261 Ga0495657_0070075 3300046675 Bacteria 2292
262 Ga0495657_0078342 3300046675 Bacteria 2142
263 Ga0495599_0000019 3300046678 Bacteria 141108
264 Ga0495599_0044507 3300046678 Bacteria 2784
265 Ga0495599_0049336 3300046678 Bacteria 2638
266 Ga0495623_0000032 3300046679 Bacteria 84435
267 Ga0495623_0105543 3300046679 Unclassified 1712
268 Ga0495646_0022754 3300046680 Bacteria 3950
269 Ga0495646_0035240 3300046680 Bacteria 3105
270 Ga0495646_0040774 3300046680 Bacteria 2857
271 Ga0495658_0173755 3300046683 Bacteria 1334
272 Ga0495613_0026820 3300046689 Bacteria 4290
273 Ga0495613_0181202 3300046689 Bacteria 1492
274 Ga0495600_0303510 3300046809 Unclassified 1007
275 Ga0495604_0000476 3300047317 Bacteria 35284
276 Ga0495604_0077932 3300047317 Bacteria 2489
277 Ga0495674_0121730 3300047319 Bacteria 2204
278 Ga0495676_0282398 3300047321 Bacteria 1124
279 Ga0495676_0308208 3300047321 Bacteria 1066
280 Ga0495680_0005578 3300047322 Bacteria 11799
281 Ga0495680_0045300 3300047322 Bacteria 3473
282 Ga0495675_0000007 3300047444 Bacteria 162640
283 Ga0495675_0162022 3300047444 Bacteria 1377
284 Ga0495684_0003458 3300047471 Bacteria 12364
285 Ga0495684_0009430 3300047471 Bacteria 7536
286 Ga0495684_0052078 3300047471 Bacteria 3123
287 Ga0495684_0176209 3300047471 Bacteria 1587
288 Ga0495602_0000246 3300048088 Bacteria 50728
289 Ga0495602_0114330 3300048088 Bacteria 2185
290 Ga0496101_0012192 3300048904 Bacteria 5730
291 Ga0496101_0027281 3300048904 Bacteria 3977
292 Ga0496101_0237800 3300048904 Bacteria 1417
293 Ga0496102_0323360 3300048905 Bacteria 1453
294 Ga0496104_0025600 3300048907 Bacteria 5440
295 Ga0496104_0051731 3300048907 Bacteria 3877
296 Ga0496104_0090766 3300048907 Bacteria 2919
297 Ga0496105_0007954 3300048908 Bacteria 8242
298 Ga0496105_0110364 3300048908 Bacteria 2270
299 Ga0496105_0163853 3300048908 Bacteria 1824
300 Ga0496107_0004339 3300048910 Bacteria 9599
301 Ga0496107_0043861 3300048910 Bacteria 3214
302 Ga0496107_0110531 3300048910 Bacteria 2020
303 Ga0496108_0027739 3300048911 Bacteria 4680
304 Ga0496108_0071141 3300048911 Bacteria 2935
305 Ga0496109_0013302 3300048912 Bacteria 7129
306 Ga0496109_0104211 3300048912 Bacteria 2633
307 Ga0496110_0007235 3300048913 Bacteria 8844
308 Ga0496110_0059101 3300048913 Bacteria 3378
309 Ga0496110_0136074 3300048913 Bacteria 2220
310 Ga0496110_0187731 3300048913 Bacteria 1877
311 Ga0496111_0001632 3300048914 Bacteria 13000
312 Ga0496113_0003441 3300048916 Bacteria 9473
313 Ga0496113_0227111 3300048916 Bacteria 1488
314 Ga0496114_0008189 3300048917 Bacteria 8288
315 Ga0496114_0016651 3300048917 Bacteria 5928
316 Ga0496115_0005172 3300048918 Bacteria 9488
317 Ga0496115_0013772 3300048918 Bacteria 6122
318 Ga0501031_0001127 3300049568 Bacteria 16242
319 Ga0501031_0015305 3300049568 Bacteria 4982
320 Ga0501031_0254093 3300049568 Bacteria 1142
321 Ga0501032_0019774 3300049569 Bacteria 4703
322 Ga0501033_0011880 3300049570 Bacteria 6654
323 Ga0501033_0013225 3300049570 Bacteria 6288
324 Ga0501033_0344860 3300049570 Archaea 1044
325 Ga0501034_0126116 3300049571 Bacteria 2545
326 Ga0501036_0001838 3300049572 Bacteria 16457
327 Ga0501036_0050584 3300049572 Bacteria 3518
328 Ga0501036_0356442 3300049572 Bacteria 1221
329 Ga0501037_0015236 3300049573 Bacteria 5656
330 Ga0501037_0049452 3300049573 Bacteria 3078
331 Ga0501038_0002057 3300049574 Bacteria 18626
332 Ga0501038_0021508 3300049574 Bacteria 5789
333 Ga0501039_0020243 3300049575 Bacteria 5100
334 Ga0501040_0001649 3300049576 Bacteria 14253
335 Ga0501040_0123677 3300049576 Bacteria 1816
336 Ga0501041_0029106 3300049577 Bacteria 3332
337 Ga0501041_0165246 3300049577 Bacteria 1384
338 Ga0501041_0195258 3300049577 Bacteria 1268
339 Ga0501042_0005679 3300049578 Bacteria 8050
340 Ga0501042_0359873 3300049578 Unclassified 1053
341 Ga0501043_0003912 3300049579 Bacteria 12213
342 Ga0501046_0027741 3300049580 Bacteria 4617
343 Ga0501046_0034598 3300049580 Bacteria 4075
344 Ga0501048_0005235 3300049582 Bacteria 9883
345 Ga0501048_0008997 3300049582 Bacteria 7517
346 Ga0501048_0126318 3300049582 Bacteria 1808
347 Ga0501048_0131383 3300049582 Bacteria 1770
348 Ga0501048_0231065 3300049582 Bacteria 1312
349 Ga0501067_0015311 3300049583 Bacteria 4244
350 Ga0501067_0017098 3300049583 Bacteria 4007
351 Ga0501067_0044198 3300049583 Unclassified 2475
352 Ga0501067_0243669 3300049583 Bacteria 1000
353 Ga0501068_0002158 3300049584 Bacteria 10478
354 Ga0501068_0006240 3300049584 Bacteria 6556
355 Ga0501068_0015137 3300049584 Bacteria 4425
356 Ga0501068_0037735 3300049584 Bacteria 2892
357 Ga0501068_0126120 3300049584 Bacteria 1599
358 Ga0501069_0006528 3300049585 Bacteria 6098
359 Ga0501069_0087882 3300049585 Bacteria 1756
360 Ga0501069_0281176 3300049585 Bacteria 974
361 Ga0501070_0028776 3300049586 Bacteria 4658
362 Ga0501071_0005276 3300049587 Bacteria 8288
363 Ga0501071_0011697 3300049587 Bacteria 5922
364 Ga0501071_0069018 3300049587 Bacteria 2573
365 Ga0501071_0082274 3300049587 Bacteria 2357
366 Ga0501072_0003896 3300049588 Bacteria 11283
367 Ga0501072_0018435 3300049588 Bacteria 5375
368 Ga0501072_0070788 3300049588 Bacteria 2755
369 Ga0501072_0133200 3300049588 Bacteria 1982
370 Ga0501072_0367530 3300049588 Bacteria 1142
371 Ga0501073_0009885 3300049589 Bacteria 7021
372 Ga0501074_0001951 3300049590 Bacteria 14189
373 Ga0501074_0006644 3300049590 Bacteria 8359
374 Ga0501074_0016727 3300049590 Bacteria 5323
375 Ga0501074_0387049 3300049590 Bacteria 992
376 Ga0501075_0001985 3300049591 Bacteria 13507
377 Ga0501075_0081766 3300049591 Bacteria 2446
378 Ga0501075_0232024 3300049591 Bacteria 1407
379 Ga0501075_0289732 3300049591 Bacteria 1247
380 Ga0501075_0338523 3300049591 Bacteria 1146
381 Ga0501076_0001010 3300049592 Bacteria 18477
382 Ga0501076_0056899 3300049592 Bacteria 3104
383 Ga0501076_0085601 3300049592 Bacteria 2533
384 Ga0501076_0104252 3300049592 Bacteria 2288
385 Ga0501076_0340706 3300049592 Unclassified 1230
386 Ga0501077_0001259 3300049593 Bacteria 15274
387 Ga0501077_0011207 3300049593 Bacteria 5594
388 Ga0501079_0001526 3300049741 Bacteria 16382
389 Ga0501079_0157585 3300049741 Bacteria 1770
390 Ga0501079_0235292 3300049741 Bacteria 1431
391 Ga0501080_0011432 3300049742 Bacteria 8129
392 Ga0501080_0023905 3300049742 Bacteria 5663
393 Ga0501080_0303750 3300049742 Bacteria 1447
394 Ga0501081_0053976 3300049743 Bacteria 2776
395 Ga0501081_0055511 3300049743 Bacteria 2737
396 Ga0501081_0229518 3300049743 Bacteria 1351
397 Ga0501081_0237252 3300049743 Bacteria 1329
398 Ga0501083_0004755 3300049744 Bacteria 9591
399 Ga0501083_0075123 3300049744 Unclassified 2245
400 Ga0501035_0008364 3300049822 Bacteria 9632
401 Ga0501035_0286517 3300049822 Bacteria 1391
402 Ga0501044_0035786 3300049823 Bacteria 5197
403 Ga0501045_0001577 3300049824 Bacteria 15194
404 Ga0501045_0055973 3300049824 Bacteria 2884
405 Ga0501045_0058010 3300049824 Bacteria 2834
406 Ga0501045_0185128 3300049824 Bacteria 1551
407 nmdc:mga05p37_112634_c1 3300050507 Bacteria 3346
408 nmdc:mga05p37_72909_c1 3300050507 Bacteria 4226
409 nmdc:mga0qj67_6269_c1 3300050509 Bacteria 8723
410 nmdc:mga06r32_322389_c1 3300050510 Bacteria 1530
411 nmdc:mga06r32_53434_c1 3300050510 Bacteria 3870
412 nmdc:mga08y16_19405_c1 3300050511 Bacteria 7168
413 nmdc:mga08y16_269154_c1 3300050511 Bacteria 1759
414 nmdc:mga08y16_42710_c1 3300050511 Bacteria 4748
415 nmdc:mga08y16_788300_c1 3300050511 Unclassified 944
416 nmdc:mga0n895_230980_c1 3300050512 Unclassified 1878
417 nmdc:mga0n895_483199_c1 3300050512 Archaea 1249
418 nmdc:mga0rr50_184984_c1 3300050513 Unclassified 1705
419 nmdc:mga08x19_219567_c1 3300050514 Unclassified 1306
420 Ga0495601_0000313 3300053077 Bacteria 25734
421 Ga0495612_0067247 3300053078 Bacteria 1490
422 Ga0495612_0082036 3300053078 Unclassified 1356
423 Ga0495595_0033684 3300053084 Bacteria 2313
424 Ga0495619_0003795 3300053085 Bacteria 9716
425 Ga0495619_0006876 3300053085 Bacteria 7192
426 Ga0501084_0011951 3300054114 Bacteria 7188
427 Ga0501084_0049872 3300054114 Bacteria 3504
428 Ga0501084_0050877 3300054114 Bacteria 3467
429 Ga0501084_0100334 3300054114 Bacteria 2431
430 Ga0501084_0333211 3300054114 Bacteria 1282
431 Ga0501084_0364829 3300054114 Bacteria 1220
432 Ga0501082_0010167 3300060353 Bacteria 8103
433 Ga0501082_0026653 3300060353 Bacteria 4982
434 Ga0501082_0396676 3300060353 Bacteria 1204
435 Ga0466962_0040599 3300061719 Bacteria 2227
436 Ga0530510_0016111 3300061734 Bacteria 5285
437 Ga0530510_0049899 3300061734 Bacteria 3023
438 Ga0530510_0050783 3300061734 Bacteria 2996
439 Ga0530510_0078588 3300061734 Bacteria 2399
440 Ga0530510_0085526 3300061734 Bacteria 2297
441 Ga0530510_0137126 3300061734 Bacteria 1802
442 Ga0530510_0172573 3300061734 Bacteria 1602
443 Ga0530510_0218305 3300061734 Bacteria 1417
444 Ga0207709_10037611
445 JGI25407J50210_10001363
446 Ga0070658_10194577
447 Ga0070676_10220942
448 Ga0070676_10374053
449 Ga0070683_100188760
450 Ga0070690_100138266
451 Ga0070670_100016363
452 Ga0070670_100034408
453 Ga0070680_100127779
454 Ga0068868_100085882
455 Ga0068868_100280198
456 Ga0070660_100443461
457 Ga0070689_100055732
458 Ga0070661_100043315
459 Ga0070668_100013366
460 Ga0070675_100008900
461 Ga0070675_100190294
462 Ga0070671_100112420
463 Ga0070674_100009669
464 Ga0070674_100226023
465 Ga0070688_100003343
466 Ga0070659_100044532
467 Ga0070659_100233333
468 Ga0070709_10005545
469 Ga0070709_10321278
470 Ga0070714_100009560
471 Ga0070714_100031708
472 Ga0070713_100003557
473 Ga0070713_100468874
474 Ga0070710_10005327
475 Ga0070710_10014156
476 Ga0070711_100489928
477 Ga0070705_100056468
478 Ga0070708_100491745
479 Ga0070678_100015946
480 Ga0070678_100069335
481 Ga0070662_100263997
482 Ga0070681_10047131
483 Ga0070681_10367190
484 Ga0068867_100045549
485 Ga0070685_10003556
486 Ga0070707_100001067
487 Ga0070707_100223253
488 Ga0070699_100133868
489 Ga0070679_100243264
490 Ga0070684_100031992
491 Ga0070684_100060233
492 Ga0070672_100181187
493 Ga0070693_100126871
494 Ga0070665_100023409
495 Ga0070704_100027393
496 Ga0070664_100294299
497 Ga0068857_100042118
498 Ga0068854_100071894
499 Ga0068856_100148569
500 Ga0070702_100032855
501 Ga0070702_100068758
502 Ga0068852_100038725
503 Ga0068866_10107226
504 Ga0068870_10006075
505 Ga0068870_10118680
506 Ga0068858_100307599
507 Ga0068862_100453853
508 Ga0081455_10025593
509 Ga0081455_10035367
510 Ga0081538_10000846
511 Ga0081538_10001503
512 Ga0081538_10002830
513 Ga0081538_10006517
514 Ga0081538_10010472
515 Ga0081538_10013832
516 Ga0081538_10046096
517 Ga0081539_10001603
518 Ga0070717_10003830
519 Ga0070717_10005289
520 Ga0070717_10007559
521 Ga0070717_10030270
522 Ga0070715_10001244
523 Ga0070716_100005283
524 Ga0070716_100243095
525 Ga0070712_100063671
526 Ga0075428_100056844
527 Ga0075430_100000493
528 Ga0075431_100020311
529 Ga0105240_10032312
530 Ga0105245_10035074
531 Ga0105245_10086552
532 Ga0114129_10058599
533 Ga0114129_10324079
534 Ga0114129_10760746
535 Ga0105243_10029441
536 Ga0105243_10045063
537 Ga0105243_10111270
538 Ga0105243_10356163
539 Ga0105242_10009936
540 Ga0105242_10106097
541 Ga0105237_10092363
542 Ga0105237_10396082
543 Ga0105237_10561905
544 Ga0105238_10100802
545 Ga0105249_10307027
546 Ga0105246_10016395
547 Ga0157369_10069975
548 Ga0157369_10107319
549 Ga0157374_10073674
550 Ga0157375_10010432
551 Ga0163163_10029081
552 Ga0157377_10019791
553 Ga0157376_10306380
554 Ga0163161_10558807
555 Ga0206353_12011138
556 Ga0207692_10003468
557 Ga0207692_10009959
558 Ga0207642_10018151
559 Ga0207688_10002164
560 Ga0207685_10069468
561 Ga0207699_10005220
562 Ga0207699_10326886
563 Ga0207645_10051625
564 Ga0207643_10010327
565 Ga0207643_10048919
566 Ga0207695_10046394
567 Ga0207693_10000586
568 Ga0207693_10001266
569 Ga0207663_10002844
570 Ga0207663_10157531
571 Ga0207657_10025356
572 Ga0207657_10128537
573 Ga0207652_10180830
574 Ga0207646_10008654
575 Ga0207650_10018619
576 Ga0207650_10034959
577 Ga0207659_10095833
578 Ga0207659_10380863
579 Ga0207700_10014591
580 Ga0207700_10022763
581 Ga0207700_10293039
582 Ga0207664_10003398
583 Ga0207664_10014224
584 Ga0207664_10015732
585 Ga0207664_10030052
586 Ga0207664_10129143
587 Ga0207644_10066186
588 Ga0207644_10148808
589 Ga0207690_10251763
590 Ga0207706_10231378
591 Ga0207686_10240390
592 Ga0207709_10037256
593 Ga0207669_10038598
594 Ga0207665_10000793
595 Ga0207665_10328309
596 Ga0207689_10218048
597 Ga0207661_10027448
598 Ga0207651_10388390
599 Ga0207668_10046142
600 Ga0207640_10130195
601 Ga0207677_10076287
602 Ga0207648_10034674
603 Ga0207674_10292344
604 Ga0207675_100049472
605 Ga0207675_100253411
606 Ga0207683_10010532
607 Ga0207683_10020522
608 Ga0207683_10136808
609 Ga0207428_10039569
610 Ga0268265_10182106
611 Ga0265318_10059499
612 Ga0265338_10000938
613 Ga0265338_10014772
614 Ga0265338_10100801
615 Ga0265325_10067206
616 Ga0265340_10139163
617 Ga0265339_10015589
618 Ga0265327_10044963
619 Ga0265314_10068174
620 Ga0307416_100732262
621 Ga0373926_0009010
622 Ga0373934_0075746
623 Ga0373956_0016102
624 Ga0373931_0003615
625 Ga0373937_0012833
626 Ga0395899_0032529
627 Ga0395900_0005451
628 Ga0395900_0086125
629 Ga0395898_0065951
630 Ga0395905_0039706
631 Ga0395901_0044412
632 Ga0395901_0435443
633 Ga0436360_0848909
634 Ga0450920_011686
635 Ga0439435_0020266
636 Ga0450918_009660
637 Ga0466972_0055333
638 Ga0466961_0009423
639 Ga0466963_0000248
640 Ga0466963_0000707
641 Ga0466963_0000854
642 Ga0466963_0001302
643 Ga0466963_0009044
644 Ga0466963_0045240
645 Ga0466963_0088661
646 Ga0466963_0095045
647 Ga0466963_0222489
648 Ga0466964_0000511
649 Ga0466971_0112497
650 Ga0466971_0242147
651 Ga0466968_0011330
652 Ga0466968_0043312
653 Ga0466957_0007646
654 Ga0466957_0012064
655 Ga0466957_0039650
656 Ga0466957_0055460
657 Ga0466960_0009169
658 Ga0466959_0110489
659 Ga0466958_0004956
660 Ga0466958_0010017
661 Ga0466958_0022359
662 Ga0466958_0157727
663 Ga0466958_0199228
664 Ga0466967_0000219
665 Ga0466967_0001803
666 Ga0466967_0010387
667 Ga0466967_0018537
668 Ga0466967_0019478
669 Ga0466967_0022055
670 Ga0466967_0040194
671 Ga0466967_0040825
672 Ga0466967_0058872
673 Ga0466967_0076323
674 Ga0466967_0082178
675 Ga0495592_0001003
676 Ga0495641_0021545
677 Ga0495651_0000038
678 Ga0495653_0005636
679 Ga0495653_0061363
680 Ga0495653_0063475
681 Ga0495582_0107118
682 Ga0495605_0042235
683 Ga0495618_0003127
684 Ga0495618_0185500
685 Ga0495628_0000025
686 Ga0495628_0013474
687 Ga0495628_0019379
688 Ga0495628_0187647
689 Ga0495630_0029963
690 Ga0495630_0382744
691 Ga0495652_0000088
692 Ga0495652_0046656
693 Ga0495640_0191383
694 Ga0495587_0002061
695 Ga0495587_0142305
696 Ga0495645_0000024
697 Ga0495645_0096000
698 Ga0495656_0000856
699 Ga0495634_0043809
700 Ga0495634_0073248
701 Ga0495611_0024372
702 Ga0495635_0043077
703 Ga0495635_0143972
704 Ga0495657_0070075
705 Ga0495657_0078342
706 Ga0495599_0000019
707 Ga0495599_0044507
708 Ga0495599_0049336
709 Ga0495623_0000032
710 Ga0495623_0105543
711 Ga0495646_0022754
712 Ga0495646_0035240
713 Ga0495646_0040774
714 Ga0495658_0173755
715 Ga0495613_0026820
716 Ga0495613_0181202
717 Ga0495600_0303510
718 Ga0495604_0000476
719 Ga0495604_0077932
720 Ga0495674_0121730
721 Ga0495676_0282398
722 Ga0495676_0308208
723 Ga0495680_0005578
724 Ga0495680_0045300
725 Ga0495675_0000007
726 Ga0495675_0162022
727 Ga0495684_0003458
728 Ga0495684_0009430
729 Ga0495684_0052078
730 Ga0495684_0176209
731 Ga0495602_0000246
732 Ga0495602_0114330
733 Ga0496101_0012192
734 Ga0496101_0027281
735 Ga0496101_0237800
736 Ga0496102_0323360
737 Ga0496104_0025600
738 Ga0496104_0051731
739 Ga0496104_0090766
740 Ga0496105_0007954
741 Ga0496105_0110364
742 Ga0496105_0163853
743 Ga0496107_0004339
744 Ga0496107_0043861
745 Ga0496107_0110531
746 Ga0496108_0027739
747 Ga0496108_0071141
748 Ga0496109_0013302
749 Ga0496109_0104211
750 Ga0496110_0007235
751 Ga0496110_0059101
752 Ga0496110_0136074
753 Ga0496110_0187731
754 Ga0496111_0001632
755 Ga0496113_0003441
756 Ga0496113_0227111
757 Ga0496114_0008189
758 Ga0496114_0016651
759 Ga0496115_0005172
760 Ga0496115_0013772
761 Ga0501031_0001127
762 Ga0501031_0015305
763 Ga0501031_0254093
764 Ga0501032_0019774
765 Ga0501033_0011880
766 Ga0501033_0013225
767 Ga0501033_0344860
768 Ga0501034_0126116
769 Ga0501036_0001838
770 Ga0501036_0050584
771 Ga0501036_0356442
772 Ga0501037_0015236
773 Ga0501037_0049452
774 Ga0501038_0002057
775 Ga0501038_0021508
776 Ga0501039_0020243
777 Ga0501040_0001649
778 Ga0501040_0123677
779 Ga0501041_0029106
780 Ga0501041_0165246
781 Ga0501041_0195258
782 Ga0501042_0005679
783 Ga0501042_0359873
784 Ga0501043_0003912
785 Ga0501046_0027741
786 Ga0501046_0034598
787 Ga0501048_0005235
788 Ga0501048_0008997
789 Ga0501048_0126318
790 Ga0501048_0131383
791 Ga0501048_0231065
792 Ga0501067_0015311
793 Ga0501067_0017098
794 Ga0501067_0044198
795 Ga0501067_0243669
796 Ga0501068_0002158
797 Ga0501068_0006240
798 Ga0501068_0015137
799 Ga0501068_0037735
800 Ga0501068_0126120
801 Ga0501069_0006528
802 Ga0501069_0087882
803 Ga0501069_0281176
804 Ga0501070_0028776
805 Ga0501071_0005276
806 Ga0501071_0011697
807 Ga0501071_0069018
808 Ga0501071_0082274
809 Ga0501072_0003896
810 Ga0501072_0018435
811 Ga0501072_0070788
812 Ga0501072_0133200
813 Ga0501072_0367530
814 Ga0501073_0009885
815 Ga0501074_0001951
816 Ga0501074_0006644
817 Ga0501074_0016727
818 Ga0501074_0387049
819 Ga0501075_0001985
820 Ga0501075_0081766
821 Ga0501075_0232024
822 Ga0501075_0289732
823 Ga0501075_0338523
824 Ga0501076_0001010
825 Ga0501076_0056899
826 Ga0501076_0085601
827 Ga0501076_0104252
828 Ga0501076_0340706
829 Ga0501077_0001259
830 Ga0501077_0011207
831 Ga0501079_0001526
832 Ga0501079_0157585
833 Ga0501079_0235292
834 Ga0501080_0011432
835 Ga0501080_0023905
836 Ga0501080_0303750
837 Ga0501081_0053976
838 Ga0501081_0055511
839 Ga0501081_0229518
840 Ga0501081_0237252
841 Ga0501083_0004755
842 Ga0501083_0075123
843 Ga0501035_0008364
844 Ga0501035_0286517
845 Ga0501044_0035786
846 Ga0501045_0001577
847 Ga0501045_0055973
848 Ga0501045_0058010
849 Ga0501045_0185128
850 nmdc:mga05p37_112634_c1
851 nmdc:mga05p37_72909_c1
852 nmdc:mga0qj67_6269_c1
853 nmdc:mga06r32_322389_c1
854 nmdc:mga06r32_53434_c1
855 nmdc:mga08y16_19405_c1
856 nmdc:mga08y16_269154_c1
857 nmdc:mga08y16_42710_c1
858 nmdc:mga08y16_788300_c1
859 nmdc:mga0n895_230980_c1
860 nmdc:mga0n895_483199_c1
861 nmdc:mga0rr50_184984_c1
862 nmdc:mga08x19_219567_c1
863 Ga0495601_0000313
864 Ga0495612_0067247
865 Ga0495612_0082036
866 Ga0495595_0033684
867 Ga0495619_0003795
868 Ga0495619_0006876
869 Ga0501084_0011951
870 Ga0501084_0049872
871 Ga0501084_0050877
872 Ga0501084_0100334
873 Ga0501084_0333211
874 Ga0501084_0364829
875 Ga0501082_0010167
876 Ga0501082_0026653
877 Ga0501082_0396676
878 Ga0466962_0040599
879 Ga0530510_0016111
880 Ga0530510_0049899
881 Ga0530510_0050783
882 Ga0530510_0078588
883 Ga0530510_0085526
884 Ga0530510_0137126
885 Ga0530510_0172573
886 Ga0530510_0218305

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2j6h-assembly1.cif.gz_A e. coli glucosamine-6-p synthase in complex with glucose-6p and 5-oxo- l-norleucine 0.8722 5 264
4s1w-assembly1.cif.gz_A structure of a putative glutamine--fructose-6-phosphate aminotransferase from staphylococcus aureus subsp. aureus mu50 0.8722 1 258
2zj3-assembly1.cif.gz_A isomerase domain of human glucose:fructose-6-phosphate amidotransferase 0.8561 5 263
6r4h-assembly1.cif.gz_A crystal structure of human gfat-1 g451e 0.856 5 263
3ooj-assembly1.cif.gz_G c1a mutant of e. coli glms in complex with glucose-6p and glutamate 0.856 5 263
ID Description Score Start End Superfamily
2cb0B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8531 137 259 3.40.50.10490
af_Q0IQC2_3_134_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8217 30 133 3.40.50.10490
1moqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8092 5 147 3.40.50.10490
3i0zB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8089 141 269 3.40.50.10490
af_Q0IQC2_1_152_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8087 30 140 3.40.50.10490
ID Description Score Start End GO Terms
AF-A0A7W0JLX7-F1-model_v4 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] (EC 2.6.1.16) 0.9837 33 280 GO:0004360
GO:0006002
GO:0006047
GO:0006487
GO:0097367
AF-A0A538MFP3-F1-model_v4 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] (EC 2.6.1.16) 0.9808 1 280 GO:0004360
GO:0006002
GO:0006047
GO:0006487
GO:0097367
AF-A0A538MFP3-F1-model_v4 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] (EC 2.6.1.16) 0.9773 1 280 GO:0004360
GO:0006002
GO:0006047
GO:0006487
GO:0097367
AF-A0A538LG21-F1-model_v4 Uncharacterized protein 0.9721 178 279 GO:0097367
GO:1901135
AF-A0A7V9BG15-F1-model_v4 SIS domain-containing protein 0.9689 7 127 GO:0097367
GO:1901135

Map