F444991

General Info

Members Datasets Scaffolds Average Seq Length
442 288 392 474

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221557|2643809445
Length 524
Sequence PDILLHIDGAWRPARSGKTIPVIDPANEETIGQVAWAEVEDLNEALAAAEKGFKTWRATSAFDRAQVMRXAAALLRERAGDIAFLMTREQGXPLAQSKGEILGAADIIEWFAEEGKRAYGQIIPPRAPDVTQMTVKLPVGPVAAFTPWNFPINQVVRKLSAALTTGCSIIVKAPEETPASPAXLIRCFVDAGLPAGVVNLVYGVPSVISEYLIAHPVIRKMSFTGSTPVGKMLAALAGQHMKRATMELGGHAPVIVTDDADVERAVAIMSASKYRNAGQVCVSPTRFLVQERVADQFLDGFVAASKTIKVGNGLEAGVDMGPLANERRIPAIESLVADALEHGARLATGGHRIGNRGYFFEPTVLADVPLSARIMNDEPFGPVSIINRFHDLDEAINEANRLPFGLAAYAFTGSERSAHRLASEVESGMISINHLGLALPEVPFGGIKDSGYGTEGGARNFDGLLQSDIESSEVESGMISINHLGLALPEVPFGGIKDSGYGTEGGSEAIEAYLETRFVTRKSV

Samples

Sample ID Description Type Environment
1 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
2 2506520008 Serratia plymuthica AS12 Isolate Unclassified
3 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
4 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
5 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
6 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
7 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
8 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
9 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
10 2643221557 Ensifer sp. Root558 Isolate Unclassified
11 2643221610 Ensifer sp. Root74 Isolate Unclassified
12 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
13 2643221668 Ensifer sp. Root423 Isolate Unclassified
14 2643221723 Ensifer sp. Root278 Isolate Unclassified
15 2643221726 Ensifer sp. Root954 Isolate Unclassified
16 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
17 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
18 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
19 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
20 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
21 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
22 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
23 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
24 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
25 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
26 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
27 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
28 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
29 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
30 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
31 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
32 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
33 2857553236 Duganella sp. R-74557 Isolate Unclassified
34 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
35 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
36 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
37 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
38 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
39 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
40 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
41 2937967321 Serratia sp. YC16 Isolate Unclassified
42 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
43 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
44 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
45 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
46 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
47 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
49 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
50 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
51 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
52 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
53 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
54 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
55 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
56 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
57 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
58 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
59 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
60 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
61 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
62 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
63 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
64 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
65 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
66 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
67 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
68 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
69 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
70 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
71 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
93 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
116 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
117 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
123 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
124 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
126 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
133 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
139 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
175 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
176 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
177 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
182 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
183 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
195 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
196 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
197 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
198 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
199 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
202 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
203 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
204 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
205 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
206 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
207 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
208 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
209 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
210 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
211 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
212 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
213 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
214 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
215 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
216 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
217 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
218 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
221 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
222 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
223 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
224 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
225 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
226 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
227 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
228 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
229 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
232 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
233 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
234 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
235 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
236 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
248 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
249 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
250 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
251 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
252 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
253 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
254 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
255 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
256 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
257 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
258 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
259 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
269 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
270 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
271 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
272 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
273 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
274 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
275 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
278 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
279 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
280 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
281 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
282 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
283 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
284 640753048 Serratia proteamaculans 568 Isolate Endosphere
285 8004592986 Serratia sp. S119 Isolate Unclassified
286 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
287 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
288 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.24
Metatranscriptomes 0.68
Isolates 11.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.76
Nodule 1.13
Rhizoplane 3.62
Rhizosphere 66.06
Stem 0
Stem Tuber 0
Unclassified 17.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000052 3300002987 Bacteria 57175
2 JGI25151J46595_10005788 3300003187 Bacteria 6328
3 JGI25406J46586_10002618 3300003203 Bacteria 8483
4 JGI25406J46586_10005826 3300003203 Bacteria 5703
5 JGI25160J50197_1000007 3300003354 Bacteria 316012
6 JGI25161J50226_1000648 3300003374 Bacteria 13978
7 Ga0055532_1000109 3300003758 Bacteria 88155
8 Ga0055532_1001270 3300003758 Bacteria 7348
9 Ga0055527_1000067 3300003760 Bacteria 88167
10 Ga0055527_1000511 3300003760 Bacteria 13489
11 Ga0055535_1000111 3300003761 Bacteria 88167
12 Ga0055535_1000251 3300003761 Bacteria 56744
13 Ga0055542_1000280 3300003762 Bacteria 57147
14 Ga0055542_1000915 3300003762 Bacteria 19764
15 Ga0055529_1000213 3300003763 Bacteria 76328
16 Ga0055526_1001100 3300003771 Bacteria 19639
17 Ga0055536_1000836 3300003781 Bacteria 20308
18 Ga0055528_1004501 3300003790 Bacteria 6699
19 Ga0055531_10008290 3300003794 Bacteria 5517
20 Ga0055543_1000120 3300004625 Bacteria 66419
21 Ga0065165_1000011 3300005262 Bacteria 316465
22 Ga0065712_10073803 3300005290 Bacteria 4274
23 Ga0070683_100031856 3300005329 Bacteria 4797
24 Ga0070683_100074995 3300005329 Bacteria 3160
25 Ga0070680_100190071 3300005336 Bacteria 1730
26 Ga0068868_100084405 3300005338 Bacteria 2551
27 Ga0070660_100110433 3300005339 Bacteria 2187
28 Ga0070668_100015120 3300005347 Bacteria 5767
29 Ga0070667_100002531 3300005367 Bacteria 15931
30 Ga0070667_100006240 3300005367 Bacteria 9916
31 Ga0070710_10028706 3300005437 Bacteria 2978
32 Ga0070700_100041318 3300005441 Bacteria 2826
33 Ga0070681_10027279 3300005458 Bacteria 5742
34 Ga0070681_10036528 3300005458 Bacteria 4934
35 Ga0070681_10091413 3300005458 Bacteria 2994
36 Ga0068867_100074299 3300005459 Bacteria 2548
37 Ga0070665_100014355 3300005548 Bacteria 7952
38 Ga0070665_100055950 3300005548 Bacteria 3956
39 Ga0070665_100255033 3300005548 Bacteria 1755
40 Ga0068855_100002309 3300005563 Bacteria 23581
41 Ga0068855_100178461 3300005563 Bacteria 2402
42 Ga0068857_100036064 3300005577 Bacteria 4382
43 Ga0068857_100044846 3300005577 Bacteria 3922
44 Ga0068852_100248322 3300005616 Bacteria 1704
45 Ga0068859_100148272 3300005617 Bacteria 2421
46 Ga0068866_10004128 3300005718 Bacteria 5954
47 Ga0068863_100003466 3300005841 Bacteria 15562
48 Ga0068858_100004898 3300005842 Bacteria 13122
49 Ga0068858_100030705 3300005842 Bacteria 4990
50 Ga0068860_100005443 3300005843 Bacteria 12906
51 Ga0068860_100005821 3300005843 Bacteria 12411
52 Ga0081455_10000599 3300005937 Bacteria 46691
53 Ga0081539_10000054 3300005985 Bacteria 259053
54 Ga0081539_10004557 3300005985 Bacteria 15176
55 Ga0070717_10031347 3300006028 Bacteria 4276
56 Ga0075363_100001621 3300006048 Bacteria 8663
57 Ga0075362_10000299 3300006177 Bacteria 14081
58 Ga0075366_10042250 3300006195 Bacteria 2699
59 Ga0075370_10005082 3300006353 Bacteria 6485
60 Ga0068871_100005572 3300006358 Bacteria 8826
61 Ga0068871_100085585 3300006358 Bacteria 2618
62 Ga0097620_100148274 3300006931 Bacteria 2421
63 Ga0079104_1001435 3300006946 Bacteria 15995
64 Ga0105251_10000026 3300009011 Bacteria 132136
65 Ga0105251_10000359 3300009011 Bacteria 44796
66 Ga0105251_10000769 3300009011 Bacteria 29167
67 Ga0105251_10002312 3300009011 Bacteria 15110
68 Ga0105251_10003795 3300009011 Bacteria 10780
69 Ga0105244_10000436 3300009036 Bacteria 38460
70 Ga0105250_10000249 3300009092 Bacteria 44567
71 Ga0105240_10000121 3300009093 Bacteria 163057
72 Ga0105240_10000467 3300009093 Bacteria 74631
73 Ga0105240_10004083 3300009093 Bacteria 22457
74 Ga0105240_10100510 3300009093 Bacteria 3519
75 Ga0105240_10182286 3300009093 Bacteria 2477
76 Ga0105245_10033401 3300009098 Bacteria 4560
77 Ga0105245_10044708 3300009098 Bacteria 3954
78 Ga0105245_10125906 3300009098 Bacteria 2399
79 Ga0105247_10000068 3300009101 Bacteria 118542
80 Ga0105247_10073738 3300009101 Bacteria 2139
81 Ga0105243_10001253 3300009148 Bacteria 22813
82 Ga0105241_10000002 3300009174 Bacteria 869480
83 Ga0105242_10017301 3300009176 Bacteria 5615
84 Ga0105237_10022600 3300009545 Bacteria 6451
85 Ga0105237_10025860 3300009545 Bacteria 6002
86 Ga0105237_10039572 3300009545 Bacteria 4759
87 Ga0105237_10046180 3300009545 Bacteria 4382
88 Ga0105237_10051536 3300009545 Bacteria 4134
89 Ga0105238_10003805 3300009551 Bacteria 14992
90 Ga0105238_10011316 3300009551 Bacteria 8976
91 Ga0105238_10046523 3300009551 Bacteria 4378
92 Ga0105249_10013179 3300009553 Bacteria 7295
93 Ga0105239_10000031 3300010375 Bacteria 226947
94 Ga0105239_10033476 3300010375 Bacteria 5644
95 Ga0105246_10013530 3300011119 Bacteria 5118
96 Ga0157370_10001383 3300013104 Bacteria 30012
97 Ga0157369_10327028 3300013105 Bacteria 1593
98 Ga0171463_1002 3300013249 Bacteria 1274851
99 Ga0157374_10023891 3300013296 Bacteria 5474
100 Ga0157378_10072059 3300013297 Bacteria 3104
101 Ga0163162_10023600 3300013306 Bacteria 6073
102 Ga0163162_10263506 3300013306 Bacteria 1855
103 Ga0157375_10025574 3300013308 Bacteria 5488
104 Ga0163163_10000004 3300014325 Bacteria 416569
105 Ga0163163_10147575 3300014325 Bacteria 2396
106 Ga0182008_10016316 3300014497 Bacteria 3860
107 Ga0157379_10005578 3300014968 Bacteria 10814
108 Ga0157379_10116465 3300014968 Bacteria 2403
109 Ga0182007_10007112 3300015262 Bacteria 4733
110 Ga0182005_1009298 3300015265 Bacteria 2863
111 Ga0183363_1106 3300015690 Bacteria 23641
112 Ga0163161_10000001 3300017792 Bacteria 2041488
113 Ga0206352_10172908 3300020078 Bacteria 1878
114 Ga0206350_11415802 3300020080 Bacteria 2136
115 Ga0213876_10006572 3300021384 Bacteria 6338
116 Ga0213876_10025357 3300021384 Bacteria 3128
117 Ga0213875_10001471 3300021388 Bacteria 15219
118 Ga0213875_10014952 3300021388 Bacteria 3780
119 Ga0213871_10002240 3300021441 Bacteria 3520
120 Ga0224712_10026644 3300022467 Bacteria 2046
121 Ga0209436_101116 3300025208 Bacteria 9953
122 Ga0209672_100044 3300025228 Bacteria 270292
123 Ga0209672_100059 3300025228 Bacteria 209692
124 Ga0209147_100039 3300025229 Bacteria 311101
125 Ga0209147_100072 3300025229 Bacteria 209692
126 Ga0209258_100062 3300025242 Bacteria 311101
127 Ga0209258_100102 3300025242 Bacteria 209692
128 Ga0209148_1000075 3300025254 Bacteria 311101
129 Ga0209148_1000294 3300025254 Bacteria 74722
130 Ga0209455_1000067 3300025272 Bacteria 311101
131 Ga0209455_1000176 3300025272 Bacteria 107090
132 Ga0209673_1000044 3300025273 Bacteria 290647
133 Ga0209130_1000033 3300025284 Bacteria 316064
134 Ga0209676_1000605 3300025292 Bacteria 52680
135 Ga0209025_1000032 3300025294 Bacteria 416141
136 Ga0209025_1030453 3300025294 Bacteria 2584
137 Ga0209564_1000079 3300025295 Bacteria 266525
138 Ga0209564_1003335 3300025295 Bacteria 11147
139 Ga0209050_1001253 3300025298 Bacteria 29284
140 Ga0209256_1000950 3300025299 Bacteria 35138
141 Ga0207426_1000078 3300025302 Bacteria 316064
142 Ga0209051_1001365 3300025303 Bacteria 21092
143 Ga0209257_1001700 3300025304 Bacteria 24721
144 Ga0207696_1000001 3300025711 Bacteria 2579611
145 Ga0207655_1000064 3300025728 Bacteria 255782
146 Ga0207713_1000008 3300025735 Bacteria 553952
147 Ga0207713_1000039 3300025735 Bacteria 247140
148 Ga0207713_1000063 3300025735 Bacteria 202247
149 Ga0207713_1002101 3300025735 Bacteria 14859
150 Ga0207710_10000327 3300025900 Bacteria 36284
151 Ga0207680_10003115 3300025903 Bacteria 7789
152 Ga0207654_10000005 3300025911 Bacteria 869492
153 Ga0207707_10012994 3300025912 Bacteria 7250
154 Ga0207707_10041594 3300025912 Bacteria 4012
155 Ga0207695_10000006 3300025913 Bacteria 1135309
156 Ga0207695_10015209 3300025913 Bacteria 9074
157 Ga0207695_10050661 3300025913 Bacteria 4366
158 Ga0207671_10018991 3300025914 Bacteria 5266
159 Ga0207693_10243199 3300025915 Bacteria 1413
160 Ga0207681_10005941 3300025923 Bacteria 7484
161 Ga0207694_10029155 3300025924 Bacteria 4209
162 Ga0207694_10035058 3300025924 Bacteria 3848
163 Ga0207687_10020185 3300025927 Bacteria 4419
164 Ga0207664_10014366 3300025929 Bacteria 5716
165 Ga0207706_10066705 3300025933 Bacteria 3167
166 Ga0207686_10087695 3300025934 Bacteria 2047
167 Ga0207704_10017372 3300025938 Bacteria 3727
168 Ga0207711_10028753 3300025941 Bacteria 4682
169 Ga0207661_10057312 3300025944 Bacteria 3132
170 Ga0207667_10260771 3300025949 Bacteria 1772
171 Ga0207712_10018796 3300025961 Bacteria 4506
172 Ga0207668_10013103 3300025972 Bacteria 5096
173 Ga0207658_10005127 3300025986 Bacteria 9022
174 Ga0207677_10059730 3300026023 Bacteria 2631
175 Ga0207703_10007902 3300026035 Bacteria 8412
176 Ga0207703_10088321 3300026035 Bacteria 2601
177 Ga0207678_10037613 3300026067 Bacteria 4208
178 Ga0207708_10041890 3300026075 Bacteria 3491
179 Ga0207641_10012091 3300026088 Bacteria 7079
180 Ga0207648_10007548 3300026089 Bacteria 10671
181 Ga0207674_10007661 3300026116 Bacteria 12570
182 Ga0209281_1000003 3300027111 Bacteria 1260089
183 Ga0268266_10033176 3300028379 Bacteria 4391
184 Ga0268266_10049320 3300028379 Bacteria 3611
185 Ga0268264_10004057 3300028381 Bacteria 12533
186 Ga0268264_10009494 3300028381 Bacteria 8057
187 Ga0265334_10022585 3300028573 Bacteria 2562
188 Ga0265338_10000092 3300028800 Bacteria 168538
189 Ga0265338_10011729 3300028800 Bacteria 10085
190 Ga0265338_10024136 3300028800 Bacteria 6223
191 Ga0265331_10001322 3300031250 Bacteria 18353
192 Ga0307509_10003945 3300031507 Bacteria 21884
193 Ga0265314_10001995 3300031711 Bacteria 21647
194 Ga0307516_10067296 3300031730 Bacteria 3452
195 Ga0307412_10060415 3300031911 Bacteria 2544
196 Ga0307507_10041239 3300033179 Bacteria 4623
197 Ga0307510_10000002 3300033180 Bacteria 801565
198 Ga0307510_10019461 3300033180 Bacteria 7965
199 Ga0373923_0011344 3300035111 Bacteria 3266
200 Ga0373943_0057555 3300035170 Bacteria 1932
201 Ga0373937_0000443 3300036401 Bacteria 38365
202 Ga0373937_0107686 3300036401 Bacteria 2591
203 Ga0373925_0039584 3300037068 Bacteria 3487
204 Ga0395899_0000114 3300037312 Bacteria 134621
205 Ga0395900_0000246 3300037418 Bacteria 85104
206 Ga0395898_0000447 3300037466 Bacteria 85103
207 Ga0395898_0254280 3300037466 Bacteria 1675
208 Ga0395905_0000228 3300037471 Bacteria 85103
209 Ga0436364_0074297 3300037853 Bacteria 14513
210 Ga0436364_0083681 3300037853 Unclassified 3099
211 Ga0436364_0238403 3300037853 Bacteria 10667
212 Ga0436364_0343587 3300037853 Bacteria 58472
213 Ga0436364_0519232 3300037853 Bacteria 78366
214 Ga0436364_0919706 3300037853 Bacteria 2984
215 Ga0436364_1290869 3300037853 Bacteria 4217
216 Ga0395901_0000167 3300038443 Bacteria 85844
217 Ga0436365_0185035 3300039437 Bacteria 15539
218 Ga0436365_0229788 3300039437 Bacteria 3924
219 Ga0436365_0391915 3300039437 Bacteria 9420
220 Ga0436360_0391255 3300039438 Bacteria 4407
221 Ga0436360_1027155 3300039438 Bacteria 12247
222 Ga0436360_1170853 3300039438 Bacteria 2077
223 Ga0436360_1329752 3300039438 Bacteria 5223
224 Ga0436361_0866961 3300039447 Bacteria 3272
225 Ga0436361_0909238 3300039447 Bacteria 2231
226 Ga0436363_1179587 3300039450 Bacteria 3989
227 Ga0436362_0903983 3300039453 Bacteria 9920
228 Ga0439463_000304 3300042016 Bacteria 13737
229 Ga0495627_000008 3300046453 Bacteria 572150
230 Ga0495627_000010 3300046453 Bacteria 381168
231 Ga0495627_000020 3300046453 Bacteria 291866
232 Ga0495603_0039396 3300046455 Bacteria 2831
233 Ga0495591_000002 3300046458 Bacteria 455013
234 Ga0495591_000009 3300046458 Bacteria 331626
235 Ga0495591_003005 3300046458 Bacteria 8983
236 Ga0495591_003760 3300046458 Bacteria 7674
237 Ga0495638_0011524 3300046460 Bacteria 6089
238 Ga0495650_0000581 3300046471 Bacteria 51097
239 Ga0495605_0000119 3300046474 Bacteria 102569
240 Ga0495605_0000142 3300046474 Bacteria 92755
241 Ga0495605_0000534 3300046474 Bacteria 31701
242 Ga0495605_0003172 3300046474 Bacteria 9882
243 Ga0495605_0029370 3300046474 Bacteria 2830
244 Ga0495605_0033884 3300046474 Bacteria 2590
245 Ga0495584_0006231 3300046491 Bacteria 6257
246 Ga0495607_0000025 3300046501 Bacteria 159379
247 Ga0495607_0000079 3300046501 Bacteria 97679
248 Ga0495607_0000105 3300046501 Bacteria 88629
249 Ga0495607_0000448 3300046501 Bacteria 41496
250 Ga0495607_0000492 3300046501 Bacteria 39465
251 Ga0495607_0009065 3300046501 Bacteria 6762
252 Ga0495607_0011255 3300046501 Bacteria 5967
253 Ga0495607_0011769 3300046501 Bacteria 5802
254 Ga0495583_0000322 3300046506 Bacteria 75510
255 Ga0495583_0001687 3300046506 Bacteria 21363
256 Ga0495583_0001787 3300046506 Bacteria 20439
257 Ga0495583_0003321 3300046506 Bacteria 12455
258 Ga0495606_0000206 3300046507 Bacteria 103708
259 Ga0495606_0000325 3300046507 Bacteria 82283
260 Ga0495616_0028019 3300046513 Bacteria 2985
261 Ga0495620_0001219 3300046515 Bacteria 15734
262 Ga0495620_0008725 3300046515 Bacteria 5427
263 Ga0495620_0042950 3300046515 Bacteria 1971
264 Ga0495631_0007362 3300046518 Bacteria 5602
265 Ga0495631_0007942 3300046518 Bacteria 5367
266 Ga0495632_0007152 3300046519 Bacteria 7058
267 Ga0495632_0012573 3300046519 Bacteria 4875
268 Ga0495632_0039451 3300046519 Bacteria 2383
269 Ga0495637_0000055 3300046520 Bacteria 99324
270 Ga0495637_0000074 3300046520 Bacteria 80233
271 Ga0495637_0000133 3300046520 Bacteria 55485
272 Ga0495637_0006542 3300046520 Bacteria 5838
273 Ga0495637_0025263 3300046520 Bacteria 2678
274 Ga0495644_0001806 3300046523 Bacteria 8636
275 Ga0495648_0000219 3300046524 Bacteria 65619
276 Ga0495648_0008920 3300046524 Bacteria 7837
277 Ga0495654_0000203 3300046530 Bacteria 57142
278 Ga0495654_0004882 3300046530 Bacteria 7892
279 Ga0495654_0026263 3300046530 Unclassified 2995
280 Ga0495654_0029382 3300046530 Bacteria 2803
281 Ga0495609_0000090 3300046538 Bacteria 106600
282 Ga0495609_0000256 3300046538 Bacteria 50491
283 Ga0495609_0024148 3300046538 Bacteria 2791
284 Ga0495597_0000011 3300046542 Bacteria 221377
285 Ga0495645_0096334 3300046543 Bacteria 2109
286 Ga0495668_0005515 3300046616 Bacteria 8538
287 Ga0495668_0031926 3300046616 Bacteria 2965
288 Ga0495668_0047802 3300046616 Bacteria 2375
289 Ga0495611_0000133 3300046648 Bacteria 52066
290 Ga0495611_0001983 3300046648 Bacteria 9712
291 Ga0495625_0000062 3300046660 Bacteria 176748
292 Ga0495661_0000123 3300046665 Bacteria 93482
293 Ga0495661_0001870 3300046665 Bacteria 16816
294 Ga0495661_0019097 3300046665 Bacteria 4497
295 Ga0495599_0012743 3300046678 Bacteria 5187
296 Ga0495671_0008142 3300046692 Bacteria 5915
297 Ga0495671_0063381 3300046692 Bacteria 1820
298 Ga0495649_0000110 3300046694 Bacteria 72175
299 Ga0495589_0000001 3300046794 Bacteria 888100
300 Ga0495660_0001382 3300046810 Bacteria 16678
301 Ga0495660_0013483 3300046810 Bacteria 4735
302 Ga0495660_0020095 3300046810 Bacteria 3830
303 Ga0495660_0025556 3300046810 Bacteria 3352
304 Ga0495672_0020593 3300047320 Bacteria 4317
305 Ga0495672_0040849 3300047320 Bacteria 2810
306 Ga0495672_0073349 3300047320 Bacteria 1930
307 Ga0495676_0000042 3300047321 Bacteria 103741
308 Ga0495683_0000006 3300047323 Bacteria 272409
309 Ga0495683_0019996 3300047323 Bacteria 3455
310 Ga0495679_000027 3300047446 Bacteria 193794
311 Ga0495673_0000282 3300047469 Bacteria 68654
312 Ga0495673_0000813 3300047469 Bacteria 29294
313 Ga0495673_0001429 3300047469 Bacteria 19118
314 Ga0495673_0051103 3300047469 Bacteria 1811
315 Ga0495681_0009215 3300047470 Bacteria 6103
316 Ga0495681_0009758 3300047470 Bacteria 5878
317 Ga0495684_0064607 3300047471 Bacteria 2782
318 Ga0495626_0000062 3300048091 Bacteria 143269
319 Ga0496102_0018676 3300048905 Bacteria 6098
320 Ga0496102_0042221 3300048905 Bacteria 4133
321 Ga0496102_0285263 3300048905 Bacteria 1556
322 Ga0496104_0018243 3300048907 Bacteria 6401
323 Ga0496106_0097332 3300048909 Bacteria 2278
324 Ga0496108_0000499 3300048911 Bacteria 31186
325 Ga0496109_0023228 3300048912 Bacteria 5501
326 Ga0496110_0008301 3300048913 Bacteria 8350
327 Ga0496110_0208766 3300048913 Bacteria 1775
328 Ga0496111_0001098 3300048914 Bacteria 14987
329 Ga0496112_0015705 3300048915 Bacteria 7072
330 Ga0496113_0000095 3300048916 Bacteria 37445
331 Ga0496115_0049202 3300048918 Bacteria 3373
332 Ga0496116_0000001 3300048919 Bacteria 1501681
333 Ga0496116_0028495 3300048919 Bacteria 4045
334 Ga0496116_0110269 3300048919 Bacteria 1619
335 Ga0496117_0003389 3300048920 Bacteria 18571
336 Ga0496118_0099549 3300048921 Bacteria 1970
337 Ga0496119_0001800 3300048922 Bacteria 24933
338 Ga0496119_0003140 3300048922 Bacteria 17396
339 Ga0496120_0000527 3300048923 Bacteria 59033
340 Ga0496120_0000538 3300048923 Bacteria 58168
341 Ga0496120_0010660 3300048923 Bacteria 6385
342 Ga0496121_0000003 3300048924 Bacteria 1191431
343 Ga0496121_0000069 3300048924 Bacteria 253087
344 Ga0496121_0001373 3300048924 Bacteria 41404
345 Ga0496121_0002669 3300048924 Bacteria 26715
346 Ga0496121_0009029 3300048924 Bacteria 11551
347 Ga0496121_0020009 3300048924 Bacteria 6656
348 Ga0496122_0000242 3300048925 Bacteria 122779
349 Ga0496123_0000269 3300048926 Bacteria 103907
350 Ga0496123_0009776 3300048926 Bacteria 8572
351 Ga0496123_0050447 3300048926 Bacteria 2780
352 Ga0496124_0000008 3300048927 Bacteria 864372
353 Ga0496124_0000224 3300048927 Bacteria 110603
354 Ga0496124_0000259 3300048927 Bacteria 101764
355 Ga0496124_0018204 3300048927 Bacteria 6587
356 Ga0496124_0035897 3300048927 Bacteria 4332
357 Ga0496124_0186470 3300048927 Bacteria 1591
358 Ga0496125_0000200 3300048928 Bacteria 126369
359 Ga0496126_0002142 3300048929 Bacteria 27515
360 Ga0495678_000008 3300049459 Bacteria 445926
361 Ga0495678_000032 3300049459 Bacteria 212537
362 Ga0495678_000043 3300049459 Bacteria 172593
363 Ga0495678_007341 3300049459 Bacteria 5724
364 Ga0495678_013331 3300049459 Bacteria 3863
365 Ga0495682_0002515 3300049460 Bacteria 8660
366 Ga0501034_0000874 3300049571 Bacteria 44331
367 Ga0501034_0065159 3300049571 Bacteria 3656
368 Ga0501034_0192537 3300049571 Bacteria 2001
369 Ga0501036_0014760 3300049572 Bacteria 6515
370 Ga0501037_0009696 3300049573 Bacteria 7068
371 Ga0501039_0042453 3300049575 Bacteria 3514
372 Ga0501040_0023488 3300049576 Bacteria 4136
373 Ga0501041_0001502 3300049577 Bacteria 12934
374 Ga0501043_0025605 3300049579 Bacteria 4629
375 Ga0501047_0152612 3300049581 Bacteria 2185
376 Ga0501068_0018315 3300049584 Bacteria 4057
377 Ga0501071_0040397 3300049587 Bacteria 3338
378 Ga0501072_0066477 3300049588 Bacteria 2844
379 Ga0501075_0010713 3300049591 Bacteria 6454
380 Ga0501076_0002496 3300049592 Bacteria 12656
381 Ga0501079_0040415 3300049741 Bacteria 3597
382 Ga0501080_0131287 3300049742 Bacteria 2319
383 Ga0501081_0000228 3300049743 Bacteria 28216
384 Ga0501035_0019031 3300049822 Bacteria 6320
385 Ga0501044_0089587 3300049823 Bacteria 3105
386 Ga0501044_0170119 3300049823 Bacteria 2151
387 nmdc:mga00v17_46670_c1 3300050491 Bacteria 2622
388 nmdc:mga0k408_73108_c1 3300050493 Bacteria 2003
389 Ga0500556_0001173 3300053104 Bacteria 12502
390 Ga0500618_001653 3300053125 Bacteria 9583
391 Ga0500573_0005312 3300053140 Bacteria 6892
392 Ga0501082_0000868 3300060353 Bacteria 26709

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025915 Ga0207693_10243199 Ga0207693_102431991 373
2 3300049588 Ga0501072_0066477 Ga0501072_0066477_10_1236 408
3 3300035170 Ga0373943_0057555 Ga0373943_0057555_17_1270 417
4 iso_pu_bacteria 2643221726 2644691115 431
5 3300005367 Ga0070667_100002531 Ga0070667_10000253113 435
6 3300009098 Ga0105245_10125906 Ga0105245_101259061 435
7 3300014968 Ga0157379_10116465 Ga0157379_101164653 435
8 3300028379 Ga0268266_10049320 Ga0268266_100493204 435
9 3300037068 Ga0373925_0039584 Ga0373925_0039584_1590_3026 435
10 3300005458 Ga0070681_10027279 Ga0070681_100272794 442
11 3300028800 Ga0265338_10000092 Ga0265338_10000092103 446
12 3300048922 Ga0496119_0001800 Ga0496119_0001800_19198_20631 447
13 3300048923 Ga0496120_0000527 Ga0496120_0000527_14349_15782 447
14 3300037466 Ga0395898_0254280 Ga0395898_0254280_76_1515 449
15 3300013308 Ga0157375_10025574 Ga0157375_100255745 450
16 3300049823 Ga0501044_0170119 Ga0501044_0170119_42_1481 450
17 3300005458 Ga0070681_10036528 Ga0070681_100365283 453
18 3300005548 Ga0070665_100255033 Ga0070665_1002550331 453
19 3300005563 Ga0068855_100002309 Ga0068855_10000230926 453
20 3300005563 Ga0068855_100178461 Ga0068855_1001784613 453
21 3300005577 Ga0068857_100036064 Ga0068857_1000360644 453
22 3300005577 Ga0068857_100044846 Ga0068857_1000448464 453
23 3300005616 Ga0068852_100248322 Ga0068852_1002483222 453
24 3300005843 Ga0068860_100005821 Ga0068860_10000582114 453
25 3300006177 Ga0075362_10000299 Ga0075362_100002996 453
26 3300006358 Ga0068871_100005572 Ga0068871_1000055728 453
27 3300009176 Ga0105242_10017301 Ga0105242_100173014 453
28 3300009545 Ga0105237_10022600 Ga0105237_100226004 453
29 3300009545 Ga0105237_10025860 Ga0105237_100258604 453
30 3300009551 Ga0105238_10011316 Ga0105238_100113164 453
31 3300009551 Ga0105238_10046523 Ga0105238_100465234 453
32 3300011119 Ga0105246_10013530 Ga0105246_100135303 453
33 3300013105 Ga0157369_10327028 Ga0157369_103270282 453
34 3300013296 Ga0157374_10023891 Ga0157374_100238914 453
35 3300013297 Ga0157378_10072059 Ga0157378_100720594 453
36 3300013306 Ga0163162_10263506 Ga0163162_102635061 453
37 3300025903 Ga0207680_10003115 Ga0207680_100031159 453
38 3300025912 Ga0207707_10012994 Ga0207707_100129947 453
39 3300025912 Ga0207707_10041594 Ga0207707_100415943 453
40 3300025924 Ga0207694_10035058 Ga0207694_100350584 453
41 3300025933 Ga0207706_10066705 Ga0207706_100667052 453
42 3300025934 Ga0207686_10087695 Ga0207686_100876952 453
43 3300025944 Ga0207661_10057312 Ga0207661_100573123 453
44 3300025949 Ga0207667_10260771 Ga0207667_102607711 453
45 3300026023 Ga0207677_10059730 Ga0207677_100597303 453
46 3300026035 Ga0207703_10088321 Ga0207703_100883212 453
47 3300026067 Ga0207678_10037613 Ga0207678_100376133 453
48 3300026116 Ga0207674_10007661 Ga0207674_100076613 453
49 3300028379 Ga0268266_10033176 Ga0268266_100331761 453
50 3300037853 Ga0436364_1290869 Ga0436364_1290869_497_1930 453
51 3300050493 nmdc:mga0k408_73108_c1 nmdc:mga0k408_73108_c1_91_1527 453
52 3300049579 Ga0501043_0025605 Ga0501043_0025605_2795_4234 454
53 iso_pu_bacteria 2643221668 2644375786 454
54 3300046458 Ga0495591_000002 Ga0495591_000002_352727_354160 455
55 3300046474 Ga0495605_0000534 Ga0495605_0000534_20306_21739 455
56 3300046501 Ga0495607_0000025 Ga0495607_0000025_10238_11671 455
57 3300046542 Ga0495597_0000011 Ga0495597_0000011_47361_48794 455
58 3300046810 Ga0495660_0025556 Ga0495660_0025556_1845_3278 455
59 3300047320 Ga0495672_0020593 Ga0495672_0020593_1877_3310 455
60 3300005617 Ga0068859_100148272 Ga0068859_1001482723 457
61 3300006931 Ga0097620_100148274 Ga0097620_1001482743 457
62 3300009098 Ga0105245_10044708 Ga0105245_100447082 457
63 iso_pu_bacteria 2643221610 2644064662 459
64 3300026088 Ga0207641_10012091 Ga0207641_100120913 460
65 3300005339 Ga0070660_100110433 Ga0070660_1001104331 461
66 3300033179 Ga0307507_10041239 Ga0307507_100412391 461
67 3300046460 Ga0495638_0011524 Ga0495638_0011524_3763_5196 463
68 3300005437 Ga0070710_10028706 Ga0070710_100287062 464
69 3300006028 Ga0070717_10031347 Ga0070717_100313475 464
70 3300021388 Ga0213875_10014952 Ga0213875_100149521 464
71 3300025929 Ga0207664_10014366 Ga0207664_100143666 464
72 3300037853 Ga0436364_0238403 Ga0436364_0238403_4664_6097 464
73 3300048905 Ga0496102_0042221 Ga0496102_0042221_2268_3701 464
74 3300048907 Ga0496104_0018243 Ga0496104_0018243_1746_3179 464
75 3300048911 Ga0496108_0000499 Ga0496108_0000499_3806_5239 464
76 3300048912 Ga0496109_0023228 Ga0496109_0023228_3557_4990 464
77 3300048913 Ga0496110_0008301 Ga0496110_0008301_4689_6122 464
78 3300048914 Ga0496111_0001098 Ga0496111_0001098_4495_5928 464
79 3300048915 Ga0496112_0015705 Ga0496112_0015705_104_1537 464
80 3300048916 Ga0496113_0000095 Ga0496113_0000095_8883_10316 464
81 3300048918 Ga0496115_0049202 Ga0496115_0049202_69_1502 464
82 3300048927 Ga0496124_0000259 Ga0496124_0000259_62648_64081 464
83 3300039437 Ga0436365_0391915 Ga0436365_0391915_3265_4698 466
84 3300049823 Ga0501044_0089587 Ga0501044_0089587_1259_2692 467
85 3300003790 Ga0055528_1004501 Ga0055528_10045017 468
86 3300025273 Ga0209673_1000044 Ga0209673_1000044220 468
87 3300025295 Ga0209564_1003335 Ga0209564_10033359 468
88 3300033180 Ga0307510_10019461 Ga0307510_100194617 468
89 3300009545 Ga0105237_10046180 Ga0105237_100461805 470
90 iso_pu_bacteria 2510917021 2511127663 471
91 3300005937 Ga0081455_10000599 Ga0081455_1000059919 472
92 iso_pu_bacteria 2842815866 2842815957 472
93 iso_pu_bacteria 2842849001 2842851227 472
94 3300005985 Ga0081539_10004557 Ga0081539_1000455711 473
95 3300005985 Ga0081539_10004557 Ga0081539_100045576 473
96 3300039438 Ga0436360_1027155 Ga0436360_1027155_10394_11833 473
97 3300039447 Ga0436361_0866961 Ga0436361_0866961_1047_2486 473
98 iso_pu_bacteria 2506520007 2506578615 473
99 iso_pu_bacteria 2506520008 2506583754 473
100 iso_pu_bacteria 2508501071 2508852567 473
101 iso_pu_bacteria 2599185307 2599973566 473
102 iso_pu_bacteria 2600255283 2601628177 473
103 iso_pu_bacteria 2643221547 2643754458 473
104 iso_pu_bacteria 2643221654 2644305367 473
105 iso_pu_bacteria 2654587920 2656279593 473
106 iso_pu_bacteria 2687453601 2689445168 473
107 iso_pu_bacteria 2738541271 2738688410 473
108 iso_pu_bacteria 2738543016 2739264142 473
109 iso_pu_bacteria 2765235838 2765568492 473
110 iso_pu_bacteria 2772190666 2772439104 473
111 iso_pu_bacteria 2806310673 2807177499 473
112 iso_pu_bacteria 2839094727 2839096643 473
113 iso_pu_bacteria 2840764183 2840770233 473
114 iso_pu_bacteria 2842775625 2842776162 473
115 iso_pu_bacteria 2869551831 2869554605 473
116 iso_pu_bacteria 2888366609 2888369159 473
117 iso_pu_bacteria 2888373701 2888378253 473
118 iso_pu_bacteria 2929199973 2929203023 473
119 iso_pu_bacteria 2937967321 2937967722 473
120 iso_pu_bacteria 640753048 640938080 473
121 iso_pu_bacteria 8004592986 8004597255 473
122 iso_pu_bacteria 8015394850 8015399086 473
123 iso_pu_bacteria 8055909800 8055912830 473
124 iso_pu_bacteria 2617270735 2617346285 474
125 iso_pu_bacteria 2818991461 2819686588 474
126 iso_pu_bacteria 2821123053 2821126300 474
127 iso_pu_bacteria 2824773399 2824774323 474
128 iso_pu_bacteria 2857531043 2857532861 474
129 iso_pu_bacteria 2894772417 2894774133 474
130 iso_pu_bacteria 2929138655 2929141469 474
131 iso_pu_bacteria 2989349275 2989352621 474
132 iso_pu_bacteria 8018150411 8018152222 474
133 iso_pu_bacteria 2599185352 2600192561 475
134 iso_pu_bacteria 2643221557 2643809445 475
135 iso_pu_bacteria 2643221723 2644677419 475
136 3300005290 Ga0065712_10073803 Ga0065712_100738035 476
137 3300005548 Ga0070665_100014355 Ga0070665_1000143552 476
138 3300033180 Ga0307510_10000002 Ga0307510_1000000255 476
139 3300046455 Ga0495603_0039396 Ga0495603_0039396_125_1555 476
140 3300046694 Ga0495649_0000110 Ga0495649_0000110_30937_32367 476
141 3300047323 Ga0495683_0000006 Ga0495683_0000006_159796_161226 476
142 3300053125 Ga0500618_001653 Ga0500618_001653_3127_4557 476
143 3300003203 JGI25406J46586_10002618 JGI25406J46586_100026188 477
144 3300003203 JGI25406J46586_10005826 JGI25406J46586_100058263 477
145 3300005329 Ga0070683_100031856 Ga0070683_1000318562 477
146 3300005347 Ga0070668_100015120 Ga0070668_1000151203 477
147 3300005367 Ga0070667_100006240 Ga0070667_1000062405 477
148 3300005441 Ga0070700_100041318 Ga0070700_1000413183 477
149 3300005458 Ga0070681_10091413 Ga0070681_100914133 477
150 3300005718 Ga0068866_10004128 Ga0068866_100041284 477
151 3300005841 Ga0068863_100003466 Ga0068863_1000034666 477
152 3300005842 Ga0068858_100004898 Ga0068858_10000489810 477
153 3300005842 Ga0068858_100030705 Ga0068858_1000307054 477
154 3300005843 Ga0068860_100005443 Ga0068860_1000054438 477
155 3300005985 Ga0081539_10000054 Ga0081539_10000054149 477
156 3300006353 Ga0075370_10005082 Ga0075370_100050827 477
157 3300006358 Ga0068871_100085585 Ga0068871_1000855852 477
158 3300006946 Ga0079104_1001435 Ga0079104_10014354 477
159 3300009011 Ga0105251_10000026 Ga0105251_1000002614 477
160 3300009011 Ga0105251_10000359 Ga0105251_1000035934 477
161 3300009011 Ga0105251_10002312 Ga0105251_100023125 477
162 3300009011 Ga0105251_10003795 Ga0105251_100037957 477
163 3300009036 Ga0105244_10000436 Ga0105244_1000043626 477
164 3300009092 Ga0105250_10000249 Ga0105250_1000024926 477
165 3300009093 Ga0105240_10000467 Ga0105240_1000046753 477
166 3300009093 Ga0105240_10182286 Ga0105240_101822862 477
167 3300009098 Ga0105245_10033401 Ga0105245_100334016 477
168 3300009101 Ga0105247_10000068 Ga0105247_1000006825 477
169 3300009101 Ga0105247_10073738 Ga0105247_100737382 477
170 3300009148 Ga0105243_10001253 Ga0105243_1000125323 477
171 3300009174 Ga0105241_10000002 Ga0105241_10000002172 477
172 3300009553 Ga0105249_10013179 Ga0105249_100131792 477
173 3300013104 Ga0157370_10001383 Ga0157370_100013839 477
174 3300013306 Ga0163162_10023600 Ga0163162_100236003 477
175 3300014325 Ga0163163_10147575 Ga0163163_101475751 477
176 3300014968 Ga0157379_10005578 Ga0157379_100055784 477
177 3300015265 Ga0182005_1009298 Ga0182005_10092982 477
178 3300017792 Ga0163161_10000001 Ga0163161_100000011383 477
179 3300020080 Ga0206350_11415802 Ga0206350_114158022 477
180 3300021384 Ga0213876_10025357 Ga0213876_100253572 477
181 3300021388 Ga0213875_10001471 Ga0213875_100014715 477
182 3300021441 Ga0213871_10002240 Ga0213871_100022402 477
183 3300022467 Ga0224712_10026644 Ga0224712_100266441 477
184 3300025711 Ga0207696_1000001 Ga0207696_10000011453 477
185 3300025728 Ga0207655_1000064 Ga0207655_1000064147 477
186 3300025735 Ga0207713_1000008 Ga0207713_1000008358 477
187 3300025735 Ga0207713_1000039 Ga0207713_100003927 477
188 3300025735 Ga0207713_1000063 Ga0207713_1000063160 477
189 3300025735 Ga0207713_1002101 Ga0207713_10021016 477
190 3300025900 Ga0207710_10000327 Ga0207710_1000032724 477
191 3300025911 Ga0207654_10000005 Ga0207654_10000005172 477
192 3300025913 Ga0207695_10050661 Ga0207695_100506614 477
193 3300025923 Ga0207681_10005941 Ga0207681_100059412 477
194 3300025927 Ga0207687_10020185 Ga0207687_100201852 477
195 3300025938 Ga0207704_10017372 Ga0207704_100173722 477
196 3300025941 Ga0207711_10028753 Ga0207711_100287534 477
197 3300025961 Ga0207712_10018796 Ga0207712_100187962 477
198 3300025972 Ga0207668_10013103 Ga0207668_100131032 477
199 3300025986 Ga0207658_10005127 Ga0207658_100051274 477
200 3300026035 Ga0207703_10007902 Ga0207703_100079027 477
201 3300026075 Ga0207708_10041890 Ga0207708_100418902 477
202 3300026089 Ga0207648_10007548 Ga0207648_1000754811 477
203 3300027111 Ga0209281_1000003 Ga0209281_1000003531 477
204 3300028381 Ga0268264_10004057 Ga0268264_100040575 477
205 3300028381 Ga0268264_10009494 Ga0268264_1000949410 477
206 3300028573 Ga0265334_10022585 Ga0265334_100225852 477
207 3300028800 Ga0265338_10011729 Ga0265338_1001172910 477
208 3300028800 Ga0265338_10024136 Ga0265338_100241365 477
209 3300031250 Ga0265331_10001322 Ga0265331_1000132216 477
210 3300031507 Ga0307509_10003945 Ga0307509_1000394518 477
211 3300031711 Ga0265314_10001995 Ga0265314_100019952 477
212 3300035111 Ga0373923_0011344 Ga0373923_0011344_715_2148 477
213 3300036401 Ga0373937_0107686 Ga0373937_0107686_820_2253 477
214 3300037853 Ga0436364_0083681 Ga0436364_0083681_309_1742 477
215 3300037853 Ga0436364_0343587 Ga0436364_0343587_51138_52571 477
216 3300037853 Ga0436364_0519232 Ga0436364_0519232_73732_75165 477
217 3300037853 Ga0436364_0919706 Ga0436364_0919706_1248_2681 477
218 3300039437 Ga0436365_0229788 Ga0436365_0229788_136_1569 477
219 3300039438 Ga0436360_0391255 Ga0436360_0391255_1701_3134 477
220 3300039438 Ga0436360_1170853 Ga0436360_1170853_347_1780 477
221 3300039438 Ga0436360_1329752 Ga0436360_1329752_1424_2857 477
222 3300039447 Ga0436361_0909238 Ga0436361_0909238_592_2025 477
223 3300039450 Ga0436363_1179587 Ga0436363_1179587_831_2264 477
224 3300046453 Ga0495627_000010 Ga0495627_000010_53486_54919 477
225 3300046453 Ga0495627_000020 Ga0495627_000020_240338_241771 477
226 3300046458 Ga0495591_000009 Ga0495591_000009_46129_47562 477
227 3300046458 Ga0495591_003005 Ga0495591_003005_40_1473 477
228 3300046458 Ga0495591_003760 Ga0495591_003760_5246_6679 477
229 3300046471 Ga0495650_0000581 Ga0495650_0000581_1091_2524 477
230 3300046474 Ga0495605_0000142 Ga0495605_0000142_53313_54746 477
231 3300046474 Ga0495605_0003172 Ga0495605_0003172_1964_3397 477
232 3300046474 Ga0495605_0033884 Ga0495605_0033884_1055_2488 477
233 3300046491 Ga0495584_0006231 Ga0495584_0006231_3760_5193 477
234 3300046501 Ga0495607_0000105 Ga0495607_0000105_41567_43000 477
235 3300046501 Ga0495607_0000492 Ga0495607_0000492_36689_38122 477
236 3300046501 Ga0495607_0009065 Ga0495607_0009065_1853_3286 477
237 3300046501 Ga0495607_0011769 Ga0495607_0011769_3361_4794 477
238 3300046506 Ga0495583_0000322 Ga0495583_0000322_44992_46425 477
239 3300046506 Ga0495583_0001687 Ga0495583_0001687_2501_3934 477
240 3300046506 Ga0495583_0001787 Ga0495583_0001787_416_1849 477
241 3300046507 Ga0495606_0000325 Ga0495606_0000325_30023_31456 477
242 3300046515 Ga0495620_0001219 Ga0495620_0001219_8491_9924 477
243 3300046515 Ga0495620_0008725 Ga0495620_0008725_2752_4185 477
244 3300046515 Ga0495620_0042950 Ga0495620_0042950_276_1709 477
245 3300046518 Ga0495631_0007362 Ga0495631_0007362_1783_3216 477
246 3300046518 Ga0495631_0007942 Ga0495631_0007942_2466_3899 477
247 3300046519 Ga0495632_0007152 Ga0495632_0007152_1951_3384 477
248 3300046519 Ga0495632_0012573 Ga0495632_0012573_1175_2608 477
249 3300046520 Ga0495637_0000055 Ga0495637_0000055_46876_48309 477
250 3300046520 Ga0495637_0000133 Ga0495637_0000133_53672_55105 477
251 3300046520 Ga0495637_0006542 Ga0495637_0006542_1537_2970 477
252 3300046523 Ga0495644_0001806 Ga0495644_0001806_3927_5360 477
253 3300046524 Ga0495648_0000219 Ga0495648_0000219_15660_17093 477
254 3300046524 Ga0495648_0008920 Ga0495648_0008920_2017_3450 477
255 3300046530 Ga0495654_0000203 Ga0495654_0000203_38337_39770 477
256 3300046530 Ga0495654_0004882 Ga0495654_0004882_3700_5133 477
257 3300046530 Ga0495654_0029382 Ga0495654_0029382_493_1926 477
258 3300046538 Ga0495609_0000090 Ga0495609_0000090_52799_54232 477
259 3300046538 Ga0495609_0000256 Ga0495609_0000256_4957_6390 477
260 3300046538 Ga0495609_0024148 Ga0495609_0024148_1327_2760 477
261 3300046543 Ga0495645_0096334 Ga0495645_0096334_141_1574 477
262 3300046616 Ga0495668_0005515 Ga0495668_0005515_3194_4627 477
263 3300046616 Ga0495668_0031926 Ga0495668_0031926_1260_2693 477
264 3300046616 Ga0495668_0047802 Ga0495668_0047802_608_2041 477
265 3300046648 Ga0495611_0001983 Ga0495611_0001983_2504_3937 477
266 3300046660 Ga0495625_0000062 Ga0495625_0000062_83398_84831 477
267 3300046665 Ga0495661_0000123 Ga0495661_0000123_2641_4074 477
268 3300046665 Ga0495661_0001870 Ga0495661_0001870_5525_6958 477
269 3300046665 Ga0495661_0019097 Ga0495661_0019097_1845_3278 477
270 3300046678 Ga0495599_0012743 Ga0495599_0012743_1977_3410 477
271 3300046692 Ga0495671_0008142 Ga0495671_0008142_3064_4497 477
272 3300046692 Ga0495671_0063381 Ga0495671_0063381_166_1599 477
273 3300046794 Ga0495589_0000001 Ga0495589_0000001_532382_533815 477
274 3300046810 Ga0495660_0001382 Ga0495660_0001382_4113_5546 477
275 3300046810 Ga0495660_0013483 Ga0495660_0013483_2912_4345 477
276 3300047320 Ga0495672_0040849 Ga0495672_0040849_1011_2444 477
277 3300047320 Ga0495672_0073349 Ga0495672_0073349_479_1912 477
278 3300047321 Ga0495676_0000042 Ga0495676_0000042_90748_92181 477
279 3300047323 Ga0495683_0019996 Ga0495683_0019996_1960_3393 477
280 3300047446 Ga0495679_000027 Ga0495679_000027_31610_33043 477
281 3300047469 Ga0495673_0000282 Ga0495673_0000282_40595_42028 477
282 3300047469 Ga0495673_0000813 Ga0495673_0000813_25911_27344 477
283 3300047469 Ga0495673_0001429 Ga0495673_0001429_6797_8230 477
284 3300047469 Ga0495673_0051103 Ga0495673_0051103_16_1449 477
285 3300047470 Ga0495681_0009215 Ga0495681_0009215_957_2390 477
286 3300047471 Ga0495684_0064607 Ga0495684_0064607_644_2077 477
287 3300048091 Ga0495626_0000062 Ga0495626_0000062_93160_94593 477
288 3300048905 Ga0496102_0018676 Ga0496102_0018676_2585_4018 477
289 3300048909 Ga0496106_0097332 Ga0496106_0097332_707_2143 477
290 3300048913 Ga0496110_0208766 Ga0496110_0208766_12_1445 477
291 3300048919 Ga0496116_0000001 Ga0496116_0000001_890328_891761 477
292 3300048920 Ga0496117_0003389 Ga0496117_0003389_1407_2840 477
293 3300048921 Ga0496118_0099549 Ga0496118_0099549_209_1642 477
294 3300048922 Ga0496119_0003140 Ga0496119_0003140_4220_5653 477
295 3300048923 Ga0496120_0000538 Ga0496120_0000538_16691_18124 477
296 3300048924 Ga0496121_0001373 Ga0496121_0001373_6318_7751 477
297 3300048924 Ga0496121_0009029 Ga0496121_0009029_5889_7322 477
298 3300048925 Ga0496122_0000242 Ga0496122_0000242_15838_17271 477
299 3300048926 Ga0496123_0000269 Ga0496123_0000269_15840_17273 477
300 3300048926 Ga0496123_0009776 Ga0496123_0009776_1625_3058 477
301 3300048927 Ga0496124_0000008 Ga0496124_0000008_196793_198226 477
302 3300048927 Ga0496124_0000224 Ga0496124_0000224_82978_84411 477
303 3300049459 Ga0495678_000043 Ga0495678_000043_118074_119507 477
304 3300049459 Ga0495678_007341 Ga0495678_007341_716_2149 477
305 3300049459 Ga0495678_013331 Ga0495678_013331_478_1911 477
306 3300049460 Ga0495682_0002515 Ga0495682_0002515_5805_7238 477
307 3300049572 Ga0501036_0014760 Ga0501036_0014760_880_2313 477
308 3300049573 Ga0501037_0009696 Ga0501037_0009696_657_2090 477
309 3300049575 Ga0501039_0042453 Ga0501039_0042453_1665_3098 477
310 3300049576 Ga0501040_0023488 Ga0501040_0023488_2267_3700 477
311 3300049577 Ga0501041_0001502 Ga0501041_0001502_11175_12608 477
312 3300049584 Ga0501068_0018315 Ga0501068_0018315_1489_2922 477
313 3300049587 Ga0501071_0040397 Ga0501071_0040397_958_2391 477
314 3300049591 Ga0501075_0010713 Ga0501075_0010713_1739_3172 477
315 3300049592 Ga0501076_0002496 Ga0501076_0002496_8004_9437 477
316 3300049741 Ga0501079_0040415 Ga0501079_0040415_1719_3152 477
317 3300049742 Ga0501080_0131287 Ga0501080_0131287_134_1567 477
318 3300049743 Ga0501081_0000228 Ga0501081_0000228_12522_13955 477
319 3300053140 Ga0500573_0005312 Ga0500573_0005312_1800_3233 477
320 3300060353 Ga0501082_0000868 Ga0501082_0000868_12745_14178 477
321 iso_pu_bacteria 2857553236 2857556121 477
322 iso_pu_bacteria 3003930520 3003934219 477
323 3300003758 Ga0055532_1000109 Ga0055532_100010980 478
324 3300003758 Ga0055532_1001270 Ga0055532_10012702 478
325 3300003760 Ga0055527_1000067 Ga0055527_100006780 478
326 3300003760 Ga0055527_1000511 Ga0055527_10005117 478
327 3300003761 Ga0055535_1000111 Ga0055535_10001118 478
328 3300003761 Ga0055535_1000251 Ga0055535_100025143 478
329 3300003762 Ga0055542_1000280 Ga0055542_100028043 478
330 3300003762 Ga0055542_1000915 Ga0055542_100091513 478
331 3300003763 Ga0055529_1000213 Ga0055529_100021343 478
332 3300005548 Ga0070665_100055950 Ga0070665_1000559501 478
333 3300009093 Ga0105240_10100510 Ga0105240_101005102 478
334 3300015262 Ga0182007_10007112 Ga0182007_100071123 478
335 3300021384 Ga0213876_10006572 Ga0213876_100065726 478
336 3300025228 Ga0209672_100044 Ga0209672_100044117 478
337 3300025228 Ga0209672_100059 Ga0209672_10005957 478
338 3300025229 Ga0209147_100039 Ga0209147_100039117 478
339 3300025229 Ga0209147_100072 Ga0209147_10007257 478
340 3300025242 Ga0209258_100062 Ga0209258_100062117 478
341 3300025242 Ga0209258_100102 Ga0209258_10010257 478
342 3300025254 Ga0209148_1000075 Ga0209148_1000075117 478
343 3300025254 Ga0209148_1000294 Ga0209148_10002943 478
344 3300025272 Ga0209455_1000067 Ga0209455_1000067117 478
345 3300025272 Ga0209455_1000176 Ga0209455_100017624 478
346 3300025913 Ga0207695_10015209 Ga0207695_100152097 478
347 3300025914 Ga0207671_10018991 Ga0207671_100189913 478
348 3300039437 Ga0436365_0185035 Ga0436365_0185035_4715_6151 478
349 3300046474 Ga0495605_0000119 Ga0495605_0000119_60627_62063 478
350 3300046501 Ga0495607_0000448 Ga0495607_0000448_13028_14482 478
351 3300046501 Ga0495607_0011255 Ga0495607_0011255_1164_2600 478
352 3300046513 Ga0495616_0028019 Ga0495616_0028019_214_1668 478
353 3300046519 Ga0495632_0039451 Ga0495632_0039451_270_1796 478
354 3300046520 Ga0495637_0000074 Ga0495637_0000074_41373_42809 478
355 3300046520 Ga0495637_0025263 Ga0495637_0025263_840_2294 478
356 3300046530 Ga0495654_0026263 Ga0495654_0026263_270_1706 478
357 3300046648 Ga0495611_0000133 Ga0495611_0000133_33109_34545 478
358 3300048919 Ga0496116_0110269 Ga0496116_0110269_146_1582 478
359 3300048923 Ga0496120_0010660 Ga0496120_0010660_326_1762 478
360 3300048924 Ga0496121_0000003 Ga0496121_0000003_1099239_1100675 478
361 3300048924 Ga0496121_0020009 Ga0496121_0020009_683_2119 478
362 3300048927 Ga0496124_0018204 Ga0496124_0018204_2757_4193 478
363 3300048927 Ga0496124_0186470 Ga0496124_0186470_98_1534 478
364 3300048928 Ga0496125_0000200 Ga0496125_0000200_89486_90922 478
365 3300049459 Ga0495678_000008 Ga0495678_000008_88956_90392 478
366 3300049571 Ga0501034_0000874 Ga0501034_0000874_14784_16229 478
367 3300049571 Ga0501034_0192537 Ga0501034_0192537_91_1536 478
368 3300049581 Ga0501047_0152612 Ga0501047_0152612_136_1581 478
369 3300049822 Ga0501035_0019031 Ga0501035_0019031_1451_2896 478
370 iso_pu_bacteria 2838675328 2838678060 478
371 iso_pu_bacteria 2863421361 2863427745 478
372 3300002987 JGI25159J45721_1000052 JGI25159J45721_100005224 479
373 3300003187 JGI25151J46595_10005788 JGI25151J46595_100057883 479
374 3300003354 JGI25160J50197_1000007 JGI25160J50197_1000007261 479
375 3300003374 JGI25161J50226_1000648 JGI25161J50226_10006489 479
376 3300003771 Ga0055526_1001100 Ga0055526_10011003 479
377 3300003781 Ga0055536_1000836 Ga0055536_100083617 479
378 3300003794 Ga0055531_10008290 Ga0055531_100082906 479
379 3300004625 Ga0055543_1000120 Ga0055543_100012033 479
380 3300005262 Ga0065165_1000011 Ga0065165_100001133 479
381 3300005329 Ga0070683_100074995 Ga0070683_1000749953 479
382 3300005336 Ga0070680_100190071 Ga0070680_1001900711 479
383 3300005338 Ga0068868_100084405 Ga0068868_1000844053 479
384 3300005459 Ga0068867_100074299 Ga0068867_1000742992 479
385 3300006048 Ga0075363_100001621 Ga0075363_1000016218 479
386 3300006195 Ga0075366_10042250 Ga0075366_100422502 479
387 3300009011 Ga0105251_10000769 Ga0105251_100007698 479
388 3300009093 Ga0105240_10000121 Ga0105240_1000012175 479
389 3300009093 Ga0105240_10004083 Ga0105240_100040833 479
390 3300009545 Ga0105237_10039572 Ga0105237_100395721 479
391 3300009545 Ga0105237_10051536 Ga0105237_100515362 479
392 3300009551 Ga0105238_10003805 Ga0105238_100038058 479
393 3300010375 Ga0105239_10000031 Ga0105239_10000031194 479
394 3300010375 Ga0105239_10033476 Ga0105239_100334761 479
395 3300013249 Ga0171463_1002 Ga0171463_1002318 479
396 3300014325 Ga0163163_10000004 Ga0163163_10000004369 479
397 3300014497 Ga0182008_10016316 Ga0182008_100163162 479
398 3300015690 Ga0183363_1106 Ga0183363_11063 479
399 3300020078 Ga0206352_10172908 Ga0206352_101729081 479
400 3300025208 Ga0209436_101116 Ga0209436_1011166 479
401 3300025284 Ga0209130_1000033 Ga0209130_100003333 479
402 3300025292 Ga0209676_1000605 Ga0209676_100060538 479
403 3300025294 Ga0209025_1000032 Ga0209025_1000032255 479
404 3300025294 Ga0209025_1030453 Ga0209025_10304531 479
405 3300025295 Ga0209564_1000079 Ga0209564_1000079217 479
406 3300025298 Ga0209050_1001253 Ga0209050_100125315 479
407 3300025299 Ga0209256_1000950 Ga0209256_10009503 479
408 3300025302 Ga0207426_1000078 Ga0207426_100007833 479
409 3300025303 Ga0209051_1001365 Ga0209051_100136510 479
410 3300025304 Ga0209257_1001700 Ga0209257_10017004 479
411 3300025913 Ga0207695_10000006 Ga0207695_10000006472 479
412 3300025924 Ga0207694_10029155 Ga0207694_100291552 479
413 3300031730 Ga0307516_10067296 Ga0307516_100672962 479
414 3300031911 Ga0307412_10060415 Ga0307412_100604152 479
415 3300036401 Ga0373937_0000443 Ga0373937_0000443_10231_11670 479
416 3300037312 Ga0395899_0000114 Ga0395899_0000114_12426_13877 479
417 3300037418 Ga0395900_0000246 Ga0395900_0000246_77279_78730 479
418 3300037466 Ga0395898_0000447 Ga0395898_0000447_77278_78729 479
419 3300037471 Ga0395905_0000228 Ga0395905_0000228_6375_7826 479
420 3300037853 Ga0436364_0074297 Ga0436364_0074297_2753_4207 479
421 3300038443 Ga0395901_0000167 Ga0395901_0000167_7115_8566 479
422 3300039453 Ga0436362_0903983 Ga0436362_0903983_3691_5151 479
423 3300042016 Ga0439463_000304 Ga0439463_000304_5449_6960 479
424 3300046453 Ga0495627_000008 Ga0495627_000008_263751_265196 479
425 3300046474 Ga0495605_0029370 Ga0495605_0029370_475_1926 479
426 3300046501 Ga0495607_0000079 Ga0495607_0000079_9574_11025 479
427 3300046506 Ga0495583_0003321 Ga0495583_0003321_9382_10821 479
428 3300046507 Ga0495606_0000206 Ga0495606_0000206_51873_53330 479
429 3300046810 Ga0495660_0020095 Ga0495660_0020095_1923_3368 479
430 3300047470 Ga0495681_0009758 Ga0495681_0009758_3914_5359 479
431 3300048905 Ga0496102_0285263 Ga0496102_0285263_50_1507 479
432 3300048919 Ga0496116_0028495 Ga0496116_0028495_2334_3779 479
433 3300048924 Ga0496121_0000069 Ga0496121_0000069_218850_220292 479
434 3300048924 Ga0496121_0002669 Ga0496121_0002669_11961_13403 479
435 3300048926 Ga0496123_0050447 Ga0496123_0050447_1230_2678 479
436 3300048927 Ga0496124_0035897 Ga0496124_0035897_1149_2594 479
437 3300048929 Ga0496126_0002142 Ga0496126_0002142_12273_13715 479
438 3300049459 Ga0495678_000032 Ga0495678_000032_13933_15378 479
439 3300049571 Ga0501034_0065159 Ga0501034_0065159_1594_3042 479
440 3300050491 nmdc:mga00v17_46670_c1 nmdc:mga00v17_46670_c1_755_2230 479
441 3300053104 Ga0500556_0001173 Ga0500556_0001173_2916_4364 479
442 iso_pu_bacteria 2941499720 2941505772 479

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00171

Aldedh

Aldehyde dehydrogenase family

11

469

0.98

PF00171

Aldedh

Aldehyde dehydrogenase family

470

519

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x5t-assembly1.cif.gz_A crystal structure of alpha-ketoglutarate semialdehyde dehydrogenase (kgsadh) from azospirillum brasilense 0.9868 6 478
5vbf-assembly2.cif.gz_E crystal structure of succinate semialdehyde dehydrogenase from burkholderia vietnamiensis 0.984 4 478
5vbf-assembly2.cif.gz_E crystal structure of succinate semialdehyde dehydrogenase from burkholderia vietnamiensis 0.98 4 478
5x5t-assembly1.cif.gz_A crystal structure of alpha-ketoglutarate semialdehyde dehydrogenase (kgsadh) from azospirillum brasilense 0.9786 6 478
3ek1-assembly2.cif.gz_G crystal structure of aldehyde dehydrogenase from brucella melitensis biovar abortus 2308 0.9771 6 477
ID Description Score Start End Superfamily
5vbfG02 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.989 254 442 3.40.309.10
af_A4IDE7_286_468_3.40.309.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9835 257 437 3.40.309.10
af_A4IDE7_13_506_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9824 6 476 3.40.605.10
af_Q4DYS1_277_499_3.40.309.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9795 254 474 3.40.309.10
af_Q9UTM8_272_454_3.40.309.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9795 260 438 3.40.309.10
ID Description Score Start End GO Terms
AF-A0A7T8M5K7-F1-model_v4 deleted 0.9898 2 479
AF-A0A6A5KRF8-F1-model_v4 deleted 0.9896 1 479
AF-A0A7Z2G8V2-F1-model_v4 Aldehyde dehydrogenase family protein 0.9894 2 478 GO:0016620
AF-A0A7T8M5K7-F1-model_v4 deleted 0.9878 2 479
AF-A0A6A5KRF8-F1-model_v4 deleted 0.9876 1 479

Feature Viewer

pLDDT pTM Quality
95.34 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map