F445076

General Info

Members Datasets Scaffolds Average Seq Length
443 245 886 205

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10072902|Ga0105238_100729022
Length 229
Sequence LTAAAAVPDKLVGWHPSHHRSIFMADLTLYHAAPSRSSIALWMLEEIGEPYDVKLIKLSAGDNMKPDYLAINPMGKVPALKHRDTVITEVAAICTYLADEFPAKKLNVPAGTPQRGVYLKWLFFGPSCVEPAVIDRAAPRKEEARRAMLGYGDFDTCMNVVAKAVDKGPWIMGEQFTAADVVIGSNIRFGTMFKLIPERPEFTAYAARIAARPAAQRAAAKDKELGAAA

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
143 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
144 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
147 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
148 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
149 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
154 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
158 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
172 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
173 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
174 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
229 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
230 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
236 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
237 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
240 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
241 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
242 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
245 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.23
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.39
Nodule 0
Rhizoplane 6.09
Rhizosphere 89.62
Stem 0
Stem Tuber 0
Unclassified 0.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10072902 3300009551 Bacteria 3428
2 JGI25153J46596_10006326 3300003215 Bacteria 6023
3 rootH1_10101462 3300003323 Bacteria 1314
4 Ga0065715_10306608 3300005293 Bacteria 1029
5 Ga0070658_10027978 3300005327 Bacteria 4525
6 Ga0070658_10028965 3300005327 Bacteria 4447
7 Ga0070658_10053409 3300005327 Bacteria 3280
8 Ga0070683_100432716 3300005329 Bacteria 1255
9 Ga0070670_100026882 3300005331 Bacteria 4949
10 Ga0070670_100755444 3300005331 Bacteria 876
11 Ga0070677_10014283 3300005333 Bacteria 2793
12 Ga0070677_10210344 3300005333 Bacteria 944
13 Ga0070666_10470145 3300005335 Bacteria 909
14 Ga0070680_100011452 3300005336 Bacteria 6862
15 Ga0070680_100025958 3300005336 Bacteria 4685
16 Ga0070680_100072903 3300005336 Bacteria 2823
17 Ga0070680_100135108 3300005336 Bacteria 2065
18 Ga0070680_100304071 3300005336 Bacteria 1353
19 Ga0070680_100631888 3300005336 Bacteria 920
20 Ga0070680_100697789 3300005336 Bacteria 873
21 Ga0070682_100006846 3300005337 Bacteria 6401
22 Ga0068868_100040237 3300005338 Bacteria 3637
23 Ga0068868_100591794 3300005338 Bacteria 982
24 Ga0070660_100053762 3300005339 Bacteria 3107
25 Ga0070660_100137014 3300005339 Bacteria 1961
26 Ga0070660_100205323 3300005339 Bacteria 1599
27 Ga0070689_100226481 3300005340 Bacteria 1536
28 Ga0070687_100145290 3300005343 Bacteria 1386
29 Ga0070692_10063626 3300005345 Bacteria 1949
30 Ga0070668_100953801 3300005347 Bacteria 769
31 Ga0070669_100085935 3300005353 Bacteria 2349
32 Ga0070669_100145869 3300005353 Bacteria 1829
33 Ga0070675_100234134 3300005354 Bacteria 1603
34 Ga0070671_100027802 3300005355 Bacteria 4656
35 Ga0070671_100193657 3300005355 Bacteria 1723
36 Ga0070671_100651949 3300005355 Bacteria 911
37 Ga0070674_100003096 3300005356 Bacteria 9255
38 Ga0070674_100650230 3300005356 Bacteria 896
39 Ga0070673_100055124 3300005364 Bacteria 3131
40 Ga0070673_100141661 3300005364 Bacteria 2028
41 Ga0070673_100796017 3300005364 Bacteria 873
42 Ga0070688_100044893 3300005365 Bacteria 2728
43 Ga0070659_100602794 3300005366 Bacteria 944
44 Ga0070667_100042921 3300005367 Bacteria 3794
45 Ga0070709_10120324 3300005434 Bacteria 1779
46 Ga0070714_100050148 3300005435 Bacteria 3554
47 Ga0070714_100097281 3300005435 Bacteria 2587
48 Ga0070714_100293796 3300005435 Bacteria 1513
49 Ga0070713_100443057 3300005436 Bacteria 1219
50 Ga0070713_100558013 3300005436 Bacteria 1085
51 Ga0070713_101114299 3300005436 Bacteria 763
52 Ga0070710_10076775 3300005437 Bacteria 1939
53 Ga0070710_10130329 3300005437 Bacteria 1533
54 Ga0070711_100099184 3300005439 Bacteria 2116
55 Ga0070711_100578612 3300005439 Bacteria 935
56 Ga0070705_100639354 3300005440 Bacteria 828
57 Ga0070700_100084241 3300005441 Bacteria 2060
58 Ga0070678_100010386 3300005456 Bacteria 5684
59 Ga0070678_100060497 3300005456 Bacteria 2788
60 Ga0070678_100750249 3300005456 Bacteria 883
61 Ga0070662_100008811 3300005457 Bacteria 6577
62 Ga0070662_100129303 3300005457 Bacteria 1945
63 Ga0070681_10045046 3300005458 Bacteria 4415
64 Ga0070681_10151203 3300005458 Bacteria 2247
65 Ga0070681_10159183 3300005458 Bacteria 2182
66 Ga0070681_10541998 3300005458 Bacteria 1077
67 Ga0070681_10683129 3300005458 Bacteria 942
68 Ga0068867_100044411 3300005459 Bacteria 3255
69 Ga0070685_10037442 3300005466 Bacteria 2747
70 Ga0070679_100013411 3300005530 Bacteria 7849
71 Ga0070679_100015163 3300005530 Bacteria 7406
72 Ga0070679_100037628 3300005530 Bacteria 4808
73 Ga0070679_100168539 3300005530 Bacteria 2163
74 Ga0070679_100265216 3300005530 Bacteria 1672
75 Ga0070679_100992613 3300005530 Bacteria 784
76 Ga0070684_100612743 3300005535 Bacteria 1012
77 Ga0068853_100001426 3300005539 Bacteria 17252
78 Ga0068853_100583891 3300005539 Bacteria 1060
79 Ga0070686_100347932 3300005544 Bacteria 1113
80 Ga0070693_100148426 3300005547 Bacteria 1482
81 Ga0070665_100347820 3300005548 Bacteria 1488
82 Ga0068855_100099382 3300005563 Bacteria 3351
83 Ga0068855_100154423 3300005563 Bacteria 2609
84 Ga0068855_100159580 3300005563 Bacteria 2560
85 Ga0068855_100211827 3300005563 Bacteria 2177
86 Ga0068855_100348875 3300005563 Bacteria 1631
87 Ga0068855_100714647 3300005563 Bacteria 1071
88 Ga0068857_101041402 3300005577 Bacteria 789
89 Ga0068854_100316435 3300005578 Bacteria 1267
90 Ga0068852_100507502 3300005616 Bacteria 1202
91 Ga0068859_100082811 3300005617 Bacteria 3251
92 Ga0068859_100331734 3300005617 Bacteria 1615
93 Ga0068864_100047112 3300005618 Bacteria 3701
94 Ga0068864_100165912 3300005618 Bacteria 2011
95 Ga0068858_100231102 3300005842 Bacteria 1753
96 Ga0070717_10467519 3300006028 Bacteria 1138
97 Ga0075365_10303844 3300006038 Bacteria 1123
98 Ga0075364_10002489 3300006051 Bacteria 10316
99 Ga0070715_10082691 3300006163 Bacteria 1461
100 Ga0070716_100566227 3300006173 Bacteria 849
101 Ga0070712_100602422 3300006175 Bacteria 930
102 Ga0070712_100670003 3300006175 Bacteria 883
103 Ga0075369_10045685 3300006186 Bacteria 1884
104 Ga0075366_10012522 3300006195 Bacteria 4812
105 Ga0075366_10072392 3300006195 Bacteria 2054
106 Ga0097621_100062007 3300006237 Bacteria 3068
107 Ga0097621_100194159 3300006237 Bacteria 1759
108 Ga0068871_100220762 3300006358 Bacteria 1642
109 Ga0068871_100229047 3300006358 Bacteria 1612
110 Ga0075428_100087097 3300006844 Bacteria 3407
111 Ga0075431_100113059 3300006847 Bacteria 2802
112 Ga0075431_100689335 3300006847 Bacteria 1000
113 Ga0075429_100305935 3300006880 Bacteria 1392
114 Ga0068865_100118105 3300006881 Bacteria 1967
115 Ga0068865_100310282 3300006881 Bacteria 1265
116 Ga0075436_100150834 3300006914 Bacteria 1636
117 Ga0075436_100201673 3300006914 Bacteria 1409
118 Ga0097620_100082809 3300006931 Bacteria 3251
119 Ga0097620_100331734 3300006931 Bacteria 1615
120 Ga0105240_10629531 3300009093 Bacteria 1178
121 Ga0111539_10474390 3300009094 Bacteria 1457
122 Ga0105245_10103263 3300009098 Bacteria 2641
123 Ga0105245_10207633 3300009098 Bacteria 1884
124 Ga0105245_10652656 3300009098 Bacteria 1082
125 Ga0105247_10180742 3300009101 Bacteria 1408
126 Ga0114129_10062316 3300009147 Bacteria 5210
127 Ga0114129_10205298 3300009147 Bacteria 2666
128 Ga0105241_10095451 3300009174 Bacteria 2354
129 Ga0105242_10069120 3300009176 Bacteria 2924
130 Ga0105242_10288095 3300009176 Bacteria 1494
131 Ga0105248_10134194 3300009177 Bacteria 2793
132 Ga0105237_11305053 3300009545 Bacteria 732
133 Ga0105238_10055204 3300009551 Bacteria 3988
134 Ga0105238_10207457 3300009551 Bacteria 1935
135 Ga0105238_10362027 3300009551 Bacteria 1440
136 Ga0099796_10047985 3300010159 Bacteria 1471
137 Ga0105246_10163165 3300011119 Bacteria 1699
138 Ga0105246_10337325 3300011119 Bacteria 1231
139 Ga0105246_10937231 3300011119 Bacteria 779
140 Ga0157373_10057036 3300013100 Bacteria 2771
141 Ga0157373_10066546 3300013100 Bacteria 2549
142 Ga0157373_10215370 3300013100 Bacteria 1354
143 Ga0157371_10648364 3300013102 Bacteria 788
144 Ga0157370_10031902 3300013104 Bacteria 5149
145 Ga0157370_10059136 3300013104 Bacteria 3643
146 Ga0157370_10691840 3300013104 Bacteria 931
147 Ga0157369_10117851 3300013105 Bacteria 2818
148 Ga0157369_10487659 3300013105 Bacteria 1275
149 Ga0157369_10869880 3300013105 Bacteria 925
150 Ga0157378_10092192 3300013297 Bacteria 2756
151 Ga0163162_10171530 3300013306 Bacteria 2294
152 Ga0163162_11268225 3300013306 Bacteria 837
153 Ga0157372_10009232 3300013307 Bacteria 10485
154 Ga0157372_10203736 3300013307 Bacteria 2292
155 Ga0157372_10273816 3300013307 Bacteria 1962
156 Ga0157372_10844341 3300013307 Bacteria 1063
157 Ga0157372_11365261 3300013307 Unclassified 817
158 Ga0157375_10267602 3300013308 Bacteria 1871
159 Ga0157375_10843607 3300013308 Bacteria 1063
160 Ga0163163_10076912 3300014325 Bacteria 3333
161 Ga0163163_10091065 3300014325 Bacteria 3063
162 Ga0163163_10676842 3300014325 Bacteria 1095
163 Ga0157376_10192158 3300014969 Bacteria 1873
164 Ga0163161_10304630 3300017792 Bacteria 1256
165 Ga0163161_10536869 3300017792 Bacteria 957
166 Ga0206356_11190055 3300020070 Bacteria 831
167 Ga0209758_1000188 3300025297 Bacteria 138749
168 Ga0207682_10002841 3300025893 Bacteria 7639
169 Ga0207692_10040715 3300025898 Bacteria 2295
170 Ga0207642_10342059 3300025899 Bacteria 880
171 Ga0207710_10094888 3300025900 Bacteria 1401
172 Ga0207688_10069100 3300025901 Bacteria 2001
173 Ga0207680_10295193 3300025903 Bacteria 1129
174 Ga0207685_10087182 3300025905 Bacteria 1306
175 Ga0207699_10114611 3300025906 Bacteria 1733
176 Ga0207645_10057545 3300025907 Bacteria 2482
177 Ga0207645_10151314 3300025907 Bacteria 1515
178 Ga0207705_10103538 3300025909 Bacteria 2096
179 Ga0207654_10186923 3300025911 Bacteria 1355
180 Ga0207707_10052036 3300025912 Bacteria 3566
181 Ga0207707_10079086 3300025912 Bacteria 2871
182 Ga0207707_10282255 3300025912 Bacteria 1438
183 Ga0207707_10581380 3300025912 Bacteria 949
184 Ga0207695_10430013 3300025913 Bacteria 1204
185 Ga0207693_10007083 3300025915 Bacteria 9255
186 Ga0207693_10238549 3300025915 Bacteria 1427
187 Ga0207663_10448637 3300025916 Bacteria 994
188 Ga0207660_10045377 3300025917 Bacteria 3096
189 Ga0207660_10099786 3300025917 Bacteria 2167
190 Ga0207660_10187669 3300025917 Bacteria 1608
191 Ga0207660_10275843 3300025917 Bacteria 1333
192 Ga0207657_10012386 3300025919 Bacteria 8425
193 Ga0207657_10049996 3300025919 Bacteria 3640
194 Ga0207657_10283899 3300025919 Bacteria 1314
195 Ga0207657_10421105 3300025919 Bacteria 1049
196 Ga0207652_10017613 3300025921 Bacteria 5847
197 Ga0207652_10019752 3300025921 Bacteria 5544
198 Ga0207652_10055891 3300025921 Bacteria 3397
199 Ga0207681_10491712 3300025923 Bacteria 1003
200 Ga0207694_10070217 3300025924 Bacteria 2736
201 Ga0207694_10137170 3300025924 Bacteria 1966
202 Ga0207694_10475959 3300025924 Bacteria 1044
203 Ga0207650_10024914 3300025925 Bacteria 4259
204 Ga0207650_10814290 3300025925 Bacteria 792
205 Ga0207659_10040871 3300025926 Bacteria 3245
206 Ga0207659_10706590 3300025926 Bacteria 863
207 Ga0207687_10009265 3300025927 Bacteria 6440
208 Ga0207687_10043029 3300025927 Bacteria 3110
209 Ga0207687_10102474 3300025927 Bacteria 2109
210 Ga0207700_10313291 3300025928 Bacteria 1358
211 Ga0207700_10399954 3300025928 Bacteria 1204
212 Ga0207664_10196236 3300025929 Bacteria 1740
213 Ga0207664_10273736 3300025929 Bacteria 1480
214 Ga0207644_10606389 3300025931 Bacteria 909
215 Ga0207690_10014208 3300025932 Bacteria 4805
216 Ga0207706_10010248 3300025933 Bacteria 8571
217 Ga0207706_10309959 3300025933 Bacteria 1374
218 Ga0207686_10030953 3300025934 Bacteria 3174
219 Ga0207686_10078867 3300025934 Bacteria 2143
220 Ga0207670_10007258 3300025936 Bacteria 6174
221 Ga0207670_10520032 3300025936 Bacteria 969
222 Ga0207669_10001043 3300025937 Bacteria 11828
223 Ga0207669_10496780 3300025937 Bacteria 975
224 Ga0207704_10030194 3300025938 Bacteria 3035
225 Ga0207704_10422428 3300025938 Bacteria 1057
226 Ga0207691_10092454 3300025940 Bacteria 2709
227 Ga0207711_10086135 3300025941 Bacteria 2754
228 Ga0207711_10541530 3300025941 Bacteria 1086
229 Ga0207689_10063125 3300025942 Bacteria 3047
230 Ga0207661_10548612 3300025944 Bacteria 1059
231 Ga0207667_10030455 3300025949 Bacteria 5837
232 Ga0207667_10190017 3300025949 Bacteria 2107
233 Ga0207667_10292804 3300025949 Bacteria 1663
234 Ga0207667_10705131 3300025949 Bacteria 1011
235 Ga0207667_11147599 3300025949 Bacteria 758
236 Ga0207651_10089754 3300025960 Bacteria 2245
237 Ga0207651_10227414 3300025960 Bacteria 1512
238 Ga0207651_10398956 3300025960 Bacteria 1169
239 Ga0207640_10325650 3300025981 Bacteria 1225
240 Ga0207640_10336696 3300025981 Bacteria 1207
241 Ga0207640_10531983 3300025981 Bacteria 984
242 Ga0207658_10023653 3300025986 Bacteria 4291
243 Ga0207658_10211665 3300025986 Bacteria 1625
244 Ga0207703_10326529 3300026035 Bacteria 1406
245 Ga0207703_10470763 3300026035 Bacteria 1176
246 Ga0207703_10964992 3300026035 Bacteria 817
247 Ga0207678_10457693 3300026067 Bacteria 1110
248 Ga0207678_10526044 3300026067 Bacteria 1032
249 Ga0207702_11305873 3300026078 Bacteria 720
250 Ga0207641_10138528 3300026088 Bacteria 2193
251 Ga0207641_10368402 3300026088 Bacteria 1373
252 Ga0207648_10014584 3300026089 Bacteria 7258
253 Ga0207648_10229497 3300026089 Bacteria 1651
254 Ga0207676_10049134 3300026095 Bacteria 3279
255 Ga0207676_10588558 3300026095 Bacteria 1067
256 Ga0207674_10266986 3300026116 Bacteria 1659
257 Ga0207674_10322711 3300026116 Bacteria 1494
258 Ga0207674_10514805 3300026116 Bacteria 1156
259 Ga0207683_10037407 3300026121 Bacteria 4226
260 Ga0207683_10418701 3300026121 Bacteria 1234
261 Ga0207698_10129546 3300026142 Bacteria 2153
262 Ga0207698_10467885 3300026142 Bacteria 1220
263 Ga0207698_10487723 3300026142 Bacteria 1197
264 Ga0209971_1005141 3300027682 Bacteria 3106
265 Ga0268266_10179134 3300028379 Bacteria 1929
266 Ga0265334_10021465 3300028573 Bacteria 2636
267 Ga0265330_10000012 3300031235 Bacteria 180837
268 Ga0265332_10000012 3300031238 Bacteria 272641
269 Ga0265332_10205193 3300031238 Bacteria 818
270 Ga0265320_10110227 3300031240 Bacteria 1261
271 Ga0265325_10005643 3300031241 Bacteria 7697
272 Ga0265325_10009992 3300031241 Bacteria 5515
273 Ga0265325_10018970 3300031241 Bacteria 3809
274 Ga0265325_10096264 3300031241 Bacteria 1454
275 Ga0265340_10007315 3300031247 Bacteria 6001
276 Ga0265340_10108274 3300031247 Bacteria 1286
277 Ga0265331_10085416 3300031250 Bacteria 1462
278 Ga0316579_10062629 3300031691 Bacteria 1752
279 Ga0265314_10000029 3300031711 Bacteria 272506
280 Ga0265314_10020379 3300031711 Bacteria 5119
281 Ga0265314_10235677 3300031711 Bacteria 1059
282 Ga0265342_10000760 3300031712 Bacteria 32963
283 Ga0265342_10034133 3300031712 Bacteria 3123
284 Ga0265342_10072723 3300031712 Bacteria 2001
285 Ga0307412_10008676 3300031911 Bacteria 5812
286 Ga0373959_0061082 3300034820 Bacteria 834
287 Ga0373923_0278468 3300035111 Bacteria 788
288 Ga0373939_0132803 3300035114 Bacteria 890
289 Ga0373953_0110140 3300035117 Bacteria 1164
290 Ga0373956_0214473 3300035119 Bacteria 913
291 Ga0373943_0112769 3300035170 Bacteria 1436
292 Ga0373955_0034436 3300035172 Bacteria 2675
293 Ga0373961_0009298 3300035241 Bacteria 2403
294 Ga0373924_0065318 3300035410 Bacteria 1528
295 Ga0373931_0113074 3300035691 Bacteria 1543
296 Ga0373933_0325796 3300035724 Bacteria 996
297 Ga0373947_0164189 3300035725 Bacteria 1438
298 Ga0373947_0308899 3300035725 Bacteria 1056
299 Ga0373947_0459662 3300035725 Bacteria 863
300 Ga0373937_0132621 3300036401 Bacteria 2327
301 Ga0373937_0385290 3300036401 Bacteria 1330
302 Ga0373937_0813244 3300036401 Bacteria 883
303 Ga0373925_0206926 3300037068 Bacteria 1562
304 Ga0373925_0238971 3300037068 Bacteria 1454
305 Ga0395898_0002494 3300037466 Bacteria 21650
306 Ga0436364_0561925 3300037853 Bacteria 691
307 Ga0395901_0024020 3300038443 Bacteria 6253
308 Ga0395901_0036020 3300038443 Bacteria 5113
309 Ga0395901_0883286 3300038443 Bacteria 877
310 Ga0466963_0167707 3300044694 Bacteria 1530
311 Ga0495617_057462 3300046452 Bacteria 1290
312 Ga0495592_0045660 3300046454 Bacteria 3268
313 Ga0495651_0009837 3300046462 Bacteria 7352
314 Ga0495662_0130180 3300046476 Bacteria 1237
315 Ga0495640_0435737 3300046533 Bacteria 802
316 Ga0495645_0003148 3300046543 Bacteria 11187
317 Ga0495667_0012256 3300046559 Bacteria 5811
318 Ga0495635_0206737 3300046663 Bacteria 1330
319 Ga0495588_0272378 3300046674 Bacteria 892
320 Ga0495623_0264350 3300046679 Bacteria 962
321 Ga0495600_0665551 3300046809 Bacteria 628
322 Ga0495604_0035799 3300047317 Bacteria 3918
323 Ga0495604_0487726 3300047317 Bacteria 801
324 Ga0495674_0265214 3300047319 Bacteria 1410
325 Ga0495674_0371698 3300047319 Bacteria 1158
326 Ga0495680_0022570 3300047322 Bacteria 5242
327 Ga0495602_0036104 3300048088 Bacteria 4603
328 Ga0495602_0496574 3300048088 Bacteria 854
329 Ga0496100_0015279 3300048903 Bacteria 4480
330 Ga0496100_0110167 3300048903 Bacteria 1911
331 Ga0496100_0156699 3300048903 Bacteria 1629
332 Ga0496101_0018533 3300048904 Bacteria 4735
333 Ga0496101_0278277 3300048904 Bacteria 1307
334 Ga0496102_0210254 3300048905 Bacteria 1834
335 Ga0496104_0000090 3300048907 Bacteria 87877
336 Ga0496104_0083777 3300048907 Bacteria 3041
337 Ga0496105_0001810 3300048908 Bacteria 15299
338 Ga0496105_0007284 3300048908 Bacteria 8548
339 Ga0496105_0013103 3300048908 Bacteria 6575
340 Ga0496106_0010697 3300048909 Bacteria 6781
341 Ga0496106_0180963 3300048909 Bacteria 1673
342 Ga0496107_0013472 3300048910 Bacteria 5716
343 Ga0496108_0000805 3300048911 Bacteria 24339
344 Ga0496109_0003733 3300048912 Bacteria 12725
345 Ga0496110_0049050 3300048913 Bacteria 3702
346 Ga0496111_0018479 3300048914 Bacteria 4830
347 Ga0496112_0008356 3300048915 Bacteria 9269
348 Ga0496112_0929371 3300048915 Bacteria 791
349 Ga0496113_0049228 3300048916 Bacteria 3137
350 Ga0496113_0389935 3300048916 Bacteria 1118
351 Ga0496114_0020586 3300048917 Bacteria 5355
352 Ga0496114_0112851 3300048917 Bacteria 2330
353 Ga0496114_0128696 3300048917 Bacteria 2185
354 Ga0496115_0003400 3300048918 Bacteria 11426
355 Ga0496115_0088136 3300048918 Bacteria 2533
356 Ga0496126_0054845 3300048929 Bacteria 3608
357 Ga0501033_0063851 3300049570 Bacteria 2710
358 Ga0501033_0269399 3300049570 Bacteria 1204
359 Ga0501033_0280513 3300049570 Bacteria 1176
360 Ga0501034_0250723 3300049571 Bacteria 1715
361 Ga0501034_0301000 3300049571 Bacteria 1540
362 Ga0501034_0579232 3300049571 Bacteria 1029
363 Ga0501034_0773169 3300049571 Bacteria 854
364 Ga0501036_0700451 3300049572 Bacteria 837
365 Ga0501036_0831864 3300049572 Bacteria 759
366 Ga0501038_0061135 3300049574 Bacteria 3222
367 Ga0501038_0132294 3300049574 Bacteria 2046
368 Ga0501042_0046488 3300049578 Bacteria 3095
369 Ga0501043_0049543 3300049579 Bacteria 3302
370 Ga0501046_0018860 3300049580 Bacteria 5730
371 Ga0501047_0003616 3300049581 Bacteria 14572
372 Ga0501047_0106974 3300049581 Bacteria 2678
373 Ga0501047_0249308 3300049581 Bacteria 1624
374 Ga0501047_0254051 3300049581 Bacteria 1606
375 Ga0501047_0256750 3300049581 Bacteria 1596
376 Ga0501047_0409772 3300049581 Bacteria 1188
377 Ga0501047_0643834 3300049581 Unclassified 880
378 Ga0501048_0125891 3300049582 Bacteria 1811
379 Ga0501067_0121299 3300049583 Bacteria 1455
380 Ga0501068_0031650 3300049584 Bacteria 3142
381 Ga0501069_0009076 3300049585 Bacteria 5247
382 Ga0501070_0022563 3300049586 Bacteria 5272
383 Ga0501070_0054793 3300049586 Bacteria 3307
384 Ga0501070_0070699 3300049586 Bacteria 2890
385 Ga0501070_0248618 3300049586 Bacteria 1455
386 Ga0501070_0657079 3300049586 Bacteria 832
387 Ga0501071_0035873 3300049587 Bacteria 3534
388 Ga0501071_0109191 3300049587 Bacteria 2044
389 Ga0501072_0046760 3300049588 Bacteria 3407
390 Ga0501072_0322466 3300049588 Bacteria 1228
391 Ga0501073_0114450 3300049589 Bacteria 1870
392 Ga0501074_0027519 3300049590 Bacteria 4122
393 Ga0501076_0011971 3300049592 Bacteria 6481
394 Ga0501076_0259941 3300049592 Unclassified 1421
395 Ga0501077_0074705 3300049593 Bacteria 2147
396 Ga0501079_0079368 3300049741 Bacteria 2538
397 Ga0501079_0156720 3300049741 Bacteria 1775
398 Ga0501079_0613955 3300049741 Bacteria 856
399 Ga0501080_0099054 3300049742 Bacteria 2705
400 Ga0501080_0782977 3300049742 Bacteria 837
401 Ga0501080_0795717 3300049742 Bacteria 829
402 Ga0501081_0172298 3300049743 Bacteria 1563
403 Ga0501083_0031278 3300049744 Bacteria 3653
404 Ga0501083_0069615 3300049744 Bacteria 2341
405 Ga0501083_0246133 3300049744 Bacteria 1164
406 Ga0501035_0036273 3300049822 Bacteria 4470
407 Ga0501035_0085064 3300049822 Bacteria 2789
408 Ga0501044_0004547 3300049823 Bacteria 15509
409 Ga0501044_0116899 3300049823 Bacteria 2671
410 Ga0501044_0396838 3300049823 Bacteria 1292
411 Ga0501044_0403982 3300049823 Bacteria 1278
412 Ga0501044_0953247 3300049823 Bacteria 731
413 Ga0501044_1031910 3300049823 Bacteria 693
414 Ga0501045_0128521 3300049824 Bacteria 1883
415 nmdc:mga00v17_8078_c1 3300050491 Bacteria 5651
416 nmdc:mga0yw44_286280_c1 3300050492 Bacteria 1102
417 nmdc:mga0yw44_479609_c1 3300050492 Bacteria 843
418 nmdc:mga0k408_105091_c1 3300050493 Bacteria 1667
419 nmdc:mga05p37_238653_c1 3300050507 Bacteria 2187
420 nmdc:mga06r32_110014_c1 3300050510 Bacteria 2710
421 nmdc:mga06r32_616654_c1 3300050510 Bacteria 1055
422 nmdc:mga08y16_375701_c1 3300050511 Bacteria 1457
423 nmdc:mga0n895_434207_c1 3300050512 Unclassified 1327
424 Ga0495601_0024174 3300053077 Bacteria 3740
425 Ga0495601_0236637 3300053077 Bacteria 1192
426 Ga0495612_0012389 3300053078 Bacteria 3437
427 Ga0495612_0222948 3300053078 Bacteria 835
428 Ga0495595_0123623 3300053084 Bacteria 1261
429 Ga0495595_0155006 3300053084 Bacteria 1128
430 Ga0495619_0002497 3300053085 Bacteria 12041
431 Ga0500595_019074 3300053119 Bacteria 2495
432 Ga0500642_0060804 3300053130 Bacteria 1696
433 Ga0500652_000015 3300053131 Bacteria 131012
434 Ga0500636_0040792 3300053177 Bacteria 2745
435 Ga0501084_0060040 3300054114 Bacteria 3184
436 Ga0501084_0078137 3300054114 Bacteria 2774
437 Ga0501084_0177109 3300054114 Bacteria 1800
438 Ga0501084_0603385 3300054114 Bacteria 927
439 Ga0501082_0030553 3300060353 Bacteria 4642
440 Ga0501082_0200976 3300060353 Bacteria 1734
441 Ga0501082_0382211 3300060353 Bacteria 1229
442 Ga0501082_0386337 3300060353 Bacteria 1221
443 2753767397 2751185897 Bacteria 5322941
444 Ga0105238_10072902
445 JGI25153J46596_10006326
446 rootH1_10101462
447 Ga0065715_10306608
448 Ga0070658_10027978
449 Ga0070658_10028965
450 Ga0070658_10053409
451 Ga0070683_100432716
452 Ga0070670_100026882
453 Ga0070670_100755444
454 Ga0070677_10014283
455 Ga0070677_10210344
456 Ga0070666_10470145
457 Ga0070680_100011452
458 Ga0070680_100025958
459 Ga0070680_100072903
460 Ga0070680_100135108
461 Ga0070680_100304071
462 Ga0070680_100631888
463 Ga0070680_100697789
464 Ga0070682_100006846
465 Ga0068868_100040237
466 Ga0068868_100591794
467 Ga0070660_100053762
468 Ga0070660_100137014
469 Ga0070660_100205323
470 Ga0070689_100226481
471 Ga0070687_100145290
472 Ga0070692_10063626
473 Ga0070668_100953801
474 Ga0070669_100085935
475 Ga0070669_100145869
476 Ga0070675_100234134
477 Ga0070671_100027802
478 Ga0070671_100193657
479 Ga0070671_100651949
480 Ga0070674_100003096
481 Ga0070674_100650230
482 Ga0070673_100055124
483 Ga0070673_100141661
484 Ga0070673_100796017
485 Ga0070688_100044893
486 Ga0070659_100602794
487 Ga0070667_100042921
488 Ga0070709_10120324
489 Ga0070714_100050148
490 Ga0070714_100097281
491 Ga0070714_100293796
492 Ga0070713_100443057
493 Ga0070713_100558013
494 Ga0070713_101114299
495 Ga0070710_10076775
496 Ga0070710_10130329
497 Ga0070711_100099184
498 Ga0070711_100578612
499 Ga0070705_100639354
500 Ga0070700_100084241
501 Ga0070678_100010386
502 Ga0070678_100060497
503 Ga0070678_100750249
504 Ga0070662_100008811
505 Ga0070662_100129303
506 Ga0070681_10045046
507 Ga0070681_10151203
508 Ga0070681_10159183
509 Ga0070681_10541998
510 Ga0070681_10683129
511 Ga0068867_100044411
512 Ga0070685_10037442
513 Ga0070679_100013411
514 Ga0070679_100015163
515 Ga0070679_100037628
516 Ga0070679_100168539
517 Ga0070679_100265216
518 Ga0070679_100992613
519 Ga0070684_100612743
520 Ga0068853_100001426
521 Ga0068853_100583891
522 Ga0070686_100347932
523 Ga0070693_100148426
524 Ga0070665_100347820
525 Ga0068855_100099382
526 Ga0068855_100154423
527 Ga0068855_100159580
528 Ga0068855_100211827
529 Ga0068855_100348875
530 Ga0068855_100714647
531 Ga0068857_101041402
532 Ga0068854_100316435
533 Ga0068852_100507502
534 Ga0068859_100082811
535 Ga0068859_100331734
536 Ga0068864_100047112
537 Ga0068864_100165912
538 Ga0068858_100231102
539 Ga0070717_10467519
540 Ga0075365_10303844
541 Ga0075364_10002489
542 Ga0070715_10082691
543 Ga0070716_100566227
544 Ga0070712_100602422
545 Ga0070712_100670003
546 Ga0075369_10045685
547 Ga0075366_10012522
548 Ga0075366_10072392
549 Ga0097621_100062007
550 Ga0097621_100194159
551 Ga0068871_100220762
552 Ga0068871_100229047
553 Ga0075428_100087097
554 Ga0075431_100113059
555 Ga0075431_100689335
556 Ga0075429_100305935
557 Ga0068865_100118105
558 Ga0068865_100310282
559 Ga0075436_100150834
560 Ga0075436_100201673
561 Ga0097620_100082809
562 Ga0097620_100331734
563 Ga0105240_10629531
564 Ga0111539_10474390
565 Ga0105245_10103263
566 Ga0105245_10207633
567 Ga0105245_10652656
568 Ga0105247_10180742
569 Ga0114129_10062316
570 Ga0114129_10205298
571 Ga0105241_10095451
572 Ga0105242_10069120
573 Ga0105242_10288095
574 Ga0105248_10134194
575 Ga0105237_11305053
576 Ga0105238_10055204
577 Ga0105238_10207457
578 Ga0105238_10362027
579 Ga0099796_10047985
580 Ga0105246_10163165
581 Ga0105246_10337325
582 Ga0105246_10937231
583 Ga0157373_10057036
584 Ga0157373_10066546
585 Ga0157373_10215370
586 Ga0157371_10648364
587 Ga0157370_10031902
588 Ga0157370_10059136
589 Ga0157370_10691840
590 Ga0157369_10117851
591 Ga0157369_10487659
592 Ga0157369_10869880
593 Ga0157378_10092192
594 Ga0163162_10171530
595 Ga0163162_11268225
596 Ga0157372_10009232
597 Ga0157372_10203736
598 Ga0157372_10273816
599 Ga0157372_10844341
600 Ga0157372_11365261
601 Ga0157375_10267602
602 Ga0157375_10843607
603 Ga0163163_10076912
604 Ga0163163_10091065
605 Ga0163163_10676842
606 Ga0157376_10192158
607 Ga0163161_10304630
608 Ga0163161_10536869
609 Ga0206356_11190055
610 Ga0209758_1000188
611 Ga0207682_10002841
612 Ga0207692_10040715
613 Ga0207642_10342059
614 Ga0207710_10094888
615 Ga0207688_10069100
616 Ga0207680_10295193
617 Ga0207685_10087182
618 Ga0207699_10114611
619 Ga0207645_10057545
620 Ga0207645_10151314
621 Ga0207705_10103538
622 Ga0207654_10186923
623 Ga0207707_10052036
624 Ga0207707_10079086
625 Ga0207707_10282255
626 Ga0207707_10581380
627 Ga0207695_10430013
628 Ga0207693_10007083
629 Ga0207693_10238549
630 Ga0207663_10448637
631 Ga0207660_10045377
632 Ga0207660_10099786
633 Ga0207660_10187669
634 Ga0207660_10275843
635 Ga0207657_10012386
636 Ga0207657_10049996
637 Ga0207657_10283899
638 Ga0207657_10421105
639 Ga0207652_10017613
640 Ga0207652_10019752
641 Ga0207652_10055891
642 Ga0207681_10491712
643 Ga0207694_10070217
644 Ga0207694_10137170
645 Ga0207694_10475959
646 Ga0207650_10024914
647 Ga0207650_10814290
648 Ga0207659_10040871
649 Ga0207659_10706590
650 Ga0207687_10009265
651 Ga0207687_10043029
652 Ga0207687_10102474
653 Ga0207700_10313291
654 Ga0207700_10399954
655 Ga0207664_10196236
656 Ga0207664_10273736
657 Ga0207644_10606389
658 Ga0207690_10014208
659 Ga0207706_10010248
660 Ga0207706_10309959
661 Ga0207686_10030953
662 Ga0207686_10078867
663 Ga0207670_10007258
664 Ga0207670_10520032
665 Ga0207669_10001043
666 Ga0207669_10496780
667 Ga0207704_10030194
668 Ga0207704_10422428
669 Ga0207691_10092454
670 Ga0207711_10086135
671 Ga0207711_10541530
672 Ga0207689_10063125
673 Ga0207661_10548612
674 Ga0207667_10030455
675 Ga0207667_10190017
676 Ga0207667_10292804
677 Ga0207667_10705131
678 Ga0207667_11147599
679 Ga0207651_10089754
680 Ga0207651_10227414
681 Ga0207651_10398956
682 Ga0207640_10325650
683 Ga0207640_10336696
684 Ga0207640_10531983
685 Ga0207658_10023653
686 Ga0207658_10211665
687 Ga0207703_10326529
688 Ga0207703_10470763
689 Ga0207703_10964992
690 Ga0207678_10457693
691 Ga0207678_10526044
692 Ga0207702_11305873
693 Ga0207641_10138528
694 Ga0207641_10368402
695 Ga0207648_10014584
696 Ga0207648_10229497
697 Ga0207676_10049134
698 Ga0207676_10588558
699 Ga0207674_10266986
700 Ga0207674_10322711
701 Ga0207674_10514805
702 Ga0207683_10037407
703 Ga0207683_10418701
704 Ga0207698_10129546
705 Ga0207698_10467885
706 Ga0207698_10487723
707 Ga0209971_1005141
708 Ga0268266_10179134
709 Ga0265334_10021465
710 Ga0265330_10000012
711 Ga0265332_10000012
712 Ga0265332_10205193
713 Ga0265320_10110227
714 Ga0265325_10005643
715 Ga0265325_10009992
716 Ga0265325_10018970
717 Ga0265325_10096264
718 Ga0265340_10007315
719 Ga0265340_10108274
720 Ga0265331_10085416
721 Ga0316579_10062629
722 Ga0265314_10000029
723 Ga0265314_10020379
724 Ga0265314_10235677
725 Ga0265342_10000760
726 Ga0265342_10034133
727 Ga0265342_10072723
728 Ga0307412_10008676
729 Ga0373959_0061082
730 Ga0373923_0278468
731 Ga0373939_0132803
732 Ga0373953_0110140
733 Ga0373956_0214473
734 Ga0373943_0112769
735 Ga0373955_0034436
736 Ga0373961_0009298
737 Ga0373924_0065318
738 Ga0373931_0113074
739 Ga0373933_0325796
740 Ga0373947_0164189
741 Ga0373947_0308899
742 Ga0373947_0459662
743 Ga0373937_0132621
744 Ga0373937_0385290
745 Ga0373937_0813244
746 Ga0373925_0206926
747 Ga0373925_0238971
748 Ga0395898_0002494
749 Ga0436364_0561925
750 Ga0395901_0024020
751 Ga0395901_0036020
752 Ga0395901_0883286
753 Ga0466963_0167707
754 Ga0495617_057462
755 Ga0495592_0045660
756 Ga0495651_0009837
757 Ga0495662_0130180
758 Ga0495640_0435737
759 Ga0495645_0003148
760 Ga0495667_0012256
761 Ga0495635_0206737
762 Ga0495588_0272378
763 Ga0495623_0264350
764 Ga0495600_0665551
765 Ga0495604_0035799
766 Ga0495604_0487726
767 Ga0495674_0265214
768 Ga0495674_0371698
769 Ga0495680_0022570
770 Ga0495602_0036104
771 Ga0495602_0496574
772 Ga0496100_0015279
773 Ga0496100_0110167
774 Ga0496100_0156699
775 Ga0496101_0018533
776 Ga0496101_0278277
777 Ga0496102_0210254
778 Ga0496104_0000090
779 Ga0496104_0083777
780 Ga0496105_0001810
781 Ga0496105_0007284
782 Ga0496105_0013103
783 Ga0496106_0010697
784 Ga0496106_0180963
785 Ga0496107_0013472
786 Ga0496108_0000805
787 Ga0496109_0003733
788 Ga0496110_0049050
789 Ga0496111_0018479
790 Ga0496112_0008356
791 Ga0496112_0929371
792 Ga0496113_0049228
793 Ga0496113_0389935
794 Ga0496114_0020586
795 Ga0496114_0112851
796 Ga0496114_0128696
797 Ga0496115_0003400
798 Ga0496115_0088136
799 Ga0496126_0054845
800 Ga0501033_0063851
801 Ga0501033_0269399
802 Ga0501033_0280513
803 Ga0501034_0250723
804 Ga0501034_0301000
805 Ga0501034_0579232
806 Ga0501034_0773169
807 Ga0501036_0700451
808 Ga0501036_0831864
809 Ga0501038_0061135
810 Ga0501038_0132294
811 Ga0501042_0046488
812 Ga0501043_0049543
813 Ga0501046_0018860
814 Ga0501047_0003616
815 Ga0501047_0106974
816 Ga0501047_0249308
817 Ga0501047_0254051
818 Ga0501047_0256750
819 Ga0501047_0409772
820 Ga0501047_0643834
821 Ga0501048_0125891
822 Ga0501067_0121299
823 Ga0501068_0031650
824 Ga0501069_0009076
825 Ga0501070_0022563
826 Ga0501070_0054793
827 Ga0501070_0070699
828 Ga0501070_0248618
829 Ga0501070_0657079
830 Ga0501071_0035873
831 Ga0501071_0109191
832 Ga0501072_0046760
833 Ga0501072_0322466
834 Ga0501073_0114450
835 Ga0501074_0027519
836 Ga0501076_0011971
837 Ga0501076_0259941
838 Ga0501077_0074705
839 Ga0501079_0079368
840 Ga0501079_0156720
841 Ga0501079_0613955
842 Ga0501080_0099054
843 Ga0501080_0782977
844 Ga0501080_0795717
845 Ga0501081_0172298
846 Ga0501083_0031278
847 Ga0501083_0069615
848 Ga0501083_0246133
849 Ga0501035_0036273
850 Ga0501035_0085064
851 Ga0501044_0004547
852 Ga0501044_0116899
853 Ga0501044_0396838
854 Ga0501044_0403982
855 Ga0501044_0953247
856 Ga0501044_1031910
857 Ga0501045_0128521
858 nmdc:mga00v17_8078_c1
859 nmdc:mga0yw44_286280_c1
860 nmdc:mga0yw44_479609_c1
861 nmdc:mga0k408_105091_c1
862 nmdc:mga05p37_238653_c1
863 nmdc:mga06r32_110014_c1
864 nmdc:mga06r32_616654_c1
865 nmdc:mga08y16_375701_c1
866 nmdc:mga0n895_434207_c1
867 Ga0495601_0024174
868 Ga0495601_0236637
869 Ga0495612_0012389
870 Ga0495612_0222948
871 Ga0495595_0123623
872 Ga0495595_0155006
873 Ga0495619_0002497
874 Ga0500595_019074
875 Ga0500642_0060804
876 Ga0500652_000015
877 Ga0500636_0040792
878 Ga0501084_0060040
879 Ga0501084_0078137
880 Ga0501084_0177109
881 Ga0501084_0603385
882 Ga0501082_0030553
883 Ga0501082_0200976
884 Ga0501082_0382211
885 Ga0501082_0386337
886 2753767397

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

25

99

0.97

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

35

100

0.91

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

29

105

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ai8-assembly1.cif.gz_B crystal structure of glutathione transferase chi 1 from synechocystis sp. pcc 6803 in complex with glutathione 0.8574 4 194
8ai9-assembly1.cif.gz_B s10t variant of glutathione transferase chi 1 from synechocystis sp. pcc 6803 in complex with glutathione 0.857 4 194
8aib-assembly1.cif.gz_B r11a variant of glutathione transferase chi 1 from synechocystis sp. pcc 6803 in complex with glutathione 0.8464 4 194
3uap-assembly1.cif.gz_A crystal structure of glutathione transferase (target efi-501774) from methylococcus capsulatus str. bath 0.8452 4 199
3m8n-assembly1.cif.gz_B crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.8355 4 191
ID Description Score Start End Superfamily
af_A0A0B5EC52_24_99_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9636 7 79 3.40.30.10
af_A0A1D6HAW8_13_80_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9599 7 70 3.40.30.10
af_Q9VHD2_18_96_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9524 7 79 3.40.30.10
af_K7TUZ4_3_77_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9498 4 66 3.40.30.10
af_Q9C6C8_6_89_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9479 5 80 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A0Q7TLL8-F1-model_v4 Glutathione S-transferase 0.9985 1 205 GO:0016740
AF-A0A3C0BT16-F1-model_v4 Glutathione S-transferase 0.996 58 202 GO:0016740
AF-X0UBQ8-F1-model_v4 GST N-terminal domain-containing protein 0.9889 1 194
AF-V4TF02-F1-model_v4 Glutathione S-transferase (EC 2.5.1.18) 0.9806 4 202 GO:0004364
AF-X0UBQ8-F1-model_v4 GST N-terminal domain-containing protein 0.9789 1 194

Map