F444981

General Info

Members Datasets Scaffolds Average Seq Length
442 236 884 171

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_24_c1|nmdc:mga0n895_24_c1_45254_45856
Length 200
Sequence MVRVLRRLGDNRRSVRRRGASFESIAYMEDPVPDEVVQGDLTEAQKRDNVIRLAFDGRIDRFEAFCRTVRDVVPDGTTAVLRGSAVTGCRWNDGAPFDSDGPGTSDLDLTLVGAGALLFFKPTGFFVPGVHSRPLSDDDPDIAPDLVPLRRALMDLVGRPVNIQASRDIVILFRGDLLGQPYLTLFEKPPGISVTGGARP

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
159 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
160 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
161 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
162 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
163 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
164 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
165 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
166 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
167 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
168 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
169 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
170 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
171 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
172 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
173 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
174 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
175 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
176 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
180 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
181 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
182 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
183 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
218 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
219 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
220 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
221 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
222 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
223 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
224 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
234 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.56
Nodule 0
Rhizoplane 2.71
Rhizosphere 90.5
Stem 0
Stem Tuber 0
Unclassified 28.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_24_c1 3300050512 Bacteria 92082
2 JGI24035J26624_1004247 3300002126 Unclassified 1358
3 JGI24035J26624_1004361 3300002126 Unclassified 1342
4 Ga0065707_10004752 3300005295 Bacteria 6730
5 Ga0065707_10242539 3300005295 Bacteria 1151
6 Ga0070690_100004294 3300005330 Bacteria 7897
7 Ga0070677_10029030 3300005333 Unclassified 2094
8 Ga0070677_10073773 3300005333 Bacteria 1442
9 Ga0068869_100092199 3300005334 Bacteria 2280
10 Ga0070666_10022281 3300005335 Bacteria 4113
11 Ga0070666_10034035 3300005335 Bacteria 3376
12 Ga0070666_10397665 3300005335 Bacteria 990
13 Ga0070689_100037938 3300005340 Bacteria 3685
14 Ga0070689_100068495 3300005340 Unclassified 2768
15 Ga0070687_100011275 3300005343 Bacteria 3905
16 Ga0070687_100026599 3300005343 Unclassified 2787
17 Ga0070661_100219060 3300005344 Unclassified 1459
18 Ga0070661_100873253 3300005344 Unclassified 741
19 Ga0070668_100068327 3300005347 Unclassified 2762
20 Ga0070668_100126897 3300005347 Unclassified 2044
21 Ga0070668_100360461 3300005347 Bacteria 1233
22 Ga0070669_100038311 3300005353 Bacteria 3480
23 Ga0070669_100126567 3300005353 Unclassified 1955
24 Ga0070669_100181578 3300005353 Bacteria 1646
25 Ga0070675_100030548 3300005354 Bacteria 4350
26 Ga0070675_100115869 3300005354 Bacteria 2272
27 Ga0070675_100231958 3300005354 Bacteria 1610
28 Ga0070671_100025490 3300005355 Unclassified 4852
29 Ga0070674_100002926 3300005356 Bacteria 9463
30 Ga0070674_100130209 3300005356 Bacteria 1874
31 Ga0070674_100309076 3300005356 Bacteria 1263
32 Ga0070674_100336131 3300005356 Bacteria 1215
33 Ga0070673_100128796 3300005364 Unclassified 2121
34 Ga0070673_100335864 3300005364 Unclassified 1338
35 Ga0070673_100387278 3300005364 Bacteria 1247
36 Ga0070688_100006651 3300005365 Bacteria 6193
37 Ga0070688_100070300 3300005365 Unclassified 2238
38 Ga0070688_100103746 3300005365 Bacteria 1879
39 Ga0070688_100330981 3300005365 Bacteria 1109
40 Ga0070659_100249293 3300005366 Unclassified 1471
41 Ga0070659_101079173 3300005366 Bacteria 707
42 Ga0070667_100063627 3300005367 Bacteria 3127
43 Ga0070667_100463998 3300005367 Bacteria 1158
44 Ga0070667_100626304 3300005367 Bacteria 992
45 Ga0070709_10186207 3300005434 Bacteria 1461
46 Ga0070711_100718600 3300005439 Bacteria 842
47 Ga0070700_100953083 3300005441 Bacteria 702
48 Ga0070694_100107166 3300005444 Unclassified 1986
49 Ga0070694_100338023 3300005444 Unclassified 1163
50 Ga0070708_100025689 3300005445 Bacteria 5037
51 Ga0070663_100239385 3300005455 Unclassified 1432
52 Ga0070663_100297954 3300005455 Bacteria 1290
53 Ga0070678_100014332 3300005456 Bacteria 4998
54 Ga0070662_100100371 3300005457 Unclassified 2189
55 Ga0070662_100455235 3300005457 Bacteria 1063
56 Ga0070681_10046648 3300005458 Bacteria 4331
57 Ga0068867_100033108 3300005459 Bacteria 3740
58 Ga0070685_10009438 3300005466 Bacteria 5041
59 Ga0070685_10102091 3300005466 Bacteria 1753
60 Ga0070685_10219376 3300005466 Bacteria 1245
61 Ga0070685_10556972 3300005466 Unclassified 819
62 Ga0070706_100205325 3300005467 Bacteria 1840
63 Ga0070706_101643848 3300005467 Bacteria 586
64 Ga0070707_100062372 3300005468 Unclassified 3576
65 Ga0070707_101729756 3300005468 Bacteria 592
66 Ga0070698_100368485 3300005471 Bacteria 1368
67 Ga0070698_100540732 3300005471 Unclassified 1104
68 Ga0070698_100916873 3300005471 Unclassified 822
69 Ga0070698_100970686 3300005471 Bacteria 796
70 Ga0070679_100103077 3300005530 Bacteria 2839
71 Ga0070684_100303520 3300005535 Bacteria 1465
72 Ga0068853_101414372 3300005539 Bacteria 673
73 Ga0070672_100034077 3300005543 Bacteria 3862
74 Ga0070672_100038949 3300005543 Bacteria 3636
75 Ga0070672_100040393 3300005543 Bacteria 3579
76 Ga0070672_100123822 3300005543 Unclassified 2119
77 Ga0070686_100002304 3300005544 Bacteria 10541
78 Ga0070686_100064604 3300005544 Unclassified 2374
79 Ga0070686_100181967 3300005544 Bacteria 1494
80 Ga0070696_100228959 3300005546 Bacteria 1398
81 Ga0070693_100110345 3300005547 Unclassified 1691
82 Ga0070665_100058289 3300005548 Bacteria 3872
83 Ga0070665_100154788 3300005548 Bacteria 2294
84 Ga0070665_102199043 3300005548 Unclassified 555
85 Ga0070704_100309786 3300005549 Bacteria 1319
86 Ga0070704_100409222 3300005549 Bacteria 1159
87 Ga0068855_100036232 3300005563 Bacteria 5873
88 Ga0068855_101657745 3300005563 Unclassified 653
89 Ga0070664_100001727 3300005564 Bacteria 17490
90 Ga0070664_100288943 3300005564 Bacteria 1480
91 Ga0070664_100500456 3300005564 Unclassified 1120
92 Ga0070664_100523264 3300005564 Bacteria 1095
93 Ga0068854_100034423 3300005578 Bacteria 3538
94 Ga0068854_100157911 3300005578 Unclassified 1754
95 Ga0070702_100095727 3300005615 Bacteria 1810
96 Ga0070702_100117942 3300005615 Bacteria 1657
97 Ga0068852_100696661 3300005616 Bacteria 1026
98 Ga0068852_100975017 3300005616 Unclassified 866
99 Ga0068859_100024373 3300005617 Bacteria 6069
100 Ga0068859_100072257 3300005617 Unclassified 3487
101 Ga0068859_100459647 3300005617 Bacteria 1369
102 Ga0068859_101003455 3300005617 Bacteria 917
103 Ga0068864_100250791 3300005618 Unclassified 1643
104 Ga0068866_10058250 3300005718 Bacteria 1994
105 Ga0068866_10243773 3300005718 Bacteria 1096
106 Ga0068861_100046537 3300005719 Bacteria 3271
107 Ga0068861_100051852 3300005719 Bacteria 3117
108 Ga0068861_100083956 3300005719 Bacteria 2499
109 Ga0068861_100185474 3300005719 Bacteria 1735
110 Ga0068861_100346884 3300005719 Bacteria 1301
111 Ga0068861_100414516 3300005719 Bacteria 1199
112 Ga0068861_100701401 3300005719 Bacteria 940
113 Ga0068851_10203003 3300005834 Unclassified 1107
114 Ga0068870_10002654 3300005840 Bacteria 7486
115 Ga0068870_10351880 3300005840 Unclassified 945
116 Ga0068863_100003179 3300005841 Bacteria 16242
117 Ga0068863_100078696 3300005841 Bacteria 3122
118 Ga0068863_100234177 3300005841 Unclassified 1772
119 Ga0068858_100016560 3300005842 Bacteria 6923
120 Ga0068858_100164515 3300005842 Bacteria 2090
121 Ga0068858_100369014 3300005842 Unclassified 1376
122 Ga0068860_100701948 3300005843 Unclassified 1021
123 Ga0068860_102259911 3300005843 Bacteria 565
124 Ga0068862_100065569 3300005844 Bacteria 3128
125 Ga0068862_100585382 3300005844 Bacteria 1069
126 Ga0075365_10004468 3300006038 Bacteria 7414
127 Ga0075368_10002351 3300006042 Bacteria 6147
128 Ga0075363_100121864 3300006048 Bacteria 1457
129 Ga0075364_10148435 3300006051 Bacteria 1579
130 Ga0075364_10247898 3300006051 Bacteria 1210
131 Ga0070716_101020165 3300006173 Bacteria 655
132 Ga0070712_100214097 3300006175 Archaea 1521
133 Ga0075362_10216872 3300006177 Bacteria 934
134 Ga0075367_10005067 3300006178 Bacteria 6503
135 Ga0075366_10006074 3300006195 Bacteria 6581
136 Ga0075366_10129646 3300006195 Unclassified 1522
137 Ga0097621_100034717 3300006237 Unclassified 4025
138 Ga0097621_100156338 3300006237 Unclassified 1957
139 Ga0097621_100525119 3300006237 Bacteria 1075
140 Ga0097621_101081302 3300006237 Bacteria 752
141 Ga0075370_10008458 3300006353 Bacteria 5296
142 Ga0075370_10043977 3300006353 Bacteria 2524
143 Ga0068871_100098433 3300006358 Unclassified 2447
144 Ga0068871_100166444 3300006358 Bacteria 1887
145 Ga0075428_100016864 3300006844 Bacteria 8065
146 Ga0075428_100506543 3300006844 Unclassified 1291
147 Ga0075428_101126052 3300006844 Bacteria 829
148 Ga0075430_100301637 3300006846 Bacteria 1325
149 Ga0075431_100408157 3300006847 Bacteria 1359
150 Ga0075431_100561118 3300006847 Unclassified 1128
151 Ga0075433_10012797 3300006852 Bacteria 6795
152 Ga0075433_10271734 3300006852 Bacteria 1502
153 Ga0075434_100000320 3300006871 Bacteria 34322
154 Ga0075434_100015035 3300006871 Bacteria 7411
155 Ga0075434_100285259 3300006871 Unclassified 1671
156 Ga0075434_100838317 3300006871 Bacteria 935
157 Ga0075429_100186498 3300006880 Unclassified 1818
158 Ga0068865_100068357 3300006881 Bacteria 2511
159 Ga0068865_100092950 3300006881 Bacteria 2192
160 Ga0068865_100295864 3300006881 Bacteria 1294
161 Ga0075436_100000078 3300006914 Bacteria 55590
162 Ga0075436_100056920 3300006914 Bacteria 2700
163 Ga0075436_100208961 3300006914 Unclassified 1383
164 Ga0097620_100024373 3300006931 Bacteria 6069
165 Ga0097620_100072256 3300006931 Unclassified 3487
166 Ga0097620_100459574 3300006931 Bacteria 1369
167 Ga0097620_101003395 3300006931 Bacteria 917
168 Ga0075435_100000103 3300007076 Bacteria 45851
169 Ga0075435_100010310 3300007076 Bacteria 6827
170 Ga0075435_100023419 3300007076 Bacteria 4777
171 Ga0075435_100037175 3300007076 Bacteria 3875
172 Ga0075435_100044757 3300007076 Unclassified 3546
173 Ga0075435_100068087 3300007076 Unclassified 2899
174 Ga0075435_100483122 3300007076 Bacteria 1070
175 Ga0111539_10015031 3300009094 Bacteria 9647
176 Ga0111539_11060609 3300009094 Bacteria 942
177 Ga0105245_10159160 3300009098 Bacteria 2141
178 Ga0114129_10000291 3300009147 Bacteria 57858
179 Ga0114129_10646859 3300009147 Bacteria 1365
180 Ga0105243_10023777 3300009148 Bacteria 4670
181 Ga0105243_10051396 3300009148 Bacteria 3260
182 Ga0105243_10475102 3300009148 Bacteria 1179
183 Ga0105242_10039674 3300009176 Bacteria 3790
184 Ga0105248_10035470 3300009177 Bacteria 5579
185 Ga0105248_10072800 3300009177 Bacteria 3862
186 Ga0105248_10103347 3300009177 Unclassified 3212
187 Ga0105248_10117039 3300009177 Bacteria 3006
188 Ga0105248_10183233 3300009177 Unclassified 2360
189 Ga0105248_10620757 3300009177 Unclassified 1220
190 Ga0105249_10027660 3300009553 Bacteria 5117
191 Ga0105249_10102241 3300009553 Bacteria 2697
192 Ga0105239_11202633 3300010375 Unclassified 873
193 Ga0105246_10250339 3300011119 Bacteria 1406
194 Ga0157374_11185752 3300013296 Unclassified 785
195 Ga0157375_10026354 3300013308 Bacteria 5416
196 Ga0157375_10060916 3300013308 Bacteria 3745
197 Ga0157375_10295559 3300013308 Bacteria 1783
198 Ga0163163_10017388 3300014325 Bacteria 6705
199 Ga0157380_10151269 3300014326 Bacteria 2007
200 Ga0157377_10029012 3300014745 Bacteria 2984
201 Ga0157379_10065815 3300014968 Unclassified 3240
202 Ga0157379_10077285 3300014968 Bacteria 2981
203 Ga0157376_10339199 3300014969 Unclassified 1435
204 Ga0157376_10887782 3300014969 Unclassified 909
205 Ga0163161_10188826 3300017792 Unclassified 1583
206 Ga0207697_10000736 3300025315 Bacteria 18593
207 Ga0207697_10091045 3300025315 Bacteria 1292
208 Ga0207642_10171793 3300025899 Bacteria 1173
209 Ga0207642_10872461 3300025899 Bacteria 575
210 Ga0207688_10032448 3300025901 Unclassified 2886
211 Ga0207647_10171611 3300025904 Unclassified 1262
212 Ga0207699_10246168 3300025906 Bacteria 1230
213 Ga0207645_10164150 3300025907 Bacteria 1454
214 Ga0207643_10048749 3300025908 Bacteria 2400
215 Ga0207684_10977081 3300025910 Bacteria 709
216 Ga0207707_10584907 3300025912 Bacteria 946
217 Ga0207693_10338053 3300025915 Unclassified 1178
218 Ga0207660_10085363 3300025917 Unclassified 2328
219 Ga0207662_10011957 3300025918 Bacteria 4828
220 Ga0207662_10015124 3300025918 Bacteria 4337
221 Ga0207646_10006641 3300025922 Bacteria 11927
222 Ga0207681_10128594 3300025923 Unclassified 1869
223 Ga0207681_10189485 3300025923 Unclassified 1572
224 Ga0207659_10071271 3300025926 Bacteria 2537
225 Ga0207659_10171669 3300025926 Bacteria 1711
226 Ga0207659_10614336 3300025926 Unclassified 927
227 Ga0207687_10296991 3300025927 Bacteria 1300
228 Ga0207644_10008687 3300025931 Bacteria 6648
229 Ga0207644_10437206 3300025931 Unclassified 1074
230 Ga0207644_11065275 3300025931 Unclassified 679
231 Ga0207690_10190885 3300025932 Bacteria 1549
232 Ga0207706_10028825 3300025933 Bacteria 4956
233 Ga0207706_10094314 3300025933 Unclassified 2632
234 Ga0207686_10059365 3300025934 Bacteria 2416
235 Ga0207686_10564175 3300025934 Bacteria 892
236 Ga0207709_10219649 3300025935 Bacteria 1370
237 Ga0207709_10579775 3300025935 Bacteria 886
238 Ga0207670_10001567 3300025936 Bacteria 11996
239 Ga0207670_10022398 3300025936 Bacteria 3915
240 Ga0207669_10028094 3300025937 Bacteria 3090
241 Ga0207669_10177601 3300025937 Bacteria 1523
242 Ga0207669_10622343 3300025937 Bacteria 880
243 Ga0207704_10110260 3300025938 Bacteria 1858
244 Ga0207704_10341002 3300025938 Bacteria 1163
245 Ga0207691_10018608 3300025940 Bacteria 6583
246 Ga0207691_10020473 3300025940 Bacteria 6254
247 Ga0207691_10130918 3300025940 Unclassified 2216
248 Ga0207711_10029459 3300025941 Unclassified 4631
249 Ga0207711_10279183 3300025941 Bacteria 1538
250 Ga0207711_10337638 3300025941 Bacteria 1394
251 Ga0207711_10341986 3300025941 Bacteria 1385
252 Ga0207711_11091211 3300025941 Unclassified 739
253 Ga0207689_10065606 3300025942 Bacteria 2986
254 Ga0207689_10120368 3300025942 Unclassified 2159
255 Ga0207679_10234330 3300025945 Bacteria 1552
256 Ga0207667_10379773 3300025949 Bacteria 1440
257 Ga0207651_10060183 3300025960 Bacteria 2635
258 Ga0207651_10149393 3300025960 Unclassified 1817
259 Ga0207651_11077902 3300025960 Unclassified 719
260 Ga0207712_10050341 3300025961 Unclassified 2908
261 Ga0207712_10296185 3300025961 Bacteria 1326
262 Ga0207712_11754098 3300025961 Unclassified 556
263 Ga0207668_10749604 3300025972 Bacteria 861
264 Ga0207640_10067068 3300025981 Unclassified 2399
265 Ga0207640_10879814 3300025981 Bacteria 781
266 Ga0207677_10090499 3300026023 Unclassified 2224
267 Ga0207677_10192270 3300026023 Bacteria 1615
268 Ga0207703_10124664 3300026035 Bacteria 2216
269 Ga0207703_10209297 3300026035 Unclassified 1738
270 Ga0207703_10307651 3300026035 Unclassified 1447
271 Ga0207703_10565459 3300026035 Bacteria 1073
272 Ga0207678_10002649 3300026067 Bacteria 16273
273 Ga0207708_10004115 3300026075 Bacteria 10707
274 Ga0207708_10104468 3300026075 Unclassified 2195
275 Ga0207708_11675410 3300026075 Bacteria 559
276 Ga0207641_10138941 3300026088 Bacteria 2189
277 Ga0207641_10211925 3300026088 Unclassified 1792
278 Ga0207648_10001115 3300026089 Bacteria 30161
279 Ga0207648_10173553 3300026089 Unclassified 1906
280 Ga0207648_10492333 3300026089 Bacteria 1121
281 Ga0207676_10271771 3300026095 Bacteria 1535
282 Ga0207676_10355115 3300026095 Unclassified 1357
283 Ga0207674_10241034 3300026116 Unclassified 1755
284 Ga0207675_100010564 3300026118 Bacteria 8650
285 Ga0207675_100028338 3300026118 Bacteria 5215
286 Ga0207675_100057705 3300026118 Bacteria 3622
287 Ga0207675_100235711 3300026118 Unclassified 1767
288 Ga0207675_100262245 3300026118 Bacteria 1675
289 Ga0207683_10030163 3300026121 Bacteria 4698
290 Ga0207698_10161531 3300026142 Unclassified 1960
291 Ga0207698_11412548 3300026142 Bacteria 711
292 Ga0209971_1025759 3300027682 Unclassified 1405
293 Ga0209813_10003258 3300027866 Bacteria 3791
294 Ga0209813_10052131 3300027866 Unclassified 1282
295 Ga0207428_10000311 3300027907 Bacteria 64550
296 Ga0207428_10416729 3300027907 Unclassified 982
297 Ga0268266_10078993 3300028379 Bacteria 2864
298 Ga0268266_10256111 3300028379 Bacteria 1620
299 Ga0268266_10891591 3300028379 Bacteria 860
300 Ga0268265_10076194 3300028380 Unclassified 2630
301 Ga0268265_10355820 3300028380 Bacteria 1338
302 Ga0268265_10712657 3300028380 Unclassified 970
303 Ga0268265_11342113 3300028380 Unclassified 716
304 Ga0268264_10021686 3300028381 Bacteria 5244
305 Ga0268264_10872673 3300028381 Unclassified 902
306 Ga0307408_100083434 3300031548 Bacteria 2394
307 Ga0307405_10113855 3300031731 Bacteria 1837
308 Ga0307413_10186626 3300031824 Unclassified 1484
309 Ga0307413_10918918 3300031824 Bacteria 744
310 Ga0307410_10006241 3300031852 Bacteria 6415
311 Ga0307410_10095742 3300031852 Bacteria 2117
312 Ga0307406_10013567 3300031901 Bacteria 4671
313 Ga0307406_10052538 3300031901 Bacteria 2592
314 Ga0307412_10087606 3300031911 Bacteria 2169
315 Ga0307409_100190168 3300031995 Bacteria 1826
316 Ga0307416_100000935 3300032002 Bacteria 15453
317 Ga0307416_100013851 3300032002 Bacteria 5497
318 Ga0307414_10048801 3300032004 Bacteria 2923
319 Ga0307411_10533211 3300032005 Unclassified 998
320 Ga0307411_10672451 3300032005 Bacteria 899
321 Ga0307415_100001987 3300032126 Bacteria 10059
322 Ga0307415_100600292 3300032126 Unclassified 979
323 Ga0373930_0000781 3300034816 Bacteria 4526
324 Ga0373948_0000595 3300034817 Bacteria 4635
325 Ga0373950_0006081 3300034818 Bacteria 1826
326 Ga0373958_0001290 3300034819 Bacteria 3350
327 Ga0373959_0032674 3300034820 Bacteria 1059
328 Ga0373938_0002603 3300034957 Bacteria 2909
329 Ga0373928_0000907 3300035084 Bacteria 5801
330 Ga0373929_0000615 3300035085 Bacteria 6872
331 Ga0373940_0012337 3300035088 Unclassified 2046
332 Ga0373949_0001719 3300035090 Bacteria 6059
333 Ga0373951_0000293 3300035091 Bacteria 15927
334 Ga0373952_0002104 3300035092 Bacteria 3580
335 Ga0373932_0003645 3300035112 Bacteria 3682
336 Ga0373939_0000600 3300035114 Bacteria 8956
337 Ga0373941_0076152 3300035115 Unclassified 1124
338 Ga0373960_0000086 3300035121 Bacteria 13908
339 Ga0373942_0000826 3300035207 Bacteria 8541
340 Ga0373961_0001190 3300035241 Bacteria 8042
341 Ga0373962_0000830 3300035242 Bacteria 7054
342 Ga0373931_0006833 3300035691 Bacteria 5364
343 Ga0373931_0079928 3300035691 Unclassified 1802
344 Ga0395905_1289267 3300037471 Unclassified 634
345 Ga0451853_1192818 3300041512 Bacteria 1358
346 Ga0450920_004768 3300042122 Unclassified 2397
347 Ga0450895_000954 3300042132 Bacteria 1880
348 Ga0450908_000803 3300042184 Bacteria 6030
349 Ga0439464_0005136 3300042439 Bacteria 3371
350 Ga0451576_0007921 3300045051 Bacteria 12574
351 Ga0495656_0146605 3300046615 Bacteria 1137
352 Ga0495669_0022661 3300046684 Bacteria 2729
353 Ga0496100_1333128 3300048903 Bacteria 566
354 Ga0496101_0578262 3300048904 Bacteria 888
355 Ga0496102_0145422 3300048905 Bacteria 2225
356 Ga0496102_0296639 3300048905 Bacteria 1524
357 Ga0496102_0505333 3300048905 Bacteria 1131
358 Ga0496104_0795197 3300048907 Bacteria 852
359 Ga0496106_0509796 3300048909 Unclassified 966
360 Ga0496106_0547718 3300048909 Bacteria 928
361 Ga0496108_0198676 3300048911 Bacteria 1740
362 Ga0496109_1177879 3300048912 Unclassified 703
363 Ga0496112_0079713 3300048915 Bacteria 3239
364 Ga0496113_0505604 3300048916 Unclassified 970
365 Ga0501291_031170 3300049514 Unclassified 900
366 Ga0501031_0262366 3300049568 Unclassified 1122
367 Ga0501031_0412633 3300049568 Unclassified 873
368 Ga0501034_0119934 3300049571 Unclassified 2617
369 Ga0501036_0058010 3300049572 Bacteria 3280
370 Ga0501036_0744067 3300049572 Bacteria 809
371 Ga0501039_0273004 3300049575 Bacteria 1329
372 Ga0501040_0039392 3300049576 Bacteria 3214
373 Ga0501040_0065135 3300049576 Bacteria 2510
374 Ga0501040_0323382 3300049576 Bacteria 1103
375 Ga0501041_0028058 3300049577 Unclassified 3395
376 Ga0501042_0006841 3300049578 Bacteria 7440
377 Ga0501042_0116417 3300049578 Bacteria 1924
378 Ga0501042_0551941 3300049578 Unclassified 837
379 Ga0501046_0068375 3300049580 Bacteria 2765
380 Ga0501047_0422227 3300049581 Archaea 1165
381 Ga0501048_0013841 3300049582 Bacteria 5984
382 Ga0501048_0090901 3300049582 Bacteria 2153
383 Ga0501048_0919035 3300049582 Unclassified 629
384 Ga0501067_0108445 3300049583 Bacteria 1544
385 Ga0501071_0053628 3300049587 Bacteria 2908
386 Ga0501071_0272917 3300049587 Unclassified 1279
387 Ga0501074_0481825 3300049590 Unclassified 879
388 Ga0501075_0170766 3300049591 Bacteria 1659
389 Ga0501075_0413377 3300049591 Bacteria 1029
390 Ga0501076_0037228 3300049592 Bacteria 3814
391 Ga0501076_0391639 3300049592 Bacteria 1142
392 Ga0501225_0024623 3300049705 Bacteria 1657
393 Ga0501079_0053309 3300049741 Bacteria 3120
394 Ga0501080_0669712 3300049742 Bacteria 917
395 Ga0501081_0089782 3300049743 Bacteria 2159
396 Ga0501081_0473631 3300049743 Bacteria 932
397 Ga0501045_0018126 3300049824 Bacteria 5003
398 Ga0501045_0185464 3300049824 Unclassified 1550
399 Ga0501045_0322192 3300049824 Bacteria 1150
400 nmdc:mga03683_3779_c1 3300050489 Bacteria 4936
401 nmdc:mga03n38_112945_c1 3300050490 Unclassified 1325
402 nmdc:mga03n38_340558_c1 3300050490 Bacteria 814
403 nmdc:mga00v17_20583_c1 3300050491 Bacteria 3782
404 nmdc:mga00v17_256174_c1 3300050491 Unclassified 1135
405 nmdc:mga0yw44_27556_c1 3300050492 Bacteria 3256
406 nmdc:mga0k408_16335_c1 3300050493 Bacteria 4118
407 nmdc:mga0k408_4772_c1 3300050493 Bacteria 6557
408 nmdc:mga0k408_57703_c1 3300050493 Bacteria 2254
409 nmdc:mga06z11_40984_c1 3300050494 Bacteria 2315
410 nmdc:mga06z11_4258_c1 3300050494 Bacteria 5614
411 nmdc:mga06z11_46429_c1 3300050494 Bacteria 2201
412 nmdc:mga04h51_46750_c1 3300050495 Unclassified 1436
413 nmdc:mga04h51_72864_c1 3300050495 Unclassified 1203
414 nmdc:mga07m45_19097_c1 3300050496 Bacteria 3710
415 nmdc:mga07m45_63387_c1 3300050496 Bacteria 2096
416 nmdc:mga05p37_485134_c1 3300050507 Bacteria 1422
417 nmdc:mga05p37_563_c1 3300050507 Bacteria 40811
418 nmdc:mga09592_97729_c1 3300050508 Bacteria 2513
419 nmdc:mga06r32_214021_c1 3300050510 Bacteria 1915
420 nmdc:mga06r32_923465_c1 3300050510 Bacteria 828
421 nmdc:mga08y16_221081_c1 3300050511 Bacteria 1961
422 nmdc:mga08y16_5390_c1 3300050511 Bacteria 13375
423 nmdc:mga0n895_22690_c1 3300050512 Bacteria 5886
424 nmdc:mga0n895_653267_c1 3300050512 Unclassified 1050
425 nmdc:mga0n895_686240_c1 3300050512 Bacteria 1021
426 nmdc:mga0rr50_183630_c1 3300050513 Unclassified 1711
427 nmdc:mga0rr50_49278_c1 3300050513 Bacteria 3118
428 nmdc:mga0rr50_528_c1 3300050513 Bacteria 20402
429 nmdc:mga0rr50_5_c1 3300050513 Bacteria 327169
430 nmdc:mga08x19_173175_c1 3300050514 Bacteria 1471
431 nmdc:mga08x19_51936_c1 3300050514 Bacteria 2635
432 nmdc:mga08x19_77_c1 3300050514 Bacteria 91801
433 nmdc:mga0a205_1670_c1 3300050515 Bacteria 19129
434 nmdc:mga0a205_27482_c1 3300050515 Bacteria 5432
435 Ga0501084_0089476 3300054114 Bacteria 2584
436 Ga0501084_0536061 3300054114 Bacteria 989
437 Ga0590071_012379 3300059421 Bacteria 1998
438 Ga0590071_053234 3300059421 Bacteria 983
439 Ga0590077_018108 3300059426 Unclassified 1485
440 Ga0590077_058936 3300059426 Bacteria 869
441 Ga0501082_0162794 3300060353 Bacteria 1939
442 Ga0530510_0199659 3300061734 Unclassified 1485
443 nmdc:mga0n895_24_c1
444 JGI24035J26624_1004247
445 JGI24035J26624_1004361
446 Ga0065707_10004752
447 Ga0065707_10242539
448 Ga0070690_100004294
449 Ga0070677_10029030
450 Ga0070677_10073773
451 Ga0068869_100092199
452 Ga0070666_10022281
453 Ga0070666_10034035
454 Ga0070666_10397665
455 Ga0070689_100037938
456 Ga0070689_100068495
457 Ga0070687_100011275
458 Ga0070687_100026599
459 Ga0070661_100219060
460 Ga0070661_100873253
461 Ga0070668_100068327
462 Ga0070668_100126897
463 Ga0070668_100360461
464 Ga0070669_100038311
465 Ga0070669_100126567
466 Ga0070669_100181578
467 Ga0070675_100030548
468 Ga0070675_100115869
469 Ga0070675_100231958
470 Ga0070671_100025490
471 Ga0070674_100002926
472 Ga0070674_100130209
473 Ga0070674_100309076
474 Ga0070674_100336131
475 Ga0070673_100128796
476 Ga0070673_100335864
477 Ga0070673_100387278
478 Ga0070688_100006651
479 Ga0070688_100070300
480 Ga0070688_100103746
481 Ga0070688_100330981
482 Ga0070659_100249293
483 Ga0070659_101079173
484 Ga0070667_100063627
485 Ga0070667_100463998
486 Ga0070667_100626304
487 Ga0070709_10186207
488 Ga0070711_100718600
489 Ga0070700_100953083
490 Ga0070694_100107166
491 Ga0070694_100338023
492 Ga0070708_100025689
493 Ga0070663_100239385
494 Ga0070663_100297954
495 Ga0070678_100014332
496 Ga0070662_100100371
497 Ga0070662_100455235
498 Ga0070681_10046648
499 Ga0068867_100033108
500 Ga0070685_10009438
501 Ga0070685_10102091
502 Ga0070685_10219376
503 Ga0070685_10556972
504 Ga0070706_100205325
505 Ga0070706_101643848
506 Ga0070707_100062372
507 Ga0070707_101729756
508 Ga0070698_100368485
509 Ga0070698_100540732
510 Ga0070698_100916873
511 Ga0070698_100970686
512 Ga0070679_100103077
513 Ga0070684_100303520
514 Ga0068853_101414372
515 Ga0070672_100034077
516 Ga0070672_100038949
517 Ga0070672_100040393
518 Ga0070672_100123822
519 Ga0070686_100002304
520 Ga0070686_100064604
521 Ga0070686_100181967
522 Ga0070696_100228959
523 Ga0070693_100110345
524 Ga0070665_100058289
525 Ga0070665_100154788
526 Ga0070665_102199043
527 Ga0070704_100309786
528 Ga0070704_100409222
529 Ga0068855_100036232
530 Ga0068855_101657745
531 Ga0070664_100001727
532 Ga0070664_100288943
533 Ga0070664_100500456
534 Ga0070664_100523264
535 Ga0068854_100034423
536 Ga0068854_100157911
537 Ga0070702_100095727
538 Ga0070702_100117942
539 Ga0068852_100696661
540 Ga0068852_100975017
541 Ga0068859_100024373
542 Ga0068859_100072257
543 Ga0068859_100459647
544 Ga0068859_101003455
545 Ga0068864_100250791
546 Ga0068866_10058250
547 Ga0068866_10243773
548 Ga0068861_100046537
549 Ga0068861_100051852
550 Ga0068861_100083956
551 Ga0068861_100185474
552 Ga0068861_100346884
553 Ga0068861_100414516
554 Ga0068861_100701401
555 Ga0068851_10203003
556 Ga0068870_10002654
557 Ga0068870_10351880
558 Ga0068863_100003179
559 Ga0068863_100078696
560 Ga0068863_100234177
561 Ga0068858_100016560
562 Ga0068858_100164515
563 Ga0068858_100369014
564 Ga0068860_100701948
565 Ga0068860_102259911
566 Ga0068862_100065569
567 Ga0068862_100585382
568 Ga0075365_10004468
569 Ga0075368_10002351
570 Ga0075363_100121864
571 Ga0075364_10148435
572 Ga0075364_10247898
573 Ga0070716_101020165
574 Ga0070712_100214097
575 Ga0075362_10216872
576 Ga0075367_10005067
577 Ga0075366_10006074
578 Ga0075366_10129646
579 Ga0097621_100034717
580 Ga0097621_100156338
581 Ga0097621_100525119
582 Ga0097621_101081302
583 Ga0075370_10008458
584 Ga0075370_10043977
585 Ga0068871_100098433
586 Ga0068871_100166444
587 Ga0075428_100016864
588 Ga0075428_100506543
589 Ga0075428_101126052
590 Ga0075430_100301637
591 Ga0075431_100408157
592 Ga0075431_100561118
593 Ga0075433_10012797
594 Ga0075433_10271734
595 Ga0075434_100000320
596 Ga0075434_100015035
597 Ga0075434_100285259
598 Ga0075434_100838317
599 Ga0075429_100186498
600 Ga0068865_100068357
601 Ga0068865_100092950
602 Ga0068865_100295864
603 Ga0075436_100000078
604 Ga0075436_100056920
605 Ga0075436_100208961
606 Ga0097620_100024373
607 Ga0097620_100072256
608 Ga0097620_100459574
609 Ga0097620_101003395
610 Ga0075435_100000103
611 Ga0075435_100010310
612 Ga0075435_100023419
613 Ga0075435_100037175
614 Ga0075435_100044757
615 Ga0075435_100068087
616 Ga0075435_100483122
617 Ga0111539_10015031
618 Ga0111539_11060609
619 Ga0105245_10159160
620 Ga0114129_10000291
621 Ga0114129_10646859
622 Ga0105243_10023777
623 Ga0105243_10051396
624 Ga0105243_10475102
625 Ga0105242_10039674
626 Ga0105248_10035470
627 Ga0105248_10072800
628 Ga0105248_10103347
629 Ga0105248_10117039
630 Ga0105248_10183233
631 Ga0105248_10620757
632 Ga0105249_10027660
633 Ga0105249_10102241
634 Ga0105239_11202633
635 Ga0105246_10250339
636 Ga0157374_11185752
637 Ga0157375_10026354
638 Ga0157375_10060916
639 Ga0157375_10295559
640 Ga0163163_10017388
641 Ga0157380_10151269
642 Ga0157377_10029012
643 Ga0157379_10065815
644 Ga0157379_10077285
645 Ga0157376_10339199
646 Ga0157376_10887782
647 Ga0163161_10188826
648 Ga0207697_10000736
649 Ga0207697_10091045
650 Ga0207642_10171793
651 Ga0207642_10872461
652 Ga0207688_10032448
653 Ga0207647_10171611
654 Ga0207699_10246168
655 Ga0207645_10164150
656 Ga0207643_10048749
657 Ga0207684_10977081
658 Ga0207707_10584907
659 Ga0207693_10338053
660 Ga0207660_10085363
661 Ga0207662_10011957
662 Ga0207662_10015124
663 Ga0207646_10006641
664 Ga0207681_10128594
665 Ga0207681_10189485
666 Ga0207659_10071271
667 Ga0207659_10171669
668 Ga0207659_10614336
669 Ga0207687_10296991
670 Ga0207644_10008687
671 Ga0207644_10437206
672 Ga0207644_11065275
673 Ga0207690_10190885
674 Ga0207706_10028825
675 Ga0207706_10094314
676 Ga0207686_10059365
677 Ga0207686_10564175
678 Ga0207709_10219649
679 Ga0207709_10579775
680 Ga0207670_10001567
681 Ga0207670_10022398
682 Ga0207669_10028094
683 Ga0207669_10177601
684 Ga0207669_10622343
685 Ga0207704_10110260
686 Ga0207704_10341002
687 Ga0207691_10018608
688 Ga0207691_10020473
689 Ga0207691_10130918
690 Ga0207711_10029459
691 Ga0207711_10279183
692 Ga0207711_10337638
693 Ga0207711_10341986
694 Ga0207711_11091211
695 Ga0207689_10065606
696 Ga0207689_10120368
697 Ga0207679_10234330
698 Ga0207667_10379773
699 Ga0207651_10060183
700 Ga0207651_10149393
701 Ga0207651_11077902
702 Ga0207712_10050341
703 Ga0207712_10296185
704 Ga0207712_11754098
705 Ga0207668_10749604
706 Ga0207640_10067068
707 Ga0207640_10879814
708 Ga0207677_10090499
709 Ga0207677_10192270
710 Ga0207703_10124664
711 Ga0207703_10209297
712 Ga0207703_10307651
713 Ga0207703_10565459
714 Ga0207678_10002649
715 Ga0207708_10004115
716 Ga0207708_10104468
717 Ga0207708_11675410
718 Ga0207641_10138941
719 Ga0207641_10211925
720 Ga0207648_10001115
721 Ga0207648_10173553
722 Ga0207648_10492333
723 Ga0207676_10271771
724 Ga0207676_10355115
725 Ga0207674_10241034
726 Ga0207675_100010564
727 Ga0207675_100028338
728 Ga0207675_100057705
729 Ga0207675_100235711
730 Ga0207675_100262245
731 Ga0207683_10030163
732 Ga0207698_10161531
733 Ga0207698_11412548
734 Ga0209971_1025759
735 Ga0209813_10003258
736 Ga0209813_10052131
737 Ga0207428_10000311
738 Ga0207428_10416729
739 Ga0268266_10078993
740 Ga0268266_10256111
741 Ga0268266_10891591
742 Ga0268265_10076194
743 Ga0268265_10355820
744 Ga0268265_10712657
745 Ga0268265_11342113
746 Ga0268264_10021686
747 Ga0268264_10872673
748 Ga0307408_100083434
749 Ga0307405_10113855
750 Ga0307413_10186626
751 Ga0307413_10918918
752 Ga0307410_10006241
753 Ga0307410_10095742
754 Ga0307406_10013567
755 Ga0307406_10052538
756 Ga0307412_10087606
757 Ga0307409_100190168
758 Ga0307416_100000935
759 Ga0307416_100013851
760 Ga0307414_10048801
761 Ga0307411_10533211
762 Ga0307411_10672451
763 Ga0307415_100001987
764 Ga0307415_100600292
765 Ga0373930_0000781
766 Ga0373948_0000595
767 Ga0373950_0006081
768 Ga0373958_0001290
769 Ga0373959_0032674
770 Ga0373938_0002603
771 Ga0373928_0000907
772 Ga0373929_0000615
773 Ga0373940_0012337
774 Ga0373949_0001719
775 Ga0373951_0000293
776 Ga0373952_0002104
777 Ga0373932_0003645
778 Ga0373939_0000600
779 Ga0373941_0076152
780 Ga0373960_0000086
781 Ga0373942_0000826
782 Ga0373961_0001190
783 Ga0373962_0000830
784 Ga0373931_0006833
785 Ga0373931_0079928
786 Ga0395905_1289267
787 Ga0451853_1192818
788 Ga0450920_004768
789 Ga0450895_000954
790 Ga0450908_000803
791 Ga0439464_0005136
792 Ga0451576_0007921
793 Ga0495656_0146605
794 Ga0495669_0022661
795 Ga0496100_1333128
796 Ga0496101_0578262
797 Ga0496102_0145422
798 Ga0496102_0296639
799 Ga0496102_0505333
800 Ga0496104_0795197
801 Ga0496106_0509796
802 Ga0496106_0547718
803 Ga0496108_0198676
804 Ga0496109_1177879
805 Ga0496112_0079713
806 Ga0496113_0505604
807 Ga0501291_031170
808 Ga0501031_0262366
809 Ga0501031_0412633
810 Ga0501034_0119934
811 Ga0501036_0058010
812 Ga0501036_0744067
813 Ga0501039_0273004
814 Ga0501040_0039392
815 Ga0501040_0065135
816 Ga0501040_0323382
817 Ga0501041_0028058
818 Ga0501042_0006841
819 Ga0501042_0116417
820 Ga0501042_0551941
821 Ga0501046_0068375
822 Ga0501047_0422227
823 Ga0501048_0013841
824 Ga0501048_0090901
825 Ga0501048_0919035
826 Ga0501067_0108445
827 Ga0501071_0053628
828 Ga0501071_0272917
829 Ga0501074_0481825
830 Ga0501075_0170766
831 Ga0501075_0413377
832 Ga0501076_0037228
833 Ga0501076_0391639
834 Ga0501225_0024623
835 Ga0501079_0053309
836 Ga0501080_0669712
837 Ga0501081_0089782
838 Ga0501081_0473631
839 Ga0501045_0018126
840 Ga0501045_0185464
841 Ga0501045_0322192
842 nmdc:mga03683_3779_c1
843 nmdc:mga03n38_112945_c1
844 nmdc:mga03n38_340558_c1
845 nmdc:mga00v17_20583_c1
846 nmdc:mga00v17_256174_c1
847 nmdc:mga0yw44_27556_c1
848 nmdc:mga0k408_16335_c1
849 nmdc:mga0k408_4772_c1
850 nmdc:mga0k408_57703_c1
851 nmdc:mga06z11_40984_c1
852 nmdc:mga06z11_4258_c1
853 nmdc:mga06z11_46429_c1
854 nmdc:mga04h51_46750_c1
855 nmdc:mga04h51_72864_c1
856 nmdc:mga07m45_19097_c1
857 nmdc:mga07m45_63387_c1
858 nmdc:mga05p37_485134_c1
859 nmdc:mga05p37_563_c1
860 nmdc:mga09592_97729_c1
861 nmdc:mga06r32_214021_c1
862 nmdc:mga06r32_923465_c1
863 nmdc:mga08y16_221081_c1
864 nmdc:mga08y16_5390_c1
865 nmdc:mga0n895_22690_c1
866 nmdc:mga0n895_653267_c1
867 nmdc:mga0n895_686240_c1
868 nmdc:mga0rr50_183630_c1
869 nmdc:mga0rr50_49278_c1
870 nmdc:mga0rr50_528_c1
871 nmdc:mga0rr50_5_c1
872 nmdc:mga08x19_173175_c1
873 nmdc:mga08x19_51936_c1
874 nmdc:mga08x19_77_c1
875 nmdc:mga0a205_1670_c1
876 nmdc:mga0a205_27482_c1
877 Ga0501084_0089476
878 Ga0501084_0536061
879 Ga0590071_012379
880 Ga0590071_053234
881 Ga0590077_018108
882 Ga0590077_058936
883 Ga0501082_0162794
884 Ga0530510_0199659

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7unu-assembly1.cif.gz_c pseudomonas aeruginosa 70s ribosome initiation complex bound to compact if2-gdp (composite structure i-b) 0.7311 79 140
7bge-assembly1.cif.gz_c staphylococcus aureus 30s ribosomal subunit in presence of spermidine (head only) 0.7071 79 140
5iqr-assembly1.cif.gz_h error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7009 79 140
6m6v-assembly1.cif.gz_A crystal structure the toxin-antitoxin mnta-hept 0.6671 31 161
2uzh-assembly1.cif.gz_C mycobacterium smegmatis 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase (ispf) 0.643 112 141
ID Description Score Start End Superfamily
af_A4I8W6_759_915_3.30.70.790 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;UreE, C-terminal domain 0.7136 79 136 3.30.70.790
3i21C01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7082 79 140 3.30.300.20
4mjxB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain 0.6803 118 134 3.40.50.10740
1wotA00 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.6669 32 136 3.30.460.10
af_Q58701_1_124_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.6107 33 161 3.30.460.10
ID Description Score Start End GO Terms
AF-A0A538U4W8-F1-model_v4 Nucleotidyltransferase domain-containing protein 0.9795 20 161
AF-A0A2V7TWG0-F1-model_v4 Uncharacterized protein 0.9471 37 164
AF-A0A538U4W8-F1-model_v4 Nucleotidyltransferase domain-containing protein 0.9403 20 161
AF-A0A7R8AYD1-F1-model_v4 deleted 0.9383 1 162
AF-A0A143PI44-F1-model_v4 Uncharacterized protein 0.9269 2 164

Map