F444892

General Info

Members Datasets Scaffolds Average Seq Length
442 179 884 129

Family's Representative Sequence

Representative Sequence 3300025949|Ga0207667_10464113|Ga0207667_104641133
Length 156
Sequence MTPEHPNAALTRRVFGAFGKDAMQISAALCRDIVWRVPGTTAMSGEYRGRREVVEFLRRTGLETGGTYGSELHTVLANDEWGLAVYRAWGTRNGIDMDVDQALDPPQVRHHDRAQRLGELDAGRSETEQPDDGPVAHGRASPPNPPGSGRRTAPRW

Samples

Sample ID Description Type Environment
1 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
77 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
78 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
79 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
82 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
83 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
84 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
85 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
86 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
87 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
97 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
98 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
99 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
100 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
101 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
102 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
103 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
104 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
105 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
106 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
112 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
118 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
119 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
120 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
121 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
122 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
123 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
135 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
136 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
137 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
138 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
139 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
148 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
149 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
150 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
173 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
174 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
176 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
177 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
178 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
179 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.74
Metatranscriptomes 2.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 7.92
Rhizosphere 91.4
Stem 0
Stem Tuber 0
Unclassified 9.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207667_10464113 3300025949 Bacteria 1286
2 rootL2_10103408 3300003322 Bacteria 1312
3 Ga0070658_10350339 3300005327 Bacteria 1264
4 Ga0070658_11378745 3300005327 Bacteria 612
5 Ga0070683_100137997 3300005329 Bacteria 2310
6 Ga0070680_100041800 3300005336 Bacteria 3717
7 Ga0070680_100168563 3300005336 Bacteria 1842
8 Ga0070680_100374626 3300005336 Bacteria 1212
9 Ga0070682_100093487 3300005337 Bacteria 1972
10 Ga0070682_100261313 3300005337 Bacteria 1253
11 Ga0068868_100247667 3300005338 Bacteria 1499
12 Ga0070660_100118723 3300005339 Bacteria 2109
13 Ga0070660_100912663 3300005339 Bacteria 741
14 Ga0070661_100176716 3300005344 Bacteria 1623
15 Ga0070671_100326436 3300005355 Bacteria 1308
16 Ga0070671_100499719 3300005355 Bacteria 1046
17 Ga0070659_100250426 3300005366 Bacteria 1468
18 Ga0070659_100358367 3300005366 Bacteria 1225
19 Ga0070659_100533817 3300005366 Bacteria 1003
20 Ga0070714_100275573 3300005435 Bacteria 1561
21 Ga0070714_100882481 3300005435 Bacteria 868
22 Ga0070713_100560565 3300005436 Bacteria 1082
23 Ga0070710_10601692 3300005437 Bacteria 765
24 Ga0070701_11226403 3300005438 Unclassified 533
25 Ga0070711_102008059 3300005439 Bacteria 509
26 Ga0070705_100397855 3300005440 Bacteria 1019
27 Ga0070681_10028076 3300005458 Bacteria 5657
28 Ga0070681_10067988 3300005458 Bacteria 3530
29 Ga0070681_10084085 3300005458 Bacteria 3135
30 Ga0070681_10095437 3300005458 Bacteria 2923
31 Ga0070681_10095945 3300005458 Bacteria 2914
32 Ga0070681_11089190 3300005458 Bacteria 720
33 Ga0070706_100415890 3300005467 Bacteria 1251
34 Ga0070706_101048880 3300005467 Bacteria 751
35 Ga0070707_100560566 3300005468 Bacteria 1104
36 Ga0070698_100021364 3300005471 Bacteria 6780
37 Ga0070698_100436727 3300005471 Unclassified 1244
38 Ga0070698_100532418 3300005471 Bacteria 1113
39 Ga0070698_100964849 3300005471 Bacteria 799
40 Ga0070699_100551960 3300005518 Bacteria 1049
41 Ga0070679_100057969 3300005530 Bacteria 3859
42 Ga0070679_100164182 3300005530 Bacteria 2195
43 Ga0070679_100184566 3300005530 Bacteria 2057
44 Ga0070679_100238626 3300005530 Bacteria 1776
45 Ga0070679_100265918 3300005530 Bacteria 1670
46 Ga0070679_100368366 3300005530 Bacteria 1384
47 Ga0070679_101395292 3300005530 Bacteria 647
48 Ga0070679_102017508 3300005530 Unclassified 526
49 Ga0070684_100014396 3300005535 Bacteria 6408
50 Ga0070684_100099557 3300005535 Bacteria 2595
51 Ga0070684_100107618 3300005535 Bacteria 2497
52 Ga0070684_100192047 3300005535 Bacteria 1858
53 Ga0070696_100473474 3300005546 Bacteria 992
54 Ga0070693_100603291 3300005547 Bacteria 793
55 Ga0070693_100995220 3300005547 Bacteria 634
56 Ga0068855_100221979 3300005563 Bacteria 2118
57 Ga0068855_100239749 3300005563 Bacteria 2027
58 Ga0068855_100322506 3300005563 Bacteria 1707
59 Ga0068855_100766247 3300005563 Bacteria 1028
60 Ga0068857_100356678 3300005577 Bacteria 1355
61 Ga0068857_100848247 3300005577 Bacteria 874
62 Ga0068854_100337434 3300005578 Bacteria 1230
63 Ga0068856_100110227 3300005614 Bacteria 2749
64 Ga0068856_100717832 3300005614 Bacteria 1020
65 Ga0068856_100763712 3300005614 Unclassified 987
66 Ga0068856_100927566 3300005614 Bacteria 889
67 Ga0068852_100202515 3300005616 Bacteria 1879
68 Ga0068852_102562903 3300005616 Unclassified 530
69 Ga0068866_11174602 3300005718 Unclassified 553
70 Ga0070717_10002360 3300006028 Bacteria 13300
71 Ga0070717_10035711 3300006028 Bacteria 4027
72 Ga0070717_10045295 3300006028 Bacteria 3596
73 Ga0070717_10408826 3300006028 Bacteria 1220
74 Ga0070717_10746758 3300006028 Bacteria 889
75 Ga0070716_100789813 3300006173 Bacteria 734
76 Ga0070712_100635979 3300006175 Bacteria 906
77 Ga0075434_100681717 3300006871 Bacteria 1045
78 Ga0075435_100910088 3300007076 Unclassified 767
79 Ga0105240_10609606 3300009093 Bacteria 1201
80 Ga0105240_12192279 3300009093 Bacteria 573
81 Ga0105245_10101461 3300009098 Bacteria 2664
82 Ga0114129_10988611 3300009147 Bacteria 1060
83 Ga0105237_10199317 3300009545 Bacteria 2001
84 Ga0105238_10794160 3300009551 Bacteria 962
85 Ga0105238_10842778 3300009551 Bacteria 934
86 Ga0105238_11155916 3300009551 Unclassified 798
87 Ga0105239_11693802 3300010375 Bacteria 732
88 Ga0105239_11930037 3300010375 Unclassified 685
89 Ga0105239_13006324 3300010375 Bacteria 550
90 Ga0157373_10280330 3300013100 Bacteria 1181
91 Ga0157370_10022796 3300013104 Bacteria 6228
92 Ga0157370_10312868 3300013104 Bacteria 1449
93 Ga0157370_11282039 3300013104 Unclassified 660
94 Ga0157369_10005924 3300013105 Bacteria 14195
95 Ga0157369_10123823 3300013105 Bacteria 2742
96 Ga0157369_10148040 3300013105 Bacteria 2482
97 Ga0157369_10148226 3300013105 Bacteria 2481
98 Ga0157369_10429188 3300013105 Bacteria 1370
99 Ga0157369_11447882 3300013105 Bacteria 699
100 Ga0157374_10221131 3300013296 Bacteria 1858
101 Ga0157372_10156128 3300013307 Bacteria 2636
102 Ga0182008_10801270 3300014497 Bacteria 547
103 Ga0157377_11407191 3300014745 Bacteria 550
104 Ga0157376_10504488 3300014969 Unclassified 1190
105 Ga0206356_10009738 3300020070 Unclassified 856
106 Ga0206356_10014424 3300020070 Unclassified 844
107 Ga0206356_11178692 3300020070 Bacteria 2295
108 Ga0206356_11494581 3300020070 Unclassified 673
109 Ga0206354_10769378 3300020081 Bacteria 6709
110 Ga0206353_10451804 3300020082 Bacteria 803
111 Ga0206353_10510943 3300020082 Bacteria 1537
112 Ga0206353_11407569 3300020082 Bacteria 813
113 Ga0206353_11851569 3300020082 Bacteria 2409
114 Ga0206353_12064951 3300020082 Unclassified 1155
115 Ga0207705_10091134 3300025909 Bacteria 2232
116 Ga0207705_10315090 3300025909 Bacteria 1201
117 Ga0207705_10779588 3300025909 Bacteria 742
118 Ga0207705_11154737 3300025909 Unclassified 595
119 Ga0207684_10220881 3300025910 Bacteria 1635
120 Ga0207707_10052608 3300025912 Bacteria 3545
121 Ga0207707_10058920 3300025912 Bacteria 3341
122 Ga0207707_10075937 3300025912 Bacteria 2932
123 Ga0207707_10093550 3300025912 Bacteria 2626
124 Ga0207707_10105275 3300025912 Bacteria 2466
125 Ga0207707_10460695 3300025912 Bacteria 1087
126 Ga0207707_11149358 3300025912 Unclassified 631
127 Ga0207695_10446276 3300025913 Bacteria 1177
128 Ga0207693_10009488 3300025915 Bacteria 7925
129 Ga0207663_10274361 3300025916 Bacteria 1250
130 Ga0207663_11258575 3300025916 Bacteria 596
131 Ga0207660_10181875 3300025917 Bacteria 1633
132 Ga0207660_10287972 3300025917 Bacteria 1305
133 Ga0207660_10456648 3300025917 Bacteria 1033
134 Ga0207660_10485029 3300025917 Bacteria 1002
135 Ga0207660_10879639 3300025917 Unclassified 731
136 Ga0207657_10002645 3300025919 Bacteria 19337
137 Ga0207657_10006111 3300025919 Bacteria 12517
138 Ga0207657_10142336 3300025919 Bacteria 1959
139 Ga0207657_10920780 3300025919 Unclassified 673
140 Ga0207649_10082925 3300025920 Bacteria 2080
141 Ga0207649_10390530 3300025920 Bacteria 1039
142 Ga0207649_10426694 3300025920 Bacteria 996
143 Ga0207652_10118486 3300025921 Bacteria 2353
144 Ga0207652_10120120 3300025921 Bacteria 2338
145 Ga0207652_10242672 3300025921 Bacteria 1624
146 Ga0207652_10275242 3300025921 Bacteria 1518
147 Ga0207652_10472440 3300025921 Bacteria 1130
148 Ga0207652_10698023 3300025921 Bacteria 905
149 Ga0207652_10795785 3300025921 Bacteria 840
150 Ga0207652_11297659 3300025921 Unclassified 631
151 Ga0207646_10002668 3300025922 Bacteria 20905
152 Ga0207646_10418797 3300025922 Bacteria 1209
153 Ga0207694_10254049 3300025924 Bacteria 1439
154 Ga0207664_10004369 3300025929 Bacteria 9579
155 Ga0207664_10058896 3300025929 Bacteria 3057
156 Ga0207664_10130090 3300025929 Bacteria 2118
157 Ga0207664_10491795 3300025929 Bacteria 1098
158 Ga0207664_10566395 3300025929 Bacteria 1020
159 Ga0207664_10641577 3300025929 Bacteria 954
160 Ga0207664_10879396 3300025929 Bacteria 805
161 Ga0207644_10177634 3300025931 Unclassified 1667
162 Ga0207690_10298546 3300025932 Bacteria 1260
163 Ga0207690_10628386 3300025932 Bacteria 878
164 Ga0207665_10286692 3300025939 Bacteria 1227
165 Ga0207661_10007448 3300025944 Bacteria 7789
166 Ga0207661_10363558 3300025944 Bacteria 1307
167 Ga0207661_11309665 3300025944 Bacteria 666
168 Ga0207667_10343638 3300025949 Bacteria 1522
169 Ga0207667_10406427 3300025949 Bacteria 1386
170 Ga0207702_10233746 3300026078 Bacteria 1719
171 Ga0207702_10482086 3300026078 Bacteria 1207
172 Ga0207702_10878980 3300026078 Unclassified 888
173 Ga0207674_10965650 3300026116 Unclassified 821
174 Ga0207698_10354113 3300026142 Unclassified 1388
175 Ga0265338_10316706 3300028800 Bacteria 1130
176 Ga0265332_10168241 3300031238 Bacteria 915
177 Ga0265328_10250053 3300031239 Bacteria 679
178 Ga0265325_10054357 3300031241 Bacteria 2050
179 Ga0265313_10055734 3300031595 Bacteria 1871
180 Ga0265314_10197262 3300031711 Bacteria 1193
181 Ga0316583_10198289 3300032133 Bacteria 697
182 Ga0373944_0011756 3300035089 Bacteria 2403
183 Ga0373943_0001811 3300035170 Bacteria 9668
184 Ga0373946_0069723 3300035171 Bacteria 1515
185 Ga0373955_0294337 3300035172 Bacteria 978
186 Ga0373955_0435302 3300035172 Bacteria 799
187 Ga0373924_0140392 3300035410 Bacteria 1054
188 Ga0373931_0579330 3300035691 Bacteria 732
189 Ga0373931_0738014 3300035691 Bacteria 653
190 Ga0373927_0133173 3300035695 Bacteria 1624
191 Ga0373947_0139935 3300035725 Bacteria 1551
192 Ga0373925_0004822 3300037068 Bacteria 10157
193 Ga0395899_0004892 3300037312 Bacteria 10429
194 Ga0395899_0049568 3300037312 Bacteria 3121
195 Ga0395899_0128799 3300037312 Bacteria 1809
196 Ga0395899_0256544 3300037312 Bacteria 1198
197 Ga0395900_0063832 3300037418 Bacteria 3785
198 Ga0395900_0511864 3300037418 Bacteria 1149
199 Ga0395900_1258061 3300037418 Bacteria 655
200 Ga0395900_1764283 3300037418 Bacteria 529
201 Ga0395898_0093986 3300037466 Bacteria 2881
202 Ga0395898_0113409 3300037466 Bacteria 2598
203 Ga0395898_0156886 3300037466 Bacteria 2177
204 Ga0395898_0160297 3300037466 Bacteria 2151
205 Ga0395898_0271816 3300037466 Bacteria 1616
206 Ga0395898_0699060 3300037466 Bacteria 956
207 Ga0395898_0983552 3300037466 Unclassified 780
208 Ga0395905_0066673 3300037471 Bacteria 3371
209 Ga0395905_0642989 3300037471 Unclassified 962
210 Ga0395901_0111236 3300038443 Bacteria 2876
211 Ga0395901_0169475 3300038443 Bacteria 2291
212 Ga0395901_0356651 3300038443 Bacteria 1509
213 Ga0395901_0369893 3300038443 Bacteria 1477
214 Ga0395901_0449765 3300038443 Bacteria 1317
215 Ga0436360_0866200 3300039438 Unclassified 563
216 Ga0451804_0888114 3300041463 Bacteria 763
217 Ga0439448_0360020 3300042005 Bacteria 519
218 Ga0466972_0049285 3300044658 Bacteria 2034
219 Ga0466966_0520759 3300044684 Bacteria 715
220 Ga0466961_0015641 3300044693 Bacteria 4868
221 Ga0466961_0035051 3300044693 Bacteria 3222
222 Ga0466961_0094170 3300044693 Bacteria 1890
223 Ga0466963_0032100 3300044694 Bacteria 3398
224 Ga0466963_0051493 3300044694 Bacteria 2729
225 Ga0466963_0226496 3300044694 Bacteria 1310
226 Ga0466963_0286646 3300044694 Bacteria 1157
227 Ga0466963_0671860 3300044694 Bacteria 731
228 Ga0466963_0982878 3300044694 Unclassified 594
229 Ga0466964_0002960 3300044706 Bacteria 6140
230 Ga0466964_0105230 3300044706 Bacteria 1250
231 Ga0466964_0108206 3300044706 Bacteria 1236
232 Ga0466964_0366274 3300044706 Bacteria 744
233 Ga0466964_0532464 3300044706 Unclassified 635
234 Ga0466971_0004009 3300044719 Bacteria 6332
235 Ga0466971_0020156 3300044719 Bacteria 2964
236 Ga0466971_0054039 3300044719 Bacteria 1810
237 Ga0466971_0068778 3300044719 Bacteria 1606
238 Ga0466971_0097024 3300044719 Bacteria 1352
239 Ga0466971_0185467 3300044719 Bacteria 979
240 Ga0466968_0019802 3300044735 Bacteria 2712
241 Ga0466968_0031870 3300044735 Bacteria 2189
242 Ga0466970_0064930 3300044765 Bacteria 1958
243 Ga0466970_0151107 3300044765 Bacteria 1282
244 Ga0466957_0009344 3300044842 Bacteria 5595
245 Ga0466957_0024928 3300044842 Bacteria 3543
246 Ga0466957_0041366 3300044842 Bacteria 2787
247 Ga0466957_0064049 3300044842 Bacteria 2261
248 Ga0466957_0131253 3300044842 Bacteria 1605
249 Ga0466957_0900095 3300044842 Bacteria 632
250 Ga0466959_0107189 3300045049 Bacteria 1997
251 Ga0466959_0113411 3300045049 Bacteria 1933
252 Ga0466958_0000451 3300045836 Bacteria 17102
253 Ga0466958_0002826 3300045836 Bacteria 8836
254 Ga0466958_0132167 3300045836 Unclassified 1568
255 Ga0466958_0158462 3300045836 Unclassified 1429
256 Ga0466958_0375593 3300045836 Bacteria 916
257 Ga0466958_0429316 3300045836 Bacteria 855
258 Ga0466958_0994355 3300045836 Bacteria 547
259 Ga0466967_0007035 3300045976 Bacteria 8056
260 Ga0466967_0013948 3300045976 Bacteria 6235
261 Ga0466967_0020951 3300045976 Bacteria 5296
262 Ga0466967_0036703 3300045976 Bacteria 4186
263 Ga0466967_0039640 3300045976 Bacteria 4051
264 Ga0466967_0039769 3300045976 Bacteria 4045
265 Ga0466967_0059912 3300045976 Bacteria 3371
266 Ga0466967_0063359 3300045976 Bacteria 3285
267 Ga0466967_0122107 3300045976 Bacteria 2408
268 Ga0466967_0206518 3300045976 Bacteria 1862
269 Ga0466967_0253629 3300045976 Bacteria 1681
270 Ga0466967_0279103 3300045976 Bacteria 1602
271 Ga0466967_0581072 3300045976 Bacteria 1104
272 Ga0466967_0706168 3300045976 Bacteria 999
273 Ga0466967_0724836 3300045976 Bacteria 985
274 Ga0466967_0819222 3300045976 Bacteria 924
275 Ga0466967_1002867 3300045976 Bacteria 831
276 Ga0466967_2171012 3300045976 Unclassified 551
277 Ga0495592_0023592 3300046454 Bacteria 4680
278 Ga0495592_0050123 3300046454 Bacteria 3103
279 Ga0495603_0015426 3300046455 Bacteria 4622
280 Ga0495629_0009104 3300046459 Bacteria 7271
281 Ga0495629_0082417 3300046459 Bacteria 2245
282 Ga0495629_0109984 3300046459 Bacteria 1921
283 Ga0495629_0273822 3300046459 Bacteria 1159
284 Ga0495629_0374211 3300046459 Bacteria 970
285 Ga0495641_0000259 3300046461 Bacteria 41682
286 Ga0495641_0083274 3300046461 Bacteria 1433
287 Ga0495641_0101198 3300046461 Unclassified 1286
288 Ga0495641_0271396 3300046461 Bacteria 763
289 Ga0495641_0357575 3300046461 Bacteria 660
290 Ga0495651_0010414 3300046462 Bacteria 7144
291 Ga0495651_0035299 3300046462 Bacteria 3894
292 Ga0495651_0891589 3300046462 Bacteria 544
293 Ga0495653_0015447 3300046463 Bacteria 6224
294 Ga0495653_0063898 3300046463 Bacteria 2775
295 Ga0495653_0087109 3300046463 Bacteria 2294
296 Ga0495653_0281822 3300046463 Bacteria 1090
297 Ga0495582_0001732 3300046473 Bacteria 12311
298 Ga0495582_0870689 3300046473 Unclassified 521
299 Ga0495639_0000124 3300046475 Bacteria 39427
300 Ga0495662_0001550 3300046476 Bacteria 11420
301 Ga0495664_0033572 3300046477 Bacteria 3015
302 Ga0495594_0398401 3300046499 Bacteria 783
303 Ga0495608_0109145 3300046511 Bacteria 1779
304 Ga0495608_0205608 3300046511 Unclassified 1239
305 Ga0495608_0296388 3300046511 Bacteria 1002
306 Ga0495608_0723616 3300046511 Unclassified 591
307 Ga0495618_0020132 3300046514 Bacteria 4107
308 Ga0495618_0150683 3300046514 Bacteria 1486
309 Ga0495618_0335571 3300046514 Bacteria 934
310 Ga0495618_0464299 3300046514 Bacteria 767
311 Ga0495628_0061358 3300046516 Bacteria 2948
312 Ga0495628_0303816 3300046516 Bacteria 1180
313 Ga0495630_0107441 3300046517 Bacteria 2113
314 Ga0495630_0129839 3300046517 Bacteria 1913
315 Ga0495630_0204244 3300046517 Bacteria 1508
316 Ga0495666_0002277 3300046526 Bacteria 9552
317 Ga0495652_0036023 3300046529 Bacteria 4304
318 Ga0495652_0080429 3300046529 Bacteria 2691
319 Ga0495652_0163035 3300046529 Bacteria 1728
320 Ga0495640_0009432 3300046533 Bacteria 7602
321 Ga0495640_0289669 3300046533 Bacteria 1018
322 Ga0495640_0604813 3300046533 Bacteria 662
323 Ga0495586_0005091 3300046535 Bacteria 7033
324 Ga0495587_0059872 3300046536 Bacteria 2234
325 Ga0495587_0122700 3300046536 Bacteria 1488
326 Ga0495645_0012906 3300046543 Bacteria 5897
327 Ga0495645_0377658 3300046543 Bacteria 907
328 Ga0495667_0014338 3300046559 Bacteria 5354
329 Ga0495667_0230343 3300046559 Bacteria 1181
330 Ga0495667_0317094 3300046559 Bacteria 986
331 Ga0495667_0985588 3300046559 Bacteria 514
332 Ga0495634_0021188 3300046642 Bacteria 4598
333 Ga0495634_0065910 3300046642 Bacteria 2399
334 Ga0495634_0640998 3300046642 Bacteria 614
335 Ga0495635_0033952 3300046663 Bacteria 3539
336 Ga0495635_0046035 3300046663 Bacteria 3009
337 Ga0495635_0052086 3300046663 Bacteria 2819
338 Ga0495635_0191908 3300046663 Bacteria 1387
339 Ga0495657_0002632 3300046675 Bacteria 15029
340 Ga0495657_0214418 3300046675 Bacteria 1169
341 Ga0495599_0068541 3300046678 Bacteria 2214
342 Ga0495599_0090617 3300046678 Bacteria 1908
343 Ga0495599_0370764 3300046678 Unclassified 856
344 Ga0495623_0594323 3300046679 Bacteria 575
345 Ga0495646_0268719 3300046680 Bacteria 909
346 Ga0495647_0000115 3300046681 Bacteria 20341
347 Ga0495658_0001950 3300046683 Bacteria 10556
348 Ga0495658_0090428 3300046683 Bacteria 1812
349 Ga0495658_0821797 3300046683 Bacteria 595
350 Ga0495613_0469749 3300046689 Bacteria 850
351 Ga0495613_0643191 3300046689 Bacteria 702
352 Ga0495624_0001536 3300046690 Bacteria 17832
353 Ga0495600_0085094 3300046809 Bacteria 2063
354 Ga0495600_0149914 3300046809 Bacteria 1510
355 Ga0495581_0452166 3300047315 Bacteria 748
356 Ga0495604_0091901 3300047317 Bacteria 2249
357 Ga0495604_0267731 3300047317 Bacteria 1159
358 Ga0495674_0070808 3300047319 Bacteria 3012
359 Ga0495674_0154554 3300047319 Bacteria 1922
360 Ga0495674_0227403 3300047319 Bacteria 1540
361 Ga0495674_0713137 3300047319 Bacteria 786
362 Ga0495674_0986638 3300047319 Bacteria 646
363 Ga0495676_0043855 3300047321 Bacteria 3655
364 Ga0495676_0582033 3300047321 Unclassified 730
365 Ga0495680_0042774 3300047322 Bacteria 3592
366 Ga0495680_0068512 3300047322 Bacteria 2710
367 Ga0495680_0181803 3300047322 Bacteria 1517
368 Ga0495684_0014058 3300047471 Bacteria 6156
369 Ga0495684_0017981 3300047471 Bacteria 5446
370 Ga0495684_0189756 3300047471 Bacteria 1520
371 Ga0495684_0217062 3300047471 Bacteria 1404
372 Ga0495684_0268360 3300047471 Bacteria 1235
373 Ga0495593_0000453 3300047673 Bacteria 23030
374 Ga0495593_0095157 3300047673 Bacteria 1532
375 Ga0495602_0111607 3300048088 Bacteria 2220
376 Ga0495602_0466118 3300048088 Bacteria 889
377 Ga0495602_0517818 3300048088 Bacteria 831
378 Ga0495614_0000371 3300048089 Bacteria 18098
379 Ga0496100_0136423 3300048903 Bacteria 1734
380 Ga0496101_0165682 3300048904 Bacteria 1697
381 Ga0496101_1445240 3300048904 Unclassified 536
382 Ga0496102_0033560 3300048905 Bacteria 4612
383 Ga0496102_1515952 3300048905 Bacteria 589
384 Ga0496103_0595063 3300048906 Bacteria 705
385 Ga0496104_0014875 3300048907 Bacteria 7033
386 Ga0496104_0975616 3300048907 Bacteria 752
387 Ga0496105_0017489 3300048908 Bacteria 5749
388 Ga0496105_0028395 3300048908 Bacteria 4574
389 Ga0496105_0125898 3300048908 Bacteria 2112
390 Ga0496105_0210799 3300048908 Bacteria 1584
391 Ga0496107_0190171 3300048910 Bacteria 1525
392 Ga0496108_0028234 3300048911 Bacteria 4642
393 Ga0496109_0003099 3300048912 Bacteria 13866
394 Ga0496109_1281762 3300048912 Unclassified 669
395 Ga0496110_0978181 3300048913 Unclassified 753
396 Ga0496111_0138098 3300048914 Unclassified 1806
397 Ga0496111_0172062 3300048914 Bacteria 1609
398 Ga0496111_0185585 3300048914 Bacteria 1546
399 Ga0496111_0685144 3300048914 Bacteria 746
400 Ga0496112_0005395 3300048915 Bacteria 11051
401 Ga0496112_0060777 3300048915 Bacteria 3724
402 Ga0496112_0110224 3300048915 Bacteria 2723
403 Ga0496112_0127322 3300048915 Bacteria 2517
404 Ga0496112_0136746 3300048915 Bacteria 2420
405 Ga0496112_0449536 3300048915 Bacteria 1226
406 Ga0496112_1216522 3300048915 Bacteria 670
407 Ga0496113_0447852 3300048916 Bacteria 1037
408 Ga0496113_0684099 3300048916 Bacteria 819
409 Ga0496113_0840136 3300048916 Bacteria 728
410 Ga0496114_0019987 3300048917 Bacteria 5433
411 Ga0496114_0237607 3300048917 Bacteria 1602
412 Ga0496115_0001419 3300048918 Bacteria 17150
413 Ga0501067_0098147 3300049583 Bacteria 1627
414 Ga0501068_0242312 3300049584 Bacteria 1148
415 Ga0501069_0024095 3300049585 Bacteria 3320
416 Ga0501069_0026794 3300049585 Bacteria 3158
417 Ga0501069_0072829 3300049585 Bacteria 1926
418 Ga0501069_0505870 3300049585 Bacteria 721
419 Ga0501069_0620863 3300049585 Bacteria 649
420 nmdc:mga0n895_902852_c1 3300050512 Unclassified 869
421 Ga0495601_0033191 3300053077 Bacteria 3215
422 Ga0495601_0199590 3300053077 Bacteria 1307
423 Ga0495601_0271673 3300053077 Bacteria 1106
424 Ga0495601_0300561 3300053077 Bacteria 1045
425 Ga0495601_0373019 3300053077 Bacteria 926
426 Ga0495612_0016500 3300053078 Bacteria 2958
427 Ga0495612_0047057 3300053078 Bacteria 1767
428 Ga0495595_0004195 3300053084 Bacteria 5797
429 Ga0495595_0021676 3300053084 Bacteria 2809
430 Ga0495595_0460737 3300053084 Bacteria 646
431 Ga0495619_0011587 3300053085 Bacteria 5556
432 Ga0495619_0021114 3300053085 Bacteria 4155
433 Ga0495619_0025293 3300053085 Bacteria 3811
434 Ga0495619_0069797 3300053085 Bacteria 2349
435 Ga0495619_0440563 3300053085 Bacteria 898
436 Ga0500566_0038710 3300053094 Bacteria 2758
437 Ga0500636_0456462 3300053177 Unclassified 576
438 Ga0466962_0010859 3300061719 Bacteria 4379
439 Ga0466962_0101091 3300061719 Bacteria 1384
440 Ga0466962_0176284 3300061719 Bacteria 1042
441 Ga0466962_0204030 3300061719 Bacteria 966
442 Ga0530510_1140697 3300061734 Bacteria 597
443 Ga0207667_10464113
444 rootL2_10103408
445 Ga0070658_10350339
446 Ga0070658_11378745
447 Ga0070683_100137997
448 Ga0070680_100041800
449 Ga0070680_100168563
450 Ga0070680_100374626
451 Ga0070682_100093487
452 Ga0070682_100261313
453 Ga0068868_100247667
454 Ga0070660_100118723
455 Ga0070660_100912663
456 Ga0070661_100176716
457 Ga0070671_100326436
458 Ga0070671_100499719
459 Ga0070659_100250426
460 Ga0070659_100358367
461 Ga0070659_100533817
462 Ga0070714_100275573
463 Ga0070714_100882481
464 Ga0070713_100560565
465 Ga0070710_10601692
466 Ga0070701_11226403
467 Ga0070711_102008059
468 Ga0070705_100397855
469 Ga0070681_10028076
470 Ga0070681_10067988
471 Ga0070681_10084085
472 Ga0070681_10095437
473 Ga0070681_10095945
474 Ga0070681_11089190
475 Ga0070706_100415890
476 Ga0070706_101048880
477 Ga0070707_100560566
478 Ga0070698_100021364
479 Ga0070698_100436727
480 Ga0070698_100532418
481 Ga0070698_100964849
482 Ga0070699_100551960
483 Ga0070679_100057969
484 Ga0070679_100164182
485 Ga0070679_100184566
486 Ga0070679_100238626
487 Ga0070679_100265918
488 Ga0070679_100368366
489 Ga0070679_101395292
490 Ga0070679_102017508
491 Ga0070684_100014396
492 Ga0070684_100099557
493 Ga0070684_100107618
494 Ga0070684_100192047
495 Ga0070696_100473474
496 Ga0070693_100603291
497 Ga0070693_100995220
498 Ga0068855_100221979
499 Ga0068855_100239749
500 Ga0068855_100322506
501 Ga0068855_100766247
502 Ga0068857_100356678
503 Ga0068857_100848247
504 Ga0068854_100337434
505 Ga0068856_100110227
506 Ga0068856_100717832
507 Ga0068856_100763712
508 Ga0068856_100927566
509 Ga0068852_100202515
510 Ga0068852_102562903
511 Ga0068866_11174602
512 Ga0070717_10002360
513 Ga0070717_10035711
514 Ga0070717_10045295
515 Ga0070717_10408826
516 Ga0070717_10746758
517 Ga0070716_100789813
518 Ga0070712_100635979
519 Ga0075434_100681717
520 Ga0075435_100910088
521 Ga0105240_10609606
522 Ga0105240_12192279
523 Ga0105245_10101461
524 Ga0114129_10988611
525 Ga0105237_10199317
526 Ga0105238_10794160
527 Ga0105238_10842778
528 Ga0105238_11155916
529 Ga0105239_11693802
530 Ga0105239_11930037
531 Ga0105239_13006324
532 Ga0157373_10280330
533 Ga0157370_10022796
534 Ga0157370_10312868
535 Ga0157370_11282039
536 Ga0157369_10005924
537 Ga0157369_10123823
538 Ga0157369_10148040
539 Ga0157369_10148226
540 Ga0157369_10429188
541 Ga0157369_11447882
542 Ga0157374_10221131
543 Ga0157372_10156128
544 Ga0182008_10801270
545 Ga0157377_11407191
546 Ga0157376_10504488
547 Ga0206356_10009738
548 Ga0206356_10014424
549 Ga0206356_11178692
550 Ga0206356_11494581
551 Ga0206354_10769378
552 Ga0206353_10451804
553 Ga0206353_10510943
554 Ga0206353_11407569
555 Ga0206353_11851569
556 Ga0206353_12064951
557 Ga0207705_10091134
558 Ga0207705_10315090
559 Ga0207705_10779588
560 Ga0207705_11154737
561 Ga0207684_10220881
562 Ga0207707_10052608
563 Ga0207707_10058920
564 Ga0207707_10075937
565 Ga0207707_10093550
566 Ga0207707_10105275
567 Ga0207707_10460695
568 Ga0207707_11149358
569 Ga0207695_10446276
570 Ga0207693_10009488
571 Ga0207663_10274361
572 Ga0207663_11258575
573 Ga0207660_10181875
574 Ga0207660_10287972
575 Ga0207660_10456648
576 Ga0207660_10485029
577 Ga0207660_10879639
578 Ga0207657_10002645
579 Ga0207657_10006111
580 Ga0207657_10142336
581 Ga0207657_10920780
582 Ga0207649_10082925
583 Ga0207649_10390530
584 Ga0207649_10426694
585 Ga0207652_10118486
586 Ga0207652_10120120
587 Ga0207652_10242672
588 Ga0207652_10275242
589 Ga0207652_10472440
590 Ga0207652_10698023
591 Ga0207652_10795785
592 Ga0207652_11297659
593 Ga0207646_10002668
594 Ga0207646_10418797
595 Ga0207694_10254049
596 Ga0207664_10004369
597 Ga0207664_10058896
598 Ga0207664_10130090
599 Ga0207664_10491795
600 Ga0207664_10566395
601 Ga0207664_10641577
602 Ga0207664_10879396
603 Ga0207644_10177634
604 Ga0207690_10298546
605 Ga0207690_10628386
606 Ga0207665_10286692
607 Ga0207661_10007448
608 Ga0207661_10363558
609 Ga0207661_11309665
610 Ga0207667_10343638
611 Ga0207667_10406427
612 Ga0207702_10233746
613 Ga0207702_10482086
614 Ga0207702_10878980
615 Ga0207674_10965650
616 Ga0207698_10354113
617 Ga0265338_10316706
618 Ga0265332_10168241
619 Ga0265328_10250053
620 Ga0265325_10054357
621 Ga0265313_10055734
622 Ga0265314_10197262
623 Ga0316583_10198289
624 Ga0373944_0011756
625 Ga0373943_0001811
626 Ga0373946_0069723
627 Ga0373955_0294337
628 Ga0373955_0435302
629 Ga0373924_0140392
630 Ga0373931_0579330
631 Ga0373931_0738014
632 Ga0373927_0133173
633 Ga0373947_0139935
634 Ga0373925_0004822
635 Ga0395899_0004892
636 Ga0395899_0049568
637 Ga0395899_0128799
638 Ga0395899_0256544
639 Ga0395900_0063832
640 Ga0395900_0511864
641 Ga0395900_1258061
642 Ga0395900_1764283
643 Ga0395898_0093986
644 Ga0395898_0113409
645 Ga0395898_0156886
646 Ga0395898_0160297
647 Ga0395898_0271816
648 Ga0395898_0699060
649 Ga0395898_0983552
650 Ga0395905_0066673
651 Ga0395905_0642989
652 Ga0395901_0111236
653 Ga0395901_0169475
654 Ga0395901_0356651
655 Ga0395901_0369893
656 Ga0395901_0449765
657 Ga0436360_0866200
658 Ga0451804_0888114
659 Ga0439448_0360020
660 Ga0466972_0049285
661 Ga0466966_0520759
662 Ga0466961_0015641
663 Ga0466961_0035051
664 Ga0466961_0094170
665 Ga0466963_0032100
666 Ga0466963_0051493
667 Ga0466963_0226496
668 Ga0466963_0286646
669 Ga0466963_0671860
670 Ga0466963_0982878
671 Ga0466964_0002960
672 Ga0466964_0105230
673 Ga0466964_0108206
674 Ga0466964_0366274
675 Ga0466964_0532464
676 Ga0466971_0004009
677 Ga0466971_0020156
678 Ga0466971_0054039
679 Ga0466971_0068778
680 Ga0466971_0097024
681 Ga0466971_0185467
682 Ga0466968_0019802
683 Ga0466968_0031870
684 Ga0466970_0064930
685 Ga0466970_0151107
686 Ga0466957_0009344
687 Ga0466957_0024928
688 Ga0466957_0041366
689 Ga0466957_0064049
690 Ga0466957_0131253
691 Ga0466957_0900095
692 Ga0466959_0107189
693 Ga0466959_0113411
694 Ga0466958_0000451
695 Ga0466958_0002826
696 Ga0466958_0132167
697 Ga0466958_0158462
698 Ga0466958_0375593
699 Ga0466958_0429316
700 Ga0466958_0994355
701 Ga0466967_0007035
702 Ga0466967_0013948
703 Ga0466967_0020951
704 Ga0466967_0036703
705 Ga0466967_0039640
706 Ga0466967_0039769
707 Ga0466967_0059912
708 Ga0466967_0063359
709 Ga0466967_0122107
710 Ga0466967_0206518
711 Ga0466967_0253629
712 Ga0466967_0279103
713 Ga0466967_0581072
714 Ga0466967_0706168
715 Ga0466967_0724836
716 Ga0466967_0819222
717 Ga0466967_1002867
718 Ga0466967_2171012
719 Ga0495592_0023592
720 Ga0495592_0050123
721 Ga0495603_0015426
722 Ga0495629_0009104
723 Ga0495629_0082417
724 Ga0495629_0109984
725 Ga0495629_0273822
726 Ga0495629_0374211
727 Ga0495641_0000259
728 Ga0495641_0083274
729 Ga0495641_0101198
730 Ga0495641_0271396
731 Ga0495641_0357575
732 Ga0495651_0010414
733 Ga0495651_0035299
734 Ga0495651_0891589
735 Ga0495653_0015447
736 Ga0495653_0063898
737 Ga0495653_0087109
738 Ga0495653_0281822
739 Ga0495582_0001732
740 Ga0495582_0870689
741 Ga0495639_0000124
742 Ga0495662_0001550
743 Ga0495664_0033572
744 Ga0495594_0398401
745 Ga0495608_0109145
746 Ga0495608_0205608
747 Ga0495608_0296388
748 Ga0495608_0723616
749 Ga0495618_0020132
750 Ga0495618_0150683
751 Ga0495618_0335571
752 Ga0495618_0464299
753 Ga0495628_0061358
754 Ga0495628_0303816
755 Ga0495630_0107441
756 Ga0495630_0129839
757 Ga0495630_0204244
758 Ga0495666_0002277
759 Ga0495652_0036023
760 Ga0495652_0080429
761 Ga0495652_0163035
762 Ga0495640_0009432
763 Ga0495640_0289669
764 Ga0495640_0604813
765 Ga0495586_0005091
766 Ga0495587_0059872
767 Ga0495587_0122700
768 Ga0495645_0012906
769 Ga0495645_0377658
770 Ga0495667_0014338
771 Ga0495667_0230343
772 Ga0495667_0317094
773 Ga0495667_0985588
774 Ga0495634_0021188
775 Ga0495634_0065910
776 Ga0495634_0640998
777 Ga0495635_0033952
778 Ga0495635_0046035
779 Ga0495635_0052086
780 Ga0495635_0191908
781 Ga0495657_0002632
782 Ga0495657_0214418
783 Ga0495599_0068541
784 Ga0495599_0090617
785 Ga0495599_0370764
786 Ga0495623_0594323
787 Ga0495646_0268719
788 Ga0495647_0000115
789 Ga0495658_0001950
790 Ga0495658_0090428
791 Ga0495658_0821797
792 Ga0495613_0469749
793 Ga0495613_0643191
794 Ga0495624_0001536
795 Ga0495600_0085094
796 Ga0495600_0149914
797 Ga0495581_0452166
798 Ga0495604_0091901
799 Ga0495604_0267731
800 Ga0495674_0070808
801 Ga0495674_0154554
802 Ga0495674_0227403
803 Ga0495674_0713137
804 Ga0495674_0986638
805 Ga0495676_0043855
806 Ga0495676_0582033
807 Ga0495680_0042774
808 Ga0495680_0068512
809 Ga0495680_0181803
810 Ga0495684_0014058
811 Ga0495684_0017981
812 Ga0495684_0189756
813 Ga0495684_0217062
814 Ga0495684_0268360
815 Ga0495593_0000453
816 Ga0495593_0095157
817 Ga0495602_0111607
818 Ga0495602_0466118
819 Ga0495602_0517818
820 Ga0495614_0000371
821 Ga0496100_0136423
822 Ga0496101_0165682
823 Ga0496101_1445240
824 Ga0496102_0033560
825 Ga0496102_1515952
826 Ga0496103_0595063
827 Ga0496104_0014875
828 Ga0496104_0975616
829 Ga0496105_0017489
830 Ga0496105_0028395
831 Ga0496105_0125898
832 Ga0496105_0210799
833 Ga0496107_0190171
834 Ga0496108_0028234
835 Ga0496109_0003099
836 Ga0496109_1281762
837 Ga0496110_0978181
838 Ga0496111_0138098
839 Ga0496111_0172062
840 Ga0496111_0185585
841 Ga0496111_0685144
842 Ga0496112_0005395
843 Ga0496112_0060777
844 Ga0496112_0110224
845 Ga0496112_0127322
846 Ga0496112_0136746
847 Ga0496112_0449536
848 Ga0496112_1216522
849 Ga0496113_0447852
850 Ga0496113_0684099
851 Ga0496113_0840136
852 Ga0496114_0019987
853 Ga0496114_0237607
854 Ga0496115_0001419
855 Ga0501067_0098147
856 Ga0501068_0242312
857 Ga0501069_0024095
858 Ga0501069_0026794
859 Ga0501069_0072829
860 Ga0501069_0505870
861 Ga0501069_0620863
862 nmdc:mga0n895_902852_c1
863 Ga0495601_0033191
864 Ga0495601_0199590
865 Ga0495601_0271673
866 Ga0495601_0300561
867 Ga0495601_0373019
868 Ga0495612_0016500
869 Ga0495612_0047057
870 Ga0495595_0004195
871 Ga0495595_0021676
872 Ga0495595_0460737
873 Ga0495619_0011587
874 Ga0495619_0021114
875 Ga0495619_0025293
876 Ga0495619_0069797
877 Ga0495619_0440563
878 Ga0500566_0038710
879 Ga0500636_0456462
880 Ga0466962_0010859
881 Ga0466962_0101091
882 Ga0466962_0176284
883 Ga0466962_0204030
884 Ga0530510_1140697

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tuh-assembly1.cif.gz_A-2 structure of bal32a from a soil-derived mobile gene cassette 0.9484 5 128
1tuh-assembly1.cif.gz_A-2 structure of bal32a from a soil-derived mobile gene cassette 0.9131 5 128
3g8z-assembly1.cif.gz_A-2 crystal structure of protein of unknown function with cystatin-like fold (np_639274.1) from xanthomonas campestris at 1.90 a resolution 0.9103 6 128
4u13-assembly1.cif.gz_B crystal structure of putative polyketide cyclase (protein sma1630) from sinorhizobium meliloti at 2.3 a resolution 0.8992 8 117
3ebt-assembly1.cif.gz_A-2 crystal structure of a ntf2-like protein of unknown function (bpss0132) from burkholderia pseudomallei k96243 at 1.30 a resolution 0.8751 3 128
ID Description Score Start End Superfamily
af_P9WM93_4_131_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.964 5 128 3.10.450.50
1tuhA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9484 5 128 3.10.450.50
1tuhA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9131 5 128 3.10.450.50
4u13B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8842 8 117 3.10.450.50
6d34B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.867 3 126 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A7V9JHM8-F1-model_v4 Nuclear transport factor 2 family protein 0.9836 5 128
AF-A0A7W1RTQ7-F1-model_v4 Nuclear transport factor 2 family protein 0.9834 6 128
AF-A0A538I115-F1-model_v4 Nuclear transport factor 2 family protein 0.981 5 128
AF-A0A7X0L0M6-F1-model_v4 Ketosteroid isomerase-like protein 0.9736 1 128 GO:0016853
AF-A0A447GIF1-F1-model_v4 RNA polymerase sigma-70 factor 0.9731 5 128

Map