F445054
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 443 | 171 | 886 | 120 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10035249|Ga0081455_100352496 |
| Length | 131 |
| Sequence | VNLVHAAIVPPVEPELRRGAATLGDLELELDEDRWRDDEDDHSGWFCVKTDPFPCPAESCTFIADYMTAAHLVLVWEERDDPNLLWHAQRAKEVGRNPHIVEYAPSFGPSASYYAWEAAGRPVHGKKKQPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 13 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 19 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 20 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 22 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 23 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 24 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 25 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 26 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 27 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 28 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 29 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 30 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 31 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 32 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 33 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 34 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 71 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 73 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 74 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 75 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 76 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 77 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 78 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 79 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 80 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 81 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 82 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 83 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 84 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 85 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 86 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 87 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 88 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 89 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 90 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 91 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 92 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 93 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 94 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 95 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 96 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 97 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 98 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 99 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 100 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 101 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 102 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 103 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 104 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 105 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 106 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 107 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 108 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 109 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 110 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 111 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 112 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 113 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 114 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 120 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 121 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 122 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 123 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 124 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 125 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 126 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 127 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 128 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 130 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 131 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 132 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 133 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 134 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 136 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 157 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 158 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 169 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 170 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.68 |
| Nodule | 0 |
| Rhizoplane | 1.13 |
| Rhizosphere | 98.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 21.9 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0081455_10035249 | 3300005937 | Bacteria | 4474 |
| 2 | JGI25407J50210_10091416 | 3300003373 | Bacteria | 753 |
| 3 | Ga0070690_100037337 | 3300005330 | Bacteria | 3061 |
| 4 | Ga0070670_100021366 | 3300005331 | Bacteria | 5569 |
| 5 | Ga0070689_100021737 | 3300005340 | Bacteria | 4781 |
| 6 | Ga0070675_100106902 | 3300005354 | Bacteria | 2362 |
| 7 | Ga0070674_100040566 | 3300005356 | Unclassified | 3150 |
| 8 | Ga0070674_100472013 | 3300005356 | Bacteria | 1040 |
| 9 | Ga0070688_100017728 | 3300005365 | Bacteria | 4091 |
| 10 | Ga0070700_100011967 | 3300005441 | Unclassified | 4821 |
| 11 | Ga0070663_100486104 | 3300005455 | Unclassified | 1023 |
| 12 | Ga0070678_100218330 | 3300005456 | Bacteria | 1584 |
| 13 | Ga0068867_100390536 | 3300005459 | Bacteria | 1171 |
| 14 | Ga0070685_10010311 | 3300005466 | Bacteria | 4852 |
| 15 | Ga0070706_101228959 | 3300005467 | Unclassified | 688 |
| 16 | Ga0070686_100031796 | 3300005544 | Bacteria | 3230 |
| 17 | Ga0070696_101088448 | 3300005546 | Unclassified | 671 |
| 18 | Ga0070664_100055280 | 3300005564 | Bacteria | 3369 |
| 19 | Ga0068857_100206672 | 3300005577 | Archaea | 1791 |
| 20 | Ga0068854_100275313 | 3300005578 | Unclassified | 1353 |
| 21 | Ga0070702_100408207 | 3300005615 | Bacteria | 974 |
| 22 | Ga0068864_100028818 | 3300005618 | Bacteria | 4697 |
| 23 | Ga0068870_10044432 | 3300005840 | Bacteria | 2321 |
| 24 | Ga0068863_100415582 | 3300005841 | Unclassified | 1317 |
| 25 | Ga0081455_10027376 | 3300005937 | Bacteria | 5224 |
| 26 | Ga0081455_10101633 | 3300005937 | Unclassified | 2307 |
| 27 | Ga0081538_10000113 | 3300005981 | Bacteria | 81440 |
| 28 | Ga0081538_10000516 | 3300005981 | Bacteria | 43216 |
| 29 | Ga0081538_10003385 | 3300005981 | Bacteria | 15090 |
| 30 | Ga0081538_10043491 | 3300005981 | Bacteria | 2819 |
| 31 | Ga0075364_10749703 | 3300006051 | Unclassified | 666 |
| 32 | Ga0075432_10556417 | 3300006058 | Unclassified | 519 |
| 33 | Ga0075427_10073091 | 3300006194 | Unclassified | 613 |
| 34 | Ga0075428_100025605 | 3300006844 | Bacteria | 6533 |
| 35 | Ga0075428_100342798 | 3300006844 | Bacteria | 1604 |
| 36 | Ga0075430_101278856 | 3300006846 | Unclassified | 603 |
| 37 | Ga0075431_100842183 | 3300006847 | Bacteria | 889 |
| 38 | Ga0075431_101768553 | 3300006847 | Unclassified | 574 |
| 39 | Ga0075429_100030176 | 3300006880 | Bacteria | 4710 |
| 40 | Ga0075429_100060321 | 3300006880 | Bacteria | 3304 |
| 41 | Ga0075436_100139120 | 3300006914 | Bacteria | 1705 |
| 42 | Ga0075435_100247466 | 3300007076 | Unclassified | 1517 |
| 43 | Ga0105244_10391354 | 3300009036 | Unclassified | 640 |
| 44 | Ga0111539_10034964 | 3300009094 | Bacteria | 6086 |
| 45 | Ga0111539_10118650 | 3300009094 | Bacteria | 3101 |
| 46 | Ga0111539_10849038 | 3300009094 | Bacteria | 1062 |
| 47 | Ga0105245_10073805 | 3300009098 | Unclassified | 3103 |
| 48 | Ga0114129_10057852 | 3300009147 | Bacteria | 5424 |
| 49 | Ga0114129_10317512 | 3300009147 | Bacteria | 2072 |
| 50 | Ga0114129_11049648 | 3300009147 | Bacteria | 1023 |
| 51 | Ga0114129_12501304 | 3300009147 | Unclassified | 617 |
| 52 | Ga0105243_10039573 | 3300009148 | Bacteria | 3676 |
| 53 | Ga0105243_10537110 | 3300009148 | Bacteria | 1115 |
| 54 | Ga0105242_10020189 | 3300009176 | Bacteria | 5223 |
| 55 | Ga0105238_11884304 | 3300009551 | Bacteria | 631 |
| 56 | Ga0105249_10947909 | 3300009553 | Archaea | 928 |
| 57 | Ga0105246_10088357 | 3300011119 | Bacteria | 2227 |
| 58 | Ga0157374_10215823 | 3300013296 | Unclassified | 1882 |
| 59 | Ga0157378_10410810 | 3300013297 | Bacteria | 1336 |
| 60 | Ga0163162_10648752 | 3300013306 | Bacteria | 1179 |
| 61 | Ga0157375_10004686 | 3300013308 | Bacteria | 11898 |
| 62 | Ga0163163_10070051 | 3300014325 | Bacteria | 3492 |
| 63 | Ga0163163_10866002 | 3300014325 | Bacteria | 967 |
| 64 | Ga0157380_10154798 | 3300014326 | Archaea | 1986 |
| 65 | Ga0157380_10377561 | 3300014326 | Unclassified | 1336 |
| 66 | Ga0157377_10013609 | 3300014745 | Unclassified | 4122 |
| 67 | Ga0157376_10552832 | 3300014969 | Bacteria | 1139 |
| 68 | Ga0207699_10719718 | 3300025906 | Bacteria | 731 |
| 69 | Ga0207645_10052308 | 3300025907 | Unclassified | 2609 |
| 70 | Ga0207643_10009768 | 3300025908 | Bacteria | 5150 |
| 71 | Ga0207681_10292092 | 3300025923 | Bacteria | 1287 |
| 72 | Ga0207644_10173051 | 3300025931 | Unclassified | 1687 |
| 73 | Ga0207690_10490560 | 3300025932 | Unclassified | 992 |
| 74 | Ga0207706_10114154 | 3300025933 | Bacteria | 2376 |
| 75 | Ga0207686_10203456 | 3300025934 | Unclassified | 1419 |
| 76 | Ga0207709_10094269 | 3300025935 | Unclassified | 1965 |
| 77 | Ga0207709_10664231 | 3300025935 | Bacteria | 831 |
| 78 | Ga0207669_10160766 | 3300025937 | Bacteria | 1586 |
| 79 | Ga0207704_10035507 | 3300025938 | Bacteria | 2857 |
| 80 | Ga0207691_10018551 | 3300025940 | Bacteria | 6594 |
| 81 | Ga0207689_10027320 | 3300025942 | Bacteria | 4778 |
| 82 | Ga0207651_10207080 | 3300025960 | Bacteria | 1576 |
| 83 | Ga0207678_10518360 | 3300026067 | Unclassified | 1040 |
| 84 | Ga0207648_10062209 | 3300026089 | Unclassified | 3255 |
| 85 | Ga0207674_10562275 | 3300026116 | Archaea | 1102 |
| 86 | Ga0207675_100066241 | 3300026118 | Unclassified | 3375 |
| 87 | Ga0207683_10024380 | 3300026121 | Bacteria | 5210 |
| 88 | Ga0207683_10328355 | 3300026121 | Bacteria | 1402 |
| 89 | Ga0207428_10004162 | 3300027907 | Bacteria | 13866 |
| 90 | Ga0268266_10352905 | 3300028379 | Unclassified | 1382 |
| 91 | Ga0265337_1030668 | 3300028556 | Bacteria | 1600 |
| 92 | Ga0265334_10021910 | 3300028573 | Bacteria | 2607 |
| 93 | Ga0265318_10005140 | 3300028577 | Bacteria | 6184 |
| 94 | Ga0265323_10052500 | 3300028653 | Unclassified | 1442 |
| 95 | Ga0265322_10008252 | 3300028654 | Bacteria | 3035 |
| 96 | Ga0265338_10112316 | 3300028800 | Bacteria | 2191 |
| 97 | Ga0265330_10004763 | 3300031235 | Bacteria | 6854 |
| 98 | Ga0265332_10032067 | 3300031238 | Bacteria | 2290 |
| 99 | Ga0265328_10002764 | 3300031239 | Bacteria | 7857 |
| 100 | Ga0265320_10255674 | 3300031240 | Bacteria | 776 |
| 101 | Ga0265325_10001447 | 3300031241 | Bacteria | 16683 |
| 102 | Ga0265329_10004723 | 3300031242 | Bacteria | 5610 |
| 103 | Ga0265340_10102797 | 3300031247 | Bacteria | 1326 |
| 104 | Ga0265339_10010714 | 3300031249 | Bacteria | 5678 |
| 105 | Ga0265331_10005895 | 3300031250 | Bacteria | 7329 |
| 106 | Ga0265327_10012512 | 3300031251 | Bacteria | 5716 |
| 107 | Ga0265316_10061197 | 3300031344 | Bacteria | 2924 |
| 108 | Ga0265313_10213034 | 3300031595 | Bacteria | 799 |
| 109 | Ga0265342_10012750 | 3300031712 | Bacteria | 5678 |
| 110 | Ga0307412_10414665 | 3300031911 | Bacteria | 1100 |
| 111 | Ga0307409_100084524 | 3300031995 | Bacteria | 2577 |
| 112 | Ga0307409_100950640 | 3300031995 | Unclassified | 875 |
| 113 | Ga0307416_100047968 | 3300032002 | Bacteria | 3385 |
| 114 | Ga0307416_100659314 | 3300032002 | Bacteria | 1132 |
| 115 | Ga0307411_10483101 | 3300032005 | Bacteria | 1044 |
| 116 | Ga0307411_10865025 | 3300032005 | Bacteria | 801 |
| 117 | Ga0307415_100054918 | 3300032126 | Bacteria | 2722 |
| 118 | Ga0373961_0328849 | 3300035241 | Unclassified | 572 |
| 119 | Ga0395900_0158224 | 3300037418 | Bacteria | 2313 |
| 120 | Ga0395901_0141940 | 3300038443 | Bacteria | 2524 |
| 121 | Ga0395901_1067530 | 3300038443 | Unclassified | 780 |
| 122 | Ga0439438_133638 | 3300041405 | Bacteria | 595 |
| 123 | Ga0439453_0071952 | 3300041408 | Unclassified | 733 |
| 124 | Ga0439453_0077979 | 3300041408 | Unclassified | 710 |
| 125 | Ga0439461_0005745 | 3300041410 | Bacteria | 2131 |
| 126 | Ga0439466_0158082 | 3300041411 | Bacteria | 693 |
| 127 | Ga0439432_031286 | 3300042006 | Bacteria | 1722 |
| 128 | Ga0439451_039851 | 3300042009 | Unclassified | 943 |
| 129 | Ga0439462_0246810 | 3300042015 | Bacteria | 513 |
| 130 | Ga0450920_001147 | 3300042122 | Bacteria | 4342 |
| 131 | Ga0450920_023618 | 3300042122 | Bacteria | 1192 |
| 132 | Ga0450923_038053 | 3300042125 | Bacteria | 1002 |
| 133 | Ga0450907_011832 | 3300042146 | Bacteria | 1449 |
| 134 | Ga0450907_015481 | 3300042146 | Unclassified | 1273 |
| 135 | Ga0450907_017800 | 3300042146 | Bacteria | 1186 |
| 136 | Ga0439446_0008141 | 3300042156 | Bacteria | 2775 |
| 137 | Ga0439446_0018224 | 3300042156 | Bacteria | 1965 |
| 138 | Ga0439446_0174047 | 3300042156 | Bacteria | 717 |
| 139 | Ga0450909_037592 | 3300042185 | Bacteria | 742 |
| 140 | Ga0439434_0030833 | 3300042435 | Bacteria | 1629 |
| 141 | Ga0439434_0062497 | 3300042435 | Bacteria | 1166 |
| 142 | Ga0439464_0119271 | 3300042439 | Unclassified | 812 |
| 143 | Ga0450918_025948 | 3300042531 | Unclassified | 1027 |
| 144 | Ga0495603_0069819 | 3300046455 | Unclassified | 2066 |
| 145 | Ga0495585_0274022 | 3300046492 | Bacteria | 836 |
| 146 | Ga0495644_0293233 | 3300046523 | Bacteria | 636 |
| 147 | Ga0495656_0287879 | 3300046615 | Unclassified | 839 |
| 148 | Ga0495656_0594659 | 3300046615 | Bacteria | 592 |
| 149 | Ga0495659_0122696 | 3300046664 | Bacteria | 1024 |
| 150 | Ga0496100_0357222 | 3300048903 | Bacteria | 1105 |
| 151 | Ga0496100_0485850 | 3300048903 | Bacteria | 950 |
| 152 | Ga0496108_0098565 | 3300048911 | Unclassified | 2491 |
| 153 | Ga0496109_0109951 | 3300048912 | Unclassified | 2562 |
| 154 | Ga0496110_0058124 | 3300048913 | Unclassified | 3406 |
| 155 | Ga0501031_0001125 | 3300049568 | Bacteria | 16264 |
| 156 | Ga0501031_0016102 | 3300049568 | Bacteria | 4855 |
| 157 | Ga0501031_0027652 | 3300049568 | Bacteria | 3697 |
| 158 | Ga0501031_0030652 | 3300049568 | Bacteria | 3509 |
| 159 | Ga0501031_0033498 | 3300049568 | Bacteria | 3351 |
| 160 | Ga0501031_0039568 | 3300049568 | Bacteria | 3077 |
| 161 | Ga0501031_0088641 | 3300049568 | Bacteria | 2017 |
| 162 | Ga0501031_0801483 | 3300049568 | Unclassified | 604 |
| 163 | Ga0501031_0872466 | 3300049568 | Unclassified | 576 |
| 164 | Ga0501032_0011785 | 3300049569 | Bacteria | 6267 |
| 165 | Ga0501032_0016186 | 3300049569 | Bacteria | 5248 |
| 166 | Ga0501032_0029391 | 3300049569 | Bacteria | 3771 |
| 167 | Ga0501033_0023404 | 3300049570 | Bacteria | 4658 |
| 168 | Ga0501033_0044772 | 3300049570 | Bacteria | 3294 |
| 169 | Ga0501033_0279626 | 3300049570 | Bacteria | 1178 |
| 170 | Ga0501034_0167792 | 3300049571 | Bacteria | 2163 |
| 171 | Ga0501036_0003552 | 3300049572 | Bacteria | 12463 |
| 172 | Ga0501036_0012790 | 3300049572 | Bacteria | 6963 |
| 173 | Ga0501036_0034146 | 3300049572 | Bacteria | 4302 |
| 174 | Ga0501036_0055879 | 3300049572 | Bacteria | 3344 |
| 175 | Ga0501036_0076214 | 3300049572 | Bacteria | 2837 |
| 176 | Ga0501036_0139757 | 3300049572 | Unclassified | 2044 |
| 177 | Ga0501036_0153583 | 3300049572 | Unclassified | 1941 |
| 178 | Ga0501036_0216556 | 3300049572 | Bacteria | 1608 |
| 179 | Ga0501036_0247054 | 3300049572 | Bacteria | 1496 |
| 180 | Ga0501037_0007959 | 3300049573 | Bacteria | 7768 |
| 181 | Ga0501037_0100894 | 3300049573 | Bacteria | 2084 |
| 182 | Ga0501037_0178606 | 3300049573 | Bacteria | 1507 |
| 183 | Ga0501038_0028645 | 3300049574 | Bacteria | 4947 |
| 184 | Ga0501038_0040368 | 3300049574 | Bacteria | 4076 |
| 185 | Ga0501038_0053457 | 3300049574 | Bacteria | 3477 |
| 186 | Ga0501038_0069042 | 3300049574 | Bacteria | 3003 |
| 187 | Ga0501038_0097293 | 3300049574 | Bacteria | 2455 |
| 188 | Ga0501038_0236859 | 3300049574 | Bacteria | 1450 |
| 189 | Ga0501038_0531132 | 3300049574 | Bacteria | 897 |
| 190 | Ga0501039_0000567 | 3300049575 | Bacteria | 26741 |
| 191 | Ga0501039_0002258 | 3300049575 | Bacteria | 14302 |
| 192 | Ga0501039_0007432 | 3300049575 | Bacteria | 8361 |
| 193 | Ga0501039_0023517 | 3300049575 | Bacteria | 4728 |
| 194 | Ga0501039_0037357 | 3300049575 | Bacteria | 3748 |
| 195 | Ga0501039_0269755 | 3300049575 | Bacteria | 1338 |
| 196 | Ga0501039_0322301 | 3300049575 | Unclassified | 1214 |
| 197 | Ga0501039_0847125 | 3300049575 | Bacteria | 712 |
| 198 | Ga0501040_0004482 | 3300049576 | Bacteria | 9069 |
| 199 | Ga0501040_0009824 | 3300049576 | Bacteria | 6246 |
| 200 | Ga0501040_0014620 | 3300049576 | Bacteria | 5176 |
| 201 | Ga0501040_0047307 | 3300049576 | Bacteria | 2938 |
| 202 | Ga0501040_0078849 | 3300049576 | Bacteria | 2279 |
| 203 | Ga0501040_0088258 | 3300049576 | Bacteria | 2153 |
| 204 | Ga0501040_0123772 | 3300049576 | Bacteria | 1815 |
| 205 | Ga0501040_0180588 | 3300049576 | Bacteria | 1496 |
| 206 | Ga0501040_0186544 | 3300049576 | Unclassified | 1471 |
| 207 | Ga0501040_0286675 | 3300049576 | Bacteria | 1176 |
| 208 | Ga0501041_0000979 | 3300049577 | Bacteria | 15588 |
| 209 | Ga0501041_0006203 | 3300049577 | Bacteria | 6988 |
| 210 | Ga0501041_0010463 | 3300049577 | Bacteria | 5467 |
| 211 | Ga0501041_0018449 | 3300049577 | Bacteria | 4156 |
| 212 | Ga0501041_0032879 | 3300049577 | Bacteria | 3135 |
| 213 | Ga0501041_0144991 | 3300049577 | Bacteria | 1481 |
| 214 | Ga0501041_0191742 | 3300049577 | Unclassified | 1280 |
| 215 | Ga0501041_0903780 | 3300049577 | Unclassified | 567 |
| 216 | Ga0501042_0002580 | 3300049578 | Bacteria | 11144 |
| 217 | Ga0501042_0006933 | 3300049578 | Bacteria | 7393 |
| 218 | Ga0501042_0009419 | 3300049578 | Bacteria | 6508 |
| 219 | Ga0501042_0016796 | 3300049578 | Bacteria | 5033 |
| 220 | Ga0501042_0035051 | 3300049578 | Bacteria | 3560 |
| 221 | Ga0501042_0137902 | 3300049578 | Bacteria | 1758 |
| 222 | Ga0501042_0170625 | 3300049578 | Unclassified | 1569 |
| 223 | Ga0501042_0218486 | 3300049578 | Bacteria | 1375 |
| 224 | Ga0501042_1413861 | 3300049578 | Bacteria | 507 |
| 225 | Ga0501043_0007925 | 3300049579 | Bacteria | 8394 |
| 226 | Ga0501043_0089426 | 3300049579 | Bacteria | 2420 |
| 227 | Ga0501043_0094870 | 3300049579 | Bacteria | 2345 |
| 228 | Ga0501043_0127988 | 3300049579 | Bacteria | 1991 |
| 229 | Ga0501046_0004391 | 3300049580 | Bacteria | 12818 |
| 230 | Ga0501046_0017756 | 3300049580 | Bacteria | 5934 |
| 231 | Ga0501046_0020366 | 3300049580 | Bacteria | 5487 |
| 232 | Ga0501046_0057951 | 3300049580 | Bacteria | 3037 |
| 233 | Ga0501046_0064260 | 3300049580 | Bacteria | 2865 |
| 234 | Ga0501046_0100754 | 3300049580 | Bacteria | 2216 |
| 235 | Ga0501046_0456326 | 3300049580 | Unclassified | 919 |
| 236 | Ga0501047_0141189 | 3300049581 | Bacteria | 2287 |
| 237 | Ga0501048_0006148 | 3300049582 | Bacteria | 9139 |
| 238 | Ga0501048_0006261 | 3300049582 | Bacteria | 9051 |
| 239 | Ga0501048_0016302 | 3300049582 | Bacteria | 5476 |
| 240 | Ga0501048_0018182 | 3300049582 | Bacteria | 5171 |
| 241 | Ga0501048_0064209 | 3300049582 | Bacteria | 2597 |
| 242 | Ga0501048_0157514 | 3300049582 | Bacteria | 1606 |
| 243 | Ga0501048_0236429 | 3300049582 | Unclassified | 1296 |
| 244 | Ga0501048_0568698 | 3300049582 | Bacteria | 813 |
| 245 | Ga0501067_0006397 | 3300049583 | Bacteria | 6525 |
| 246 | Ga0501067_0009228 | 3300049583 | Bacteria | 5462 |
| 247 | Ga0501067_0102799 | 3300049583 | Unclassified | 1587 |
| 248 | Ga0501068_0011596 | 3300049584 | Bacteria | 4978 |
| 249 | Ga0501068_0017585 | 3300049584 | Bacteria | 4137 |
| 250 | Ga0501068_0030242 | 3300049584 | Bacteria | 3211 |
| 251 | Ga0501068_0047781 | 3300049584 | Bacteria | 2582 |
| 252 | Ga0501068_0075834 | 3300049584 | Bacteria | 2057 |
| 253 | Ga0501068_0076470 | 3300049584 | Bacteria | 2049 |
| 254 | Ga0501068_0117064 | 3300049584 | Bacteria | 1660 |
| 255 | Ga0501068_0227341 | 3300049584 | Bacteria | 1186 |
| 256 | Ga0501068_0381765 | 3300049584 | Bacteria | 907 |
| 257 | Ga0501068_0472749 | 3300049584 | Bacteria | 812 |
| 258 | Ga0501069_0004571 | 3300049585 | Bacteria | 7155 |
| 259 | Ga0501069_0017011 | 3300049585 | Bacteria | 3909 |
| 260 | Ga0501069_0076763 | 3300049585 | Bacteria | 1879 |
| 261 | Ga0501069_0102016 | 3300049585 | Bacteria | 1629 |
| 262 | Ga0501069_0286725 | 3300049585 | Unclassified | 964 |
| 263 | Ga0501069_0364532 | 3300049585 | Bacteria | 853 |
| 264 | Ga0501070_0004557 | 3300049586 | Bacteria | 11886 |
| 265 | Ga0501070_0145210 | 3300049586 | Unclassified | 1958 |
| 266 | Ga0501070_0251358 | 3300049586 | Bacteria | 1446 |
| 267 | Ga0501070_0565479 | 3300049586 | Bacteria | 909 |
| 268 | Ga0501070_1295259 | 3300049586 | Unclassified | 556 |
| 269 | Ga0501071_0000103 | 3300049587 | Bacteria | 32610 |
| 270 | Ga0501071_0002253 | 3300049587 | Bacteria | 11614 |
| 271 | Ga0501071_0007048 | 3300049587 | Bacteria | 7345 |
| 272 | Ga0501071_0007629 | 3300049587 | Bacteria | 7128 |
| 273 | Ga0501071_0009996 | 3300049587 | Bacteria | 6340 |
| 274 | Ga0501071_0014285 | 3300049587 | Bacteria | 5430 |
| 275 | Ga0501071_0088703 | 3300049587 | Bacteria | 2269 |
| 276 | Ga0501071_0108802 | 3300049587 | Unclassified | 2047 |
| 277 | Ga0501071_0266999 | 3300049587 | Unclassified | 1293 |
| 278 | Ga0501071_0791498 | 3300049587 | Bacteria | 731 |
| 279 | Ga0501071_1541523 | 3300049587 | Unclassified | 513 |
| 280 | Ga0501072_0000831 | 3300049588 | Bacteria | 22737 |
| 281 | Ga0501072_0001074 | 3300049588 | Bacteria | 20312 |
| 282 | Ga0501072_0002078 | 3300049588 | Bacteria | 14897 |
| 283 | Ga0501072_0006720 | 3300049588 | Bacteria | 8743 |
| 284 | Ga0501072_0042424 | 3300049588 | Bacteria | 3573 |
| 285 | Ga0501072_0169915 | 3300049588 | Bacteria | 1740 |
| 286 | Ga0501072_0174163 | 3300049588 | Unclassified | 1717 |
| 287 | Ga0501072_0365323 | 3300049588 | Bacteria | 1145 |
| 288 | Ga0501072_0427334 | 3300049588 | Unclassified | 1050 |
| 289 | Ga0501072_0792280 | 3300049588 | Bacteria | 742 |
| 290 | Ga0501072_1059440 | 3300049588 | Bacteria | 631 |
| 291 | Ga0501073_0033619 | 3300049589 | Bacteria | 3650 |
| 292 | Ga0501073_0037977 | 3300049589 | Bacteria | 3418 |
| 293 | Ga0501073_0082023 | 3300049589 | Bacteria | 2243 |
| 294 | Ga0501073_0509613 | 3300049589 | Bacteria | 832 |
| 295 | Ga0501074_0003520 | 3300049590 | Bacteria | 11116 |
| 296 | Ga0501074_0014210 | 3300049590 | Bacteria | 5791 |
| 297 | Ga0501074_0055377 | 3300049590 | Bacteria | 2858 |
| 298 | Ga0501074_0081044 | 3300049590 | Bacteria | 2327 |
| 299 | Ga0501074_0090557 | 3300049590 | Bacteria | 2190 |
| 300 | Ga0501074_0170526 | 3300049590 | Bacteria | 1553 |
| 301 | Ga0501074_0430355 | 3300049590 | Bacteria | 936 |
| 302 | Ga0501074_0635964 | 3300049590 | Unclassified | 754 |
| 303 | Ga0501074_0837371 | 3300049590 | Unclassified | 648 |
| 304 | Ga0501074_1297156 | 3300049590 | Bacteria | 510 |
| 305 | Ga0501075_0004644 | 3300049591 | Bacteria | 9320 |
| 306 | Ga0501075_0005305 | 3300049591 | Bacteria | 8812 |
| 307 | Ga0501075_0008231 | 3300049591 | Bacteria | 7262 |
| 308 | Ga0501075_0028623 | 3300049591 | Bacteria | 4113 |
| 309 | Ga0501075_0080628 | 3300049591 | Bacteria | 2463 |
| 310 | Ga0501075_0181937 | 3300049591 | Bacteria | 1603 |
| 311 | Ga0501075_0223275 | 3300049591 | Unclassified | 1437 |
| 312 | Ga0501075_0420774 | 3300049591 | Unclassified | 1019 |
| 313 | Ga0501075_1115422 | 3300049591 | Unclassified | 599 |
| 314 | Ga0501076_0001908 | 3300049592 | Bacteria | 14228 |
| 315 | Ga0501076_0001971 | 3300049592 | Bacteria | 14012 |
| 316 | Ga0501076_0002037 | 3300049592 | Bacteria | 13834 |
| 317 | Ga0501076_0004847 | 3300049592 | Bacteria | 9606 |
| 318 | Ga0501076_0050995 | 3300049592 | Bacteria | 3274 |
| 319 | Ga0501076_0164003 | 3300049592 | Bacteria | 1811 |
| 320 | Ga0501076_0205587 | 3300049592 | Bacteria | 1608 |
| 321 | Ga0501076_0301540 | 3300049592 | Unclassified | 1313 |
| 322 | Ga0501076_0470309 | 3300049592 | Unclassified | 1035 |
| 323 | Ga0501076_0616118 | 3300049592 | Bacteria | 895 |
| 324 | Ga0501076_0745130 | 3300049592 | Unclassified | 808 |
| 325 | Ga0501077_0000531 | 3300049593 | Bacteria | 23114 |
| 326 | Ga0501077_0011250 | 3300049593 | Bacteria | 5583 |
| 327 | Ga0501077_0016185 | 3300049593 | Bacteria | 4697 |
| 328 | Ga0501077_0025064 | 3300049593 | Bacteria | 3788 |
| 329 | Ga0501077_0056633 | 3300049593 | Bacteria | 2488 |
| 330 | Ga0501077_0464037 | 3300049593 | Bacteria | 811 |
| 331 | Ga0501077_0612592 | 3300049593 | Unclassified | 699 |
| 332 | Ga0501079_0004472 | 3300049741 | Bacteria | 10372 |
| 333 | Ga0501079_0005738 | 3300049741 | Bacteria | 9276 |
| 334 | Ga0501079_0009253 | 3300049741 | Bacteria | 7463 |
| 335 | Ga0501079_0011082 | 3300049741 | Bacteria | 6876 |
| 336 | Ga0501079_0057089 | 3300049741 | Bacteria | 3012 |
| 337 | Ga0501079_0087797 | 3300049741 | Bacteria | 2407 |
| 338 | Ga0501079_0126419 | 3300049741 | Bacteria | 1989 |
| 339 | Ga0501079_0282976 | 3300049741 | Bacteria | 1297 |
| 340 | Ga0501079_0775884 | 3300049741 | Bacteria | 755 |
| 341 | Ga0501079_0980883 | 3300049741 | Unclassified | 666 |
| 342 | Ga0501079_1027615 | 3300049741 | Archaea | 649 |
| 343 | Ga0501079_1356197 | 3300049741 | Unclassified | 560 |
| 344 | Ga0501080_0025327 | 3300049742 | Bacteria | 5504 |
| 345 | Ga0501080_0034281 | 3300049742 | Bacteria | 4738 |
| 346 | Ga0501080_0052867 | 3300049742 | Bacteria | 3781 |
| 347 | Ga0501080_0077993 | 3300049742 | Bacteria | 3081 |
| 348 | Ga0501080_0093868 | 3300049742 | Bacteria | 2786 |
| 349 | Ga0501080_0263455 | 3300049742 | Bacteria | 1570 |
| 350 | Ga0501080_1108247 | 3300049742 | Unclassified | 683 |
| 351 | Ga0501081_0000330 | 3300049743 | Bacteria | 25438 |
| 352 | Ga0501081_0001505 | 3300049743 | Bacteria | 14301 |
| 353 | Ga0501081_0004178 | 3300049743 | Bacteria | 9261 |
| 354 | Ga0501081_0031455 | 3300049743 | Bacteria | 3596 |
| 355 | Ga0501081_0035229 | 3300049743 | Bacteria | 3407 |
| 356 | Ga0501081_0038155 | 3300049743 | Bacteria | 3280 |
| 357 | Ga0501081_0233716 | 3300049743 | Bacteria | 1339 |
| 358 | Ga0501081_0335373 | 3300049743 | Bacteria | 1113 |
| 359 | Ga0501081_0468681 | 3300049743 | Bacteria | 937 |
| 360 | Ga0501083_0051333 | 3300049744 | Bacteria | 2773 |
| 361 | Ga0501083_0070314 | 3300049744 | Bacteria | 2328 |
| 362 | Ga0501083_0335878 | 3300049744 | Unclassified | 982 |
| 363 | Ga0501083_0438291 | 3300049744 | Bacteria | 850 |
| 364 | Ga0501083_0517292 | 3300049744 | Unclassified | 777 |
| 365 | Ga0501035_0038914 | 3300049822 | Bacteria | 4306 |
| 366 | Ga0501035_0041623 | 3300049822 | Bacteria | 4148 |
| 367 | Ga0501035_0055926 | 3300049822 | Bacteria | 3522 |
| 368 | Ga0501035_0191488 | 3300049822 | Bacteria | 1758 |
| 369 | Ga0501035_0235827 | 3300049822 | Bacteria | 1558 |
| 370 | Ga0501035_0318449 | 3300049822 | Bacteria | 1307 |
| 371 | Ga0501035_0322646 | 3300049822 | Unclassified | 1297 |
| 372 | Ga0501035_0668360 | 3300049822 | Bacteria | 841 |
| 373 | Ga0501044_0042370 | 3300049823 | Bacteria | 4735 |
| 374 | Ga0501044_0717632 | 3300049823 | Bacteria | 884 |
| 375 | Ga0501044_0838906 | 3300049823 | Unclassified | 796 |
| 376 | Ga0501044_1121091 | 3300049823 | Unclassified | 656 |
| 377 | Ga0501045_0000404 | 3300049824 | Bacteria | 26259 |
| 378 | Ga0501045_0000824 | 3300049824 | Bacteria | 20065 |
| 379 | Ga0501045_0006073 | 3300049824 | Bacteria | 8366 |
| 380 | Ga0501045_0026675 | 3300049824 | Bacteria | 4157 |
| 381 | Ga0501045_0030448 | 3300049824 | Bacteria | 3906 |
| 382 | Ga0501045_0226727 | 3300049824 | Unclassified | 1391 |
| 383 | Ga0501045_0244766 | 3300049824 | Bacteria | 1335 |
| 384 | Ga0501045_0292564 | 3300049824 | Unclassified | 1212 |
| 385 | Ga0501045_0525296 | 3300049824 | Bacteria | 878 |
| 386 | nmdc:mga00v17_1061889_c1 | 3300050491 | Unclassified | 508 |
| 387 | nmdc:mga0yw44_332170_c1 | 3300050492 | Bacteria | 1022 |
| 388 | nmdc:mga05p37_2229300_c1 | 3300050507 | Bacteria | 507 |
| 389 | nmdc:mga05p37_75069_c1 | 3300050507 | Bacteria | 4162 |
| 390 | nmdc:mga09592_1180727_c1 | 3300050508 | Bacteria | 633 |
| 391 | nmdc:mga09592_448870_c1 | 3300050508 | Bacteria | 1113 |
| 392 | nmdc:mga09592_9111_c1 | 3300050508 | Bacteria | 8072 |
| 393 | nmdc:mga0qj67_10862_c1 | 3300050509 | Bacteria | 6811 |
| 394 | nmdc:mga0qj67_25429_c1 | 3300050509 | Bacteria | 4574 |
| 395 | nmdc:mga0qj67_368308_c1 | 3300050509 | Bacteria | 1161 |
| 396 | nmdc:mga06r32_223693_c1 | 3300050510 | Unclassified | 1870 |
| 397 | nmdc:mga06r32_547180_c1 | 3300050510 | Bacteria | 1132 |
| 398 | nmdc:mga06r32_6010_c1 | 3300050510 | Bacteria | 10922 |
| 399 | nmdc:mga08y16_115061_c1 | 3300050511 | Archaea | 2800 |
| 400 | nmdc:mga08y16_244116_c1 | 3300050511 | Unclassified | 1856 |
| 401 | nmdc:mga08y16_6966_c1 | 3300050511 | Bacteria | 11850 |
| 402 | nmdc:mga0n895_567889_c1 | 3300050512 | Unclassified | 1139 |
| 403 | nmdc:mga0rr50_1132676_c1 | 3300050513 | Bacteria | 665 |
| 404 | nmdc:mga0rr50_93045_c1 | 3300050513 | Bacteria | 2351 |
| 405 | nmdc:mga08x19_110474_c1 | 3300050514 | Bacteria | 1833 |
| 406 | Ga0495655_0180534 | 3300053083 | Unclassified | 680 |
| 407 | Ga0501084_0005300 | 3300054114 | Bacteria | 10555 |
| 408 | Ga0501084_0008644 | 3300054114 | Bacteria | 8416 |
| 409 | Ga0501084_0018506 | 3300054114 | Bacteria | 5798 |
| 410 | Ga0501084_0026068 | 3300054114 | Bacteria | 4877 |
| 411 | Ga0501084_0171444 | 3300054114 | Unclassified | 1831 |
| 412 | Ga0501084_0175389 | 3300054114 | Bacteria | 1809 |
| 413 | Ga0501084_0180972 | 3300054114 | Bacteria | 1779 |
| 414 | Ga0501084_0182922 | 3300054114 | Bacteria | 1769 |
| 415 | Ga0501084_0247610 | 3300054114 | Unclassified | 1505 |
| 416 | Ga0501084_0279815 | 3300054114 | Bacteria | 1409 |
| 417 | Ga0501084_0308955 | 3300054114 | Bacteria | 1335 |
| 418 | Ga0501084_1138297 | 3300054114 | Bacteria | 655 |
| 419 | Ga0501084_1363231 | 3300054114 | Unclassified | 594 |
| 420 | Ga0590071_107763 | 3300059421 | Unclassified | 705 |
| 421 | Ga0590077_039152 | 3300059426 | Bacteria | 1050 |
| 422 | Ga0501082_0002605 | 3300060353 | Bacteria | 15764 |
| 423 | Ga0501082_0005809 | 3300060353 | Bacteria | 10714 |
| 424 | Ga0501082_0006028 | 3300060353 | Bacteria | 10514 |
| 425 | Ga0501082_0015511 | 3300060353 | Bacteria | 6559 |
| 426 | Ga0501082_0020947 | 3300060353 | Bacteria | 5640 |
| 427 | Ga0501082_0062514 | 3300060353 | Bacteria | 3205 |
| 428 | Ga0501082_0150600 | 3300060353 | Unclassified | 2020 |
| 429 | Ga0501082_0398615 | 3300060353 | Unclassified | 1201 |
| 430 | Ga0501082_0437328 | 3300060353 | Bacteria | 1143 |
| 431 | Ga0501082_0470362 | 3300060353 | Bacteria | 1098 |
| 432 | Ga0501082_0876928 | 3300060353 | Bacteria | 785 |
| 433 | Ga0530510_0001272 | 3300061734 | Bacteria | 16837 |
| 434 | Ga0530510_0001867 | 3300061734 | Bacteria | 14406 |
| 435 | Ga0530510_0005078 | 3300061734 | Bacteria | 9079 |
| 436 | Ga0530510_0042031 | 3300061734 | Bacteria | 3301 |
| 437 | Ga0530510_0064422 | 3300061734 | Bacteria | 2654 |
| 438 | Ga0530510_0064701 | 3300061734 | Bacteria | 2648 |
| 439 | Ga0530510_0238895 | 3300061734 | Unclassified | 1352 |
| 440 | Ga0530510_0298512 | 3300061734 | Unclassified | 1205 |
| 441 | Ga0530510_0469398 | 3300061734 | Unclassified | 952 |
| 442 | Ga0530510_0571316 | 3300061734 | Bacteria | 859 |
| 443 | Ga0530510_0697661 | 3300061734 | Bacteria | 773 |
| 444 | Ga0081455_10035249 | |||
| 445 | JGI25407J50210_10091416 | |||
| 446 | Ga0070690_100037337 | |||
| 447 | Ga0070670_100021366 | |||
| 448 | Ga0070689_100021737 | |||
| 449 | Ga0070675_100106902 | |||
| 450 | Ga0070674_100040566 | |||
| 451 | Ga0070674_100472013 | |||
| 452 | Ga0070688_100017728 | |||
| 453 | Ga0070700_100011967 | |||
| 454 | Ga0070663_100486104 | |||
| 455 | Ga0070678_100218330 | |||
| 456 | Ga0068867_100390536 | |||
| 457 | Ga0070685_10010311 | |||
| 458 | Ga0070706_101228959 | |||
| 459 | Ga0070686_100031796 | |||
| 460 | Ga0070696_101088448 | |||
| 461 | Ga0070664_100055280 | |||
| 462 | Ga0068857_100206672 | |||
| 463 | Ga0068854_100275313 | |||
| 464 | Ga0070702_100408207 | |||
| 465 | Ga0068864_100028818 | |||
| 466 | Ga0068870_10044432 | |||
| 467 | Ga0068863_100415582 | |||
| 468 | Ga0081455_10027376 | |||
| 469 | Ga0081455_10101633 | |||
| 470 | Ga0081538_10000113 | |||
| 471 | Ga0081538_10000516 | |||
| 472 | Ga0081538_10003385 | |||
| 473 | Ga0081538_10043491 | |||
| 474 | Ga0075364_10749703 | |||
| 475 | Ga0075432_10556417 | |||
| 476 | Ga0075427_10073091 | |||
| 477 | Ga0075428_100025605 | |||
| 478 | Ga0075428_100342798 | |||
| 479 | Ga0075430_101278856 | |||
| 480 | Ga0075431_100842183 | |||
| 481 | Ga0075431_101768553 | |||
| 482 | Ga0075429_100030176 | |||
| 483 | Ga0075429_100060321 | |||
| 484 | Ga0075436_100139120 | |||
| 485 | Ga0075435_100247466 | |||
| 486 | Ga0105244_10391354 | |||
| 487 | Ga0111539_10034964 | |||
| 488 | Ga0111539_10118650 | |||
| 489 | Ga0111539_10849038 | |||
| 490 | Ga0105245_10073805 | |||
| 491 | Ga0114129_10057852 | |||
| 492 | Ga0114129_10317512 | |||
| 493 | Ga0114129_11049648 | |||
| 494 | Ga0114129_12501304 | |||
| 495 | Ga0105243_10039573 | |||
| 496 | Ga0105243_10537110 | |||
| 497 | Ga0105242_10020189 | |||
| 498 | Ga0105238_11884304 | |||
| 499 | Ga0105249_10947909 | |||
| 500 | Ga0105246_10088357 | |||
| 501 | Ga0157374_10215823 | |||
| 502 | Ga0157378_10410810 | |||
| 503 | Ga0163162_10648752 | |||
| 504 | Ga0157375_10004686 | |||
| 505 | Ga0163163_10070051 | |||
| 506 | Ga0163163_10866002 | |||
| 507 | Ga0157380_10154798 | |||
| 508 | Ga0157380_10377561 | |||
| 509 | Ga0157377_10013609 | |||
| 510 | Ga0157376_10552832 | |||
| 511 | Ga0207699_10719718 | |||
| 512 | Ga0207645_10052308 | |||
| 513 | Ga0207643_10009768 | |||
| 514 | Ga0207681_10292092 | |||
| 515 | Ga0207644_10173051 | |||
| 516 | Ga0207690_10490560 | |||
| 517 | Ga0207706_10114154 | |||
| 518 | Ga0207686_10203456 | |||
| 519 | Ga0207709_10094269 | |||
| 520 | Ga0207709_10664231 | |||
| 521 | Ga0207669_10160766 | |||
| 522 | Ga0207704_10035507 | |||
| 523 | Ga0207691_10018551 | |||
| 524 | Ga0207689_10027320 | |||
| 525 | Ga0207651_10207080 | |||
| 526 | Ga0207678_10518360 | |||
| 527 | Ga0207648_10062209 | |||
| 528 | Ga0207674_10562275 | |||
| 529 | Ga0207675_100066241 | |||
| 530 | Ga0207683_10024380 | |||
| 531 | Ga0207683_10328355 | |||
| 532 | Ga0207428_10004162 | |||
| 533 | Ga0268266_10352905 | |||
| 534 | Ga0265337_1030668 | |||
| 535 | Ga0265334_10021910 | |||
| 536 | Ga0265318_10005140 | |||
| 537 | Ga0265323_10052500 | |||
| 538 | Ga0265322_10008252 | |||
| 539 | Ga0265338_10112316 | |||
| 540 | Ga0265330_10004763 | |||
| 541 | Ga0265332_10032067 | |||
| 542 | Ga0265328_10002764 | |||
| 543 | Ga0265320_10255674 | |||
| 544 | Ga0265325_10001447 | |||
| 545 | Ga0265329_10004723 | |||
| 546 | Ga0265340_10102797 | |||
| 547 | Ga0265339_10010714 | |||
| 548 | Ga0265331_10005895 | |||
| 549 | Ga0265327_10012512 | |||
| 550 | Ga0265316_10061197 | |||
| 551 | Ga0265313_10213034 | |||
| 552 | Ga0265342_10012750 | |||
| 553 | Ga0307412_10414665 | |||
| 554 | Ga0307409_100084524 | |||
| 555 | Ga0307409_100950640 | |||
| 556 | Ga0307416_100047968 | |||
| 557 | Ga0307416_100659314 | |||
| 558 | Ga0307411_10483101 | |||
| 559 | Ga0307411_10865025 | |||
| 560 | Ga0307415_100054918 | |||
| 561 | Ga0373961_0328849 | |||
| 562 | Ga0395900_0158224 | |||
| 563 | Ga0395901_0141940 | |||
| 564 | Ga0395901_1067530 | |||
| 565 | Ga0439438_133638 | |||
| 566 | Ga0439453_0071952 | |||
| 567 | Ga0439453_0077979 | |||
| 568 | Ga0439461_0005745 | |||
| 569 | Ga0439466_0158082 | |||
| 570 | Ga0439432_031286 | |||
| 571 | Ga0439451_039851 | |||
| 572 | Ga0439462_0246810 | |||
| 573 | Ga0450920_001147 | |||
| 574 | Ga0450920_023618 | |||
| 575 | Ga0450923_038053 | |||
| 576 | Ga0450907_011832 | |||
| 577 | Ga0450907_015481 | |||
| 578 | Ga0450907_017800 | |||
| 579 | Ga0439446_0008141 | |||
| 580 | Ga0439446_0018224 | |||
| 581 | Ga0439446_0174047 | |||
| 582 | Ga0450909_037592 | |||
| 583 | Ga0439434_0030833 | |||
| 584 | Ga0439434_0062497 | |||
| 585 | Ga0439464_0119271 | |||
| 586 | Ga0450918_025948 | |||
| 587 | Ga0495603_0069819 | |||
| 588 | Ga0495585_0274022 | |||
| 589 | Ga0495644_0293233 | |||
| 590 | Ga0495656_0287879 | |||
| 591 | Ga0495656_0594659 | |||
| 592 | Ga0495659_0122696 | |||
| 593 | Ga0496100_0357222 | |||
| 594 | Ga0496100_0485850 | |||
| 595 | Ga0496108_0098565 | |||
| 596 | Ga0496109_0109951 | |||
| 597 | Ga0496110_0058124 | |||
| 598 | Ga0501031_0001125 | |||
| 599 | Ga0501031_0016102 | |||
| 600 | Ga0501031_0027652 | |||
| 601 | Ga0501031_0030652 | |||
| 602 | Ga0501031_0033498 | |||
| 603 | Ga0501031_0039568 | |||
| 604 | Ga0501031_0088641 | |||
| 605 | Ga0501031_0801483 | |||
| 606 | Ga0501031_0872466 | |||
| 607 | Ga0501032_0011785 | |||
| 608 | Ga0501032_0016186 | |||
| 609 | Ga0501032_0029391 | |||
| 610 | Ga0501033_0023404 | |||
| 611 | Ga0501033_0044772 | |||
| 612 | Ga0501033_0279626 | |||
| 613 | Ga0501034_0167792 | |||
| 614 | Ga0501036_0003552 | |||
| 615 | Ga0501036_0012790 | |||
| 616 | Ga0501036_0034146 | |||
| 617 | Ga0501036_0055879 | |||
| 618 | Ga0501036_0076214 | |||
| 619 | Ga0501036_0139757 | |||
| 620 | Ga0501036_0153583 | |||
| 621 | Ga0501036_0216556 | |||
| 622 | Ga0501036_0247054 | |||
| 623 | Ga0501037_0007959 | |||
| 624 | Ga0501037_0100894 | |||
| 625 | Ga0501037_0178606 | |||
| 626 | Ga0501038_0028645 | |||
| 627 | Ga0501038_0040368 | |||
| 628 | Ga0501038_0053457 | |||
| 629 | Ga0501038_0069042 | |||
| 630 | Ga0501038_0097293 | |||
| 631 | Ga0501038_0236859 | |||
| 632 | Ga0501038_0531132 | |||
| 633 | Ga0501039_0000567 | |||
| 634 | Ga0501039_0002258 | |||
| 635 | Ga0501039_0007432 | |||
| 636 | Ga0501039_0023517 | |||
| 637 | Ga0501039_0037357 | |||
| 638 | Ga0501039_0269755 | |||
| 639 | Ga0501039_0322301 | |||
| 640 | Ga0501039_0847125 | |||
| 641 | Ga0501040_0004482 | |||
| 642 | Ga0501040_0009824 | |||
| 643 | Ga0501040_0014620 | |||
| 644 | Ga0501040_0047307 | |||
| 645 | Ga0501040_0078849 | |||
| 646 | Ga0501040_0088258 | |||
| 647 | Ga0501040_0123772 | |||
| 648 | Ga0501040_0180588 | |||
| 649 | Ga0501040_0186544 | |||
| 650 | Ga0501040_0286675 | |||
| 651 | Ga0501041_0000979 | |||
| 652 | Ga0501041_0006203 | |||
| 653 | Ga0501041_0010463 | |||
| 654 | Ga0501041_0018449 | |||
| 655 | Ga0501041_0032879 | |||
| 656 | Ga0501041_0144991 | |||
| 657 | Ga0501041_0191742 | |||
| 658 | Ga0501041_0903780 | |||
| 659 | Ga0501042_0002580 | |||
| 660 | Ga0501042_0006933 | |||
| 661 | Ga0501042_0009419 | |||
| 662 | Ga0501042_0016796 | |||
| 663 | Ga0501042_0035051 | |||
| 664 | Ga0501042_0137902 | |||
| 665 | Ga0501042_0170625 | |||
| 666 | Ga0501042_0218486 | |||
| 667 | Ga0501042_1413861 | |||
| 668 | Ga0501043_0007925 | |||
| 669 | Ga0501043_0089426 | |||
| 670 | Ga0501043_0094870 | |||
| 671 | Ga0501043_0127988 | |||
| 672 | Ga0501046_0004391 | |||
| 673 | Ga0501046_0017756 | |||
| 674 | Ga0501046_0020366 | |||
| 675 | Ga0501046_0057951 | |||
| 676 | Ga0501046_0064260 | |||
| 677 | Ga0501046_0100754 | |||
| 678 | Ga0501046_0456326 | |||
| 679 | Ga0501047_0141189 | |||
| 680 | Ga0501048_0006148 | |||
| 681 | Ga0501048_0006261 | |||
| 682 | Ga0501048_0016302 | |||
| 683 | Ga0501048_0018182 | |||
| 684 | Ga0501048_0064209 | |||
| 685 | Ga0501048_0157514 | |||
| 686 | Ga0501048_0236429 | |||
| 687 | Ga0501048_0568698 | |||
| 688 | Ga0501067_0006397 | |||
| 689 | Ga0501067_0009228 | |||
| 690 | Ga0501067_0102799 | |||
| 691 | Ga0501068_0011596 | |||
| 692 | Ga0501068_0017585 | |||
| 693 | Ga0501068_0030242 | |||
| 694 | Ga0501068_0047781 | |||
| 695 | Ga0501068_0075834 | |||
| 696 | Ga0501068_0076470 | |||
| 697 | Ga0501068_0117064 | |||
| 698 | Ga0501068_0227341 | |||
| 699 | Ga0501068_0381765 | |||
| 700 | Ga0501068_0472749 | |||
| 701 | Ga0501069_0004571 | |||
| 702 | Ga0501069_0017011 | |||
| 703 | Ga0501069_0076763 | |||
| 704 | Ga0501069_0102016 | |||
| 705 | Ga0501069_0286725 | |||
| 706 | Ga0501069_0364532 | |||
| 707 | Ga0501070_0004557 | |||
| 708 | Ga0501070_0145210 | |||
| 709 | Ga0501070_0251358 | |||
| 710 | Ga0501070_0565479 | |||
| 711 | Ga0501070_1295259 | |||
| 712 | Ga0501071_0000103 | |||
| 713 | Ga0501071_0002253 | |||
| 714 | Ga0501071_0007048 | |||
| 715 | Ga0501071_0007629 | |||
| 716 | Ga0501071_0009996 | |||
| 717 | Ga0501071_0014285 | |||
| 718 | Ga0501071_0088703 | |||
| 719 | Ga0501071_0108802 | |||
| 720 | Ga0501071_0266999 | |||
| 721 | Ga0501071_0791498 | |||
| 722 | Ga0501071_1541523 | |||
| 723 | Ga0501072_0000831 | |||
| 724 | Ga0501072_0001074 | |||
| 725 | Ga0501072_0002078 | |||
| 726 | Ga0501072_0006720 | |||
| 727 | Ga0501072_0042424 | |||
| 728 | Ga0501072_0169915 | |||
| 729 | Ga0501072_0174163 | |||
| 730 | Ga0501072_0365323 | |||
| 731 | Ga0501072_0427334 | |||
| 732 | Ga0501072_0792280 | |||
| 733 | Ga0501072_1059440 | |||
| 734 | Ga0501073_0033619 | |||
| 735 | Ga0501073_0037977 | |||
| 736 | Ga0501073_0082023 | |||
| 737 | Ga0501073_0509613 | |||
| 738 | Ga0501074_0003520 | |||
| 739 | Ga0501074_0014210 | |||
| 740 | Ga0501074_0055377 | |||
| 741 | Ga0501074_0081044 | |||
| 742 | Ga0501074_0090557 | |||
| 743 | Ga0501074_0170526 | |||
| 744 | Ga0501074_0430355 | |||
| 745 | Ga0501074_0635964 | |||
| 746 | Ga0501074_0837371 | |||
| 747 | Ga0501074_1297156 | |||
| 748 | Ga0501075_0004644 | |||
| 749 | Ga0501075_0005305 | |||
| 750 | Ga0501075_0008231 | |||
| 751 | Ga0501075_0028623 | |||
| 752 | Ga0501075_0080628 | |||
| 753 | Ga0501075_0181937 | |||
| 754 | Ga0501075_0223275 | |||
| 755 | Ga0501075_0420774 | |||
| 756 | Ga0501075_1115422 | |||
| 757 | Ga0501076_0001908 | |||
| 758 | Ga0501076_0001971 | |||
| 759 | Ga0501076_0002037 | |||
| 760 | Ga0501076_0004847 | |||
| 761 | Ga0501076_0050995 | |||
| 762 | Ga0501076_0164003 | |||
| 763 | Ga0501076_0205587 | |||
| 764 | Ga0501076_0301540 | |||
| 765 | Ga0501076_0470309 | |||
| 766 | Ga0501076_0616118 | |||
| 767 | Ga0501076_0745130 | |||
| 768 | Ga0501077_0000531 | |||
| 769 | Ga0501077_0011250 | |||
| 770 | Ga0501077_0016185 | |||
| 771 | Ga0501077_0025064 | |||
| 772 | Ga0501077_0056633 | |||
| 773 | Ga0501077_0464037 | |||
| 774 | Ga0501077_0612592 | |||
| 775 | Ga0501079_0004472 | |||
| 776 | Ga0501079_0005738 | |||
| 777 | Ga0501079_0009253 | |||
| 778 | Ga0501079_0011082 | |||
| 779 | Ga0501079_0057089 | |||
| 780 | Ga0501079_0087797 | |||
| 781 | Ga0501079_0126419 | |||
| 782 | Ga0501079_0282976 | |||
| 783 | Ga0501079_0775884 | |||
| 784 | Ga0501079_0980883 | |||
| 785 | Ga0501079_1027615 | |||
| 786 | Ga0501079_1356197 | |||
| 787 | Ga0501080_0025327 | |||
| 788 | Ga0501080_0034281 | |||
| 789 | Ga0501080_0052867 | |||
| 790 | Ga0501080_0077993 | |||
| 791 | Ga0501080_0093868 | |||
| 792 | Ga0501080_0263455 | |||
| 793 | Ga0501080_1108247 | |||
| 794 | Ga0501081_0000330 | |||
| 795 | Ga0501081_0001505 | |||
| 796 | Ga0501081_0004178 | |||
| 797 | Ga0501081_0031455 | |||
| 798 | Ga0501081_0035229 | |||
| 799 | Ga0501081_0038155 | |||
| 800 | Ga0501081_0233716 | |||
| 801 | Ga0501081_0335373 | |||
| 802 | Ga0501081_0468681 | |||
| 803 | Ga0501083_0051333 | |||
| 804 | Ga0501083_0070314 | |||
| 805 | Ga0501083_0335878 | |||
| 806 | Ga0501083_0438291 | |||
| 807 | Ga0501083_0517292 | |||
| 808 | Ga0501035_0038914 | |||
| 809 | Ga0501035_0041623 | |||
| 810 | Ga0501035_0055926 | |||
| 811 | Ga0501035_0191488 | |||
| 812 | Ga0501035_0235827 | |||
| 813 | Ga0501035_0318449 | |||
| 814 | Ga0501035_0322646 | |||
| 815 | Ga0501035_0668360 | |||
| 816 | Ga0501044_0042370 | |||
| 817 | Ga0501044_0717632 | |||
| 818 | Ga0501044_0838906 | |||
| 819 | Ga0501044_1121091 | |||
| 820 | Ga0501045_0000404 | |||
| 821 | Ga0501045_0000824 | |||
| 822 | Ga0501045_0006073 | |||
| 823 | Ga0501045_0026675 | |||
| 824 | Ga0501045_0030448 | |||
| 825 | Ga0501045_0226727 | |||
| 826 | Ga0501045_0244766 | |||
| 827 | Ga0501045_0292564 | |||
| 828 | Ga0501045_0525296 | |||
| 829 | nmdc:mga00v17_1061889_c1 | |||
| 830 | nmdc:mga0yw44_332170_c1 | |||
| 831 | nmdc:mga05p37_2229300_c1 | |||
| 832 | nmdc:mga05p37_75069_c1 | |||
| 833 | nmdc:mga09592_1180727_c1 | |||
| 834 | nmdc:mga09592_448870_c1 | |||
| 835 | nmdc:mga09592_9111_c1 | |||
| 836 | nmdc:mga0qj67_10862_c1 | |||
| 837 | nmdc:mga0qj67_25429_c1 | |||
| 838 | nmdc:mga0qj67_368308_c1 | |||
| 839 | nmdc:mga06r32_223693_c1 | |||
| 840 | nmdc:mga06r32_547180_c1 | |||
| 841 | nmdc:mga06r32_6010_c1 | |||
| 842 | nmdc:mga08y16_115061_c1 | |||
| 843 | nmdc:mga08y16_244116_c1 | |||
| 844 | nmdc:mga08y16_6966_c1 | |||
| 845 | nmdc:mga0n895_567889_c1 | |||
| 846 | nmdc:mga0rr50_1132676_c1 | |||
| 847 | nmdc:mga0rr50_93045_c1 | |||
| 848 | nmdc:mga08x19_110474_c1 | |||
| 849 | Ga0495655_0180534 | |||
| 850 | Ga0501084_0005300 | |||
| 851 | Ga0501084_0008644 | |||
| 852 | Ga0501084_0018506 | |||
| 853 | Ga0501084_0026068 | |||
| 854 | Ga0501084_0171444 | |||
| 855 | Ga0501084_0175389 | |||
| 856 | Ga0501084_0180972 | |||
| 857 | Ga0501084_0182922 | |||
| 858 | Ga0501084_0247610 | |||
| 859 | Ga0501084_0279815 | |||
| 860 | Ga0501084_0308955 | |||
| 861 | Ga0501084_1138297 | |||
| 862 | Ga0501084_1363231 | |||
| 863 | Ga0590071_107763 | |||
| 864 | Ga0590077_039152 | |||
| 865 | Ga0501082_0002605 | |||
| 866 | Ga0501082_0005809 | |||
| 867 | Ga0501082_0006028 | |||
| 868 | Ga0501082_0015511 | |||
| 869 | Ga0501082_0020947 | |||
| 870 | Ga0501082_0062514 | |||
| 871 | Ga0501082_0150600 | |||
| 872 | Ga0501082_0398615 | |||
| 873 | Ga0501082_0437328 | |||
| 874 | Ga0501082_0470362 | |||
| 875 | Ga0501082_0876928 | |||
| 876 | Ga0530510_0001272 | |||
| 877 | Ga0530510_0001867 | |||
| 878 | Ga0530510_0005078 | |||
| 879 | Ga0530510_0042031 | |||
| 880 | Ga0530510_0064422 | |||
| 881 | Ga0530510_0064701 | |||
| 882 | Ga0530510_0238895 | |||
| 883 | Ga0530510_0298512 | |||
| 884 | Ga0530510_0469398 | |||
| 885 | Ga0530510_0571316 | |||
| 886 | Ga0530510_0697661 |