F444751

General Info

Members Datasets Scaffolds Average Seq Length
441 233 431 268

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0385786|Ga0496108_0385786_210_1031
Length 273
Sequence MGDKSIRDVERIGEGEATKWDPGFTEQVKNLIGPLIKRYFRAEVKGLDAIPSAGGALLVSNHSGGMFTPDVLVFAPAFYHKFGFDRPVYTLAHYALFAGPLGDWLRRVGVIEANRENAAKALRSGALVLVFPGGDYDSYRPTFENKIDFAGRTGYVRTAIESEVPIVPMVSIGAQESQLFLTRGNWLAKRLGLQRLRAEILPVTFGFPFGLSVFFPPNVPLPTKIVTQVLDPIDVVKEFGEDPDVDAVDEHVREVMQTALDDLAKKRRFPILG

Samples

Sample ID Description Type Environment
1 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
2 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
3 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
4 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
5 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
6 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
7 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
153 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
154 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
155 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
158 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
159 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
160 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
161 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
166 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
167 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
168 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
169 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
175 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
176 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
179 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
199 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
200 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
201 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
202 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
203 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
219 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
220 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
221 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
222 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
225 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
226 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
227 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
228 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
229 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
230 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
231 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
232 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
233 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.51
Metatranscriptomes 0.23
Isolates 2.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.7
Nodule 0.23
Rhizoplane 10.66
Rhizosphere 69.61
Stem 0
Stem Tuber 0
Unclassified 6.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10086576 3300001990 Bacteria 931
2 JGI24748J21848_1007397 3300002074 Bacteria 1287
3 JGI24744J21845_10000056 3300002077 Bacteria 13378
4 JGI24742J22300_10000298 3300002244 Bacteria 7368
5 Ga0070676_10009360 3300005328 Bacteria 5295
6 Ga0070683_100573764 3300005329 Bacteria 1079
7 Ga0070690_100138849 3300005330 Bacteria 1648
8 Ga0068869_100026751 3300005334 Bacteria 4017
9 Ga0068869_100031639 3300005334 Bacteria 3722
10 Ga0070680_100189390 3300005336 Bacteria 1733
11 Ga0070682_100002572 3300005337 Bacteria 10014
12 Ga0070682_100060269 3300005337 Bacteria 2400
13 Ga0068868_100003487 3300005338 Bacteria 10945
14 Ga0068868_100060928 3300005338 Bacteria 2989
15 Ga0070660_100667576 3300005339 Bacteria 871
16 Ga0070689_100092810 3300005340 Bacteria 2382
17 Ga0070692_10206782 3300005345 Bacteria 1153
18 Ga0070668_100001188 3300005347 Bacteria 18456
19 Ga0070668_100060067 3300005347 Bacteria 2943
20 Ga0070669_100000597 3300005353 Bacteria 26784
21 Ga0070669_100008771 3300005353 Bacteria 7214
22 Ga0070669_100208492 3300005353 Bacteria 1540
23 Ga0070671_100035331 3300005355 Bacteria 4140
24 Ga0070674_100043807 3300005356 Bacteria 3046
25 Ga0070688_100094295 3300005365 Bacteria 1962
26 Ga0070659_100010064 3300005366 Bacteria 6962
27 Ga0070667_100000388 3300005367 Bacteria 47627
28 Ga0070667_100009690 3300005367 Bacteria 7982
29 Ga0070667_100460440 3300005367 Bacteria 1163
30 Ga0070714_100056402 3300005435 Bacteria 3360
31 Ga0070710_10002861 3300005437 Bacteria 8222
32 Ga0070711_100015566 3300005439 Bacteria 4814
33 Ga0070711_100050470 3300005439 Bacteria 2853
34 Ga0070711_100455780 3300005439 Bacteria 1048
35 Ga0070705_100003517 3300005440 Bacteria 7666
36 Ga0070700_100001498 3300005441 Bacteria 11628
37 Ga0070694_100294658 3300005444 Bacteria 1241
38 Ga0070678_100001466 3300005456 Bacteria 12574
39 Ga0070678_100085628 3300005456 Bacteria 2402
40 Ga0070678_100124376 3300005456 Bacteria 2039
41 Ga0070678_100521211 3300005456 Bacteria 1051
42 Ga0068867_100007367 3300005459 Bacteria 7784
43 Ga0070685_10040055 3300005466 Bacteria 2665
44 Ga0070684_100095799 3300005535 Bacteria 2645
45 Ga0070684_100403302 3300005535 Bacteria 1261
46 Ga0068853_100003962 3300005539 Bacteria 11376
47 Ga0070672_100310512 3300005543 Bacteria 1338
48 Ga0070695_100003335 3300005545 Bacteria 9388
49 Ga0070696_100294219 3300005546 Bacteria 1241
50 Ga0070696_100458033 3300005546 Bacteria 1008
51 Ga0070693_100043486 3300005547 Bacteria 2537
52 Ga0070693_100256341 3300005547 Bacteria 1162
53 Ga0070665_100004946 3300005548 Bacteria 13817
54 Ga0070665_100006513 3300005548 Bacteria 11871
55 Ga0070665_100084282 3300005548 Bacteria 3183
56 Ga0070704_100002412 3300005549 Bacteria 10497
57 Ga0070704_100342416 3300005549 Bacteria 1259
58 Ga0068854_100002546 3300005578 Bacteria 11288
59 Ga0068856_100134700 3300005614 Bacteria 2476
60 Ga0070702_100013152 3300005615 Bacteria 4171
61 Ga0070702_100034359 3300005615 Bacteria 2794
62 Ga0070702_100174269 3300005615 Bacteria 1402
63 Ga0070702_100266012 3300005615 Bacteria 1170
64 Ga0068859_100000276 3300005617 Bacteria 51118
65 Ga0068859_100008624 3300005617 Bacteria 10300
66 Ga0068864_100039998 3300005618 Bacteria 4010
67 Ga0068866_10001276 3300005718 Bacteria 10909
68 Ga0068866_10207910 3300005718 Bacteria 1173
69 Ga0068861_100000307 3300005719 Bacteria 27379
70 Ga0068861_100080787 3300005719 Bacteria 2544
71 Ga0068861_100608388 3300005719 Bacteria 1004
72 Ga0068863_100000431 3300005841 Bacteria 42342
73 Ga0068863_100090030 3300005841 Bacteria 2910
74 Ga0068863_100119240 3300005841 Bacteria 2515
75 Ga0068858_100000440 3300005842 Bacteria 43437
76 Ga0068858_100058958 3300005842 Bacteria 3548
77 Ga0068860_100000232 3300005843 Bacteria 85501
78 Ga0068860_100007260 3300005843 Bacteria 11082
79 Ga0068860_100274904 3300005843 Bacteria 1645
80 Ga0068862_100000055 3300005844 Bacteria 142386
81 Ga0068862_100002080 3300005844 Bacteria 18047
82 Ga0081455_10096905 3300005937 Bacteria 2378
83 Ga0081455_10139110 3300005937 Bacteria 1888
84 Ga0075365_10002978 3300006038 Bacteria 8569
85 Ga0075365_10003735 3300006038 Bacteria 7920
86 Ga0075365_10034408 3300006038 Bacteria 3271
87 Ga0075365_10162682 3300006038 Bacteria 1556
88 Ga0075363_100000301 3300006048 Bacteria 14480
89 Ga0075363_100002272 3300006048 Bacteria 7789
90 Ga0075363_100003512 3300006048 Bacteria 6682
91 Ga0075363_100005175 3300006048 Bacteria 5772
92 Ga0075363_100005377 3300006048 Bacteria 5690
93 Ga0075363_100010832 3300006048 Bacteria 4348
94 Ga0075363_100094913 3300006048 Bacteria 1645
95 Ga0075363_100104820 3300006048 Bacteria 1568
96 Ga0075363_100264509 3300006048 Bacteria 993
97 Ga0075364_10003925 3300006051 Bacteria 8530
98 Ga0075364_10009589 3300006051 Bacteria 5814
99 Ga0075364_10141109 3300006051 Bacteria 1621
100 Ga0070715_10028473 3300006163 Bacteria 2241
101 Ga0070715_10048157 3300006163 Bacteria 1821
102 Ga0070716_100003667 3300006173 Bacteria 7269
103 Ga0070716_100004132 3300006173 Bacteria 6889
104 Ga0070712_100003774 3300006175 Bacteria 9331
105 Ga0075367_10004632 3300006178 Bacteria 6736
106 Ga0075367_10084765 3300006178 Bacteria 1922
107 Ga0075369_10006868 3300006186 Bacteria 4321
108 Ga0075369_10016492 3300006186 Bacteria 2982
109 Ga0075369_10081999 3300006186 Bacteria 1431
110 Ga0075370_10000890 3300006353 Bacteria 12225
111 Ga0075370_10004551 3300006353 Bacteria 6754
112 Ga0075370_10014001 3300006353 Bacteria 4271
113 Ga0075370_10083473 3300006353 Bacteria 1838
114 Ga0075428_100006189 3300006844 Bacteria 13315
115 Ga0075430_100117388 3300006846 Bacteria 2218
116 Ga0068865_100001579 3300006881 Bacteria 13317
117 Ga0068865_100155609 3300006881 Bacteria 1738
118 Ga0097620_100000276 3300006931 Bacteria 51118
119 Ga0097620_100008624 3300006931 Bacteria 10300
120 Ga0105250_10058617 3300009092 Bacteria 1545
121 Ga0105245_10002313 3300009098 Bacteria 17248
122 Ga0105245_10022670 3300009098 Bacteria 5511
123 Ga0105245_10062155 3300009098 Bacteria 3369
124 Ga0105247_10000029 3300009101 Bacteria 198763
125 Ga0105247_10000584 3300009101 Bacteria 29668
126 Ga0105247_10014653 3300009101 Bacteria 4700
127 Ga0105243_10001688 3300009148 Bacteria 19021
128 Ga0105243_10135388 3300009148 Bacteria 2095
129 Ga0105241_10014332 3300009174 Bacteria 5804
130 Ga0105241_10195166 3300009174 Bacteria 1687
131 Ga0105242_10000923 3300009176 Bacteria 22835
132 Ga0105242_10070058 3300009176 Bacteria 2906
133 Ga0105242_10146632 3300009176 Bacteria 2054
134 Ga0105248_10000136 3300009177 Bacteria 85507
135 Ga0105248_10002643 3300009177 Bacteria 19910
136 Ga0105248_10089746 3300009177 Bacteria 3460
137 Ga0105248_10182458 3300009177 Bacteria 2365
138 Ga0105237_10024507 3300009545 Bacteria 6172
139 Ga0105238_10407264 3300009551 Bacteria 1354
140 Ga0105249_10000077 3300009553 Bacteria 141905
141 Ga0105249_10003484 3300009553 Bacteria 13633
142 Ga0105249_10057305 3300009553 Bacteria 3569
143 Ga0105249_10060875 3300009553 Bacteria 3464
144 Ga0105239_10082222 3300010375 Bacteria 3546
145 Ga0105239_10131889 3300010375 Bacteria 2780
146 Ga0105239_10502591 3300010375 Bacteria 1378
147 Ga0105246_10114130 3300011119 Bacteria 1990
148 Ga0105246_10117230 3300011119 Bacteria 1967
149 Ga0105246_10628877 3300011119 Bacteria 931
150 Ga0157374_10007254 3300013296 Bacteria 9442
151 Ga0157378_10002579 3300013297 Bacteria 16129
152 Ga0157378_10060973 3300013297 Bacteria 3365
153 Ga0157378_10218295 3300013297 Bacteria 1812
154 Ga0163162_10002796 3300013306 Bacteria 16590
155 Ga0163162_10007824 3300013306 Bacteria 10420
156 Ga0157372_10000875 3300013307 Bacteria 32716
157 Ga0157375_10002649 3300013308 Bacteria 15501
158 Ga0157375_10200845 3300013308 Bacteria 2150
159 Ga0157375_10323995 3300013308 Bacteria 1706
160 Ga0163163_10108311 3300014325 Bacteria 2806
161 Ga0163163_10121163 3300014325 Bacteria 2650
162 Ga0163163_11066633 3300014325 Bacteria 871
163 Ga0157380_10000844 3300014326 Bacteria 19168
164 Ga0182008_10122575 3300014497 Bacteria 1292
165 Ga0157379_10003466 3300014968 Bacteria 13353
166 Ga0157379_10256439 3300014968 Bacteria 1588
167 Ga0163161_10001223 3300017792 Bacteria 19270
168 Ga0213876_10002900 3300021384 Bacteria 9943
169 Ga0213875_10015087 3300021388 Bacteria 3762
170 Ga0213875_10036418 3300021388 Bacteria 2320
171 Ga0213875_10082712 3300021388 Bacteria 1498
172 Ga0209051_1056992 3300025303 Bacteria 1255
173 Ga0207692_10002758 3300025898 Bacteria 6767
174 Ga0207642_10000230 3300025899 Bacteria 16535
175 Ga0207710_10000046 3300025900 Bacteria 198754
176 Ga0207688_10000208 3300025901 Bacteria 26121
177 Ga0207688_10049978 3300025901 Bacteria 2339
178 Ga0207647_10046619 3300025904 Bacteria 2700
179 Ga0207685_10002125 3300025905 Bacteria 4444
180 Ga0207685_10093368 3300025905 Bacteria 1272
181 Ga0207645_10022908 3300025907 Bacteria 4059
182 Ga0207693_10000614 3300025915 Bacteria 31922
183 Ga0207663_10049297 3300025916 Bacteria 2611
184 Ga0207657_10217863 3300025919 Bacteria 1530
185 Ga0207681_10000948 3300025923 Bacteria 18907
186 Ga0207681_10006923 3300025923 Bacteria 6957
187 Ga0207687_10007362 3300025927 Bacteria 7253
188 Ga0207687_10158328 3300025927 Bacteria 1735
189 Ga0207687_10368025 3300025927 Bacteria 1175
190 Ga0207644_10182382 3300025931 Bacteria 1646
191 Ga0207644_10653573 3300025931 Bacteria 875
192 Ga0207690_10020349 3300025932 Bacteria 4099
193 Ga0207706_10053669 3300025933 Bacteria 3558
194 Ga0207686_10004857 3300025934 Bacteria 7225
195 Ga0207686_10074112 3300025934 Bacteria 2199
196 Ga0207686_10104701 3300025934 Bacteria 1896
197 Ga0207709_10006644 3300025935 Bacteria 6490
198 Ga0207709_10106126 3300025935 Bacteria 1868
199 Ga0207670_10008584 3300025936 Bacteria 5775
200 Ga0207669_10010358 3300025937 Bacteria 4484
201 Ga0207704_10003738 3300025938 Bacteria 6927
202 Ga0207665_10002840 3300025939 Bacteria 11623
203 Ga0207665_10007811 3300025939 Bacteria 7059
204 Ga0207665_10086686 3300025939 Bacteria 2163
205 Ga0207691_10314124 3300025940 Bacteria 1344
206 Ga0207711_10000111 3300025941 Bacteria 85466
207 Ga0207711_10119968 3300025941 Bacteria 2347
208 Ga0207711_10130156 3300025941 Bacteria 2255
209 Ga0207689_10010719 3300025942 Bacteria 7887
210 Ga0207661_10689547 3300025944 Bacteria 939
211 Ga0207651_10172082 3300025960 Bacteria 1709
212 Ga0207712_10000017 3300025961 Bacteria 337943
213 Ga0207668_10022542 3300025972 Bacteria 4034
214 Ga0207668_10026222 3300025972 Bacteria 3781
215 Ga0207640_10044024 3300025981 Bacteria 2857
216 Ga0207658_10000016 3300025986 Bacteria 215618
217 Ga0207658_10020042 3300025986 Bacteria 4629
218 Ga0207658_10271092 3300025986 Bacteria 1451
219 Ga0207677_10015294 3300026023 Bacteria 4508
220 Ga0207703_10016881 3300026035 Bacteria 5694
221 Ga0207703_10057977 3300026035 Bacteria 3159
222 Ga0207703_10202926 3300026035 Bacteria 1763
223 Ga0207678_10003908 3300026067 Bacteria 13401
224 Ga0207678_10057320 3300026067 Bacteria 3352
225 Ga0207702_10280142 3300026078 Bacteria 1576
226 Ga0207641_10001756 3300026088 Bacteria 20884
227 Ga0207641_10008314 3300026088 Bacteria 8576
228 Ga0207641_10207975 3300026088 Bacteria 1808
229 Ga0207641_10444271 3300026088 Bacteria 1252
230 Ga0207648_10000112 3300026089 Bacteria 78746
231 Ga0207676_10016432 3300026095 Bacteria 5360
232 Ga0207676_10415952 3300026095 Bacteria 1260
233 Ga0207675_100000917 3300026118 Bacteria 29411
234 Ga0207675_100116948 3300026118 Bacteria 2520
235 Ga0207683_10000451 3300026121 Bacteria 38077
236 Ga0207683_10131193 3300026121 Bacteria 2254
237 Ga0207683_10150364 3300026121 Bacteria 2101
238 Ga0268266_10005455 3300028379 Bacteria 11851
239 Ga0268266_10010157 3300028379 Bacteria 8250
240 Ga0268265_10000067 3300028380 Bacteria 142389
241 Ga0268265_10006910 3300028380 Bacteria 7675
242 Ga0268265_10041932 3300028380 Bacteria 3392
243 Ga0268264_10000146 3300028381 Bacteria 165733
244 Ga0316576_10472212 3300031727 Bacteria 925
245 Ga0307413_10015591 3300031824 Bacteria 3901
246 Ga0307410_10009089 3300031852 Bacteria 5554
247 Ga0307409_100138476 3300031995 Bacteria 2093
248 Ga0307416_100034035 3300032002 Bacteria 3872
249 Ga0307416_100233677 3300032002 Bacteria 1775
250 Ga0307411_10059219 3300032005 Bacteria 2538
251 Ga0307415_100594449 3300032126 Bacteria 984
252 Ga0373943_0210186 3300035170 Bacteria 1080
253 Ga0373961_0024187 3300035241 Bacteria 1641
254 Ga0373931_0002988 3300035691 Bacteria 7550
255 Ga0373931_0067563 3300035691 Bacteria 1943
256 Ga0265778_014599 3300036457 Bacteria 930
257 Ga0436364_0166962 3300037853 Bacteria 6539
258 Ga0436364_0706017 3300037853 Bacteria 6620
259 Ga0436364_0907426 3300037853 Bacteria 2346
260 Ga0395901_0587284 3300038443 Bacteria 1125
261 Ga0436365_0271296 3300039437 Bacteria 39035
262 Ga0436365_0430385 3300039437 Bacteria 20042
263 Ga0436365_1685157 3300039437 Bacteria 17329
264 Ga0436365_1781365 3300039437 Bacteria 36167
265 Ga0436363_0005942 3300039450 Bacteria 3934
266 Ga0436363_1257506 3300039450 Bacteria 4178
267 Ga0439461_0004961 3300041410 Bacteria 2247
268 Ga0439466_0009445 3300041411 Bacteria 3643
269 Ga0439466_0038715 3300041411 Bacteria 1601
270 Ga0439465_0005630 3300041413 Bacteria 3990
271 Ga0439465_0005901 3300041413 Bacteria 3894
272 Ga0451853_1512470 3300041512 Bacteria 1256
273 Ga0439431_0025764 3300041997 Bacteria 1438
274 Ga0439442_004437 3300042002 Bacteria 2788
275 Ga0466969_0025918 3300044656 Bacteria 3011
276 Ga0466972_0182318 3300044658 Bacteria 984
277 Ga0466965_0103242 3300044683 Bacteria 1459
278 Ga0466966_0010057 3300044684 Bacteria 6271
279 Ga0466966_0019768 3300044684 Bacteria 4430
280 Ga0466966_0043857 3300044684 Bacteria 2865
281 Ga0466966_0066671 3300044684 Bacteria 2262
282 Ga0466961_0016900 3300044693 Bacteria 4688
283 Ga0466961_0017544 3300044693 Bacteria 4599
284 Ga0466961_0020608 3300044693 Bacteria 4243
285 Ga0466963_0010509 3300044694 Bacteria 5606
286 Ga0466963_0018937 3300044694 Bacteria 4311
287 Ga0466963_0335173 3300044694 Bacteria 1065
288 Ga0466963_0429218 3300044694 Bacteria 932
289 Ga0466971_0060527 3300044719 Bacteria 1711
290 Ga0466968_0006620 3300044735 Bacteria 4375
291 Ga0466968_0016883 3300044735 Bacteria 2910
292 Ga0466970_0008373 3300044765 Bacteria 5204
293 Ga0466970_0009540 3300044765 Bacteria 4908
294 Ga0466957_0022738 3300044842 Bacteria 3701
295 Ga0466957_0064590 3300044842 Bacteria 2252
296 Ga0466957_0333676 3300044842 Bacteria 1026
297 Ga0466960_0001146 3300044901 Bacteria 9511
298 Ga0466960_0004090 3300044901 Bacteria 5669
299 Ga0466960_0061109 3300044901 Bacteria 1849
300 Ga0466960_0225131 3300044901 Bacteria 1033
301 Ga0466959_0016228 3300045049 Bacteria 5437
302 Ga0466959_0100421 3300045049 Bacteria 2071
303 Ga0466959_0312413 3300045049 Bacteria 1075
304 Ga0466958_0001611 3300045836 Bacteria 10858
305 Ga0466958_0014906 3300045836 Bacteria 4444
306 Ga0466958_0026895 3300045836 Bacteria 3401
307 Ga0466967_0004425 3300045976 Bacteria 9470
308 Ga0466967_0039777 3300045976 Bacteria 4045
309 Ga0466967_0131491 3300045976 Bacteria 2324
310 Ga0466967_0204644 3300045976 Bacteria 1870
311 Ga0495629_0013469 3300046459 Bacteria 5898
312 Ga0495639_0040540 3300046475 Bacteria 2095
313 Ga0495662_0081425 3300046476 Bacteria 1574
314 Ga0495640_0044166 3300046533 Bacteria 3100
315 Ga0495667_0114901 3300046559 Bacteria 1739
316 Ga0495581_0036565 3300047315 Bacteria 2841
317 Ga0495672_0228035 3300047320 Bacteria 916
318 Ga0495676_0068711 3300047321 Bacteria 2736
319 Ga0495686_0035607 3300047472 Bacteria 3198
320 Ga0495686_0178961 3300047472 Bacteria 1230
321 Ga0496100_0005283 3300048903 Bacteria 6938
322 Ga0496100_0032895 3300048903 Bacteria 3239
323 Ga0496100_0412653 3300048903 Bacteria 1030
324 Ga0496101_0005556 3300048904 Bacteria 8047
325 Ga0496101_0009026 3300048904 Bacteria 6538
326 Ga0496101_0023436 3300048904 Bacteria 4265
327 Ga0496102_0000587 3300048905 Bacteria 38525
328 Ga0496102_0012278 3300048905 Bacteria 7408
329 Ga0496102_0026207 3300048905 Bacteria 5197
330 Ga0496102_0032917 3300048905 Bacteria 4659
331 Ga0496102_0157975 3300048905 Bacteria 2132
332 Ga0496102_0177824 3300048905 Bacteria 2004
333 Ga0496103_0001354 3300048906 Bacteria 16543
334 Ga0496104_0011430 3300048907 Bacteria 7952
335 Ga0496104_0033199 3300048907 Bacteria 4806
336 Ga0496104_0228536 3300048907 Bacteria 1773
337 Ga0496105_0023567 3300048908 Bacteria 4994
338 Ga0496105_0153779 3300048908 Bacteria 1890
339 Ga0496106_0005094 3300048909 Bacteria 9728
340 Ga0496106_0008195 3300048909 Bacteria 7723
341 Ga0496106_0327760 3300048909 Bacteria 1229
342 Ga0496107_0001833 3300048910 Bacteria 13417
343 Ga0496107_0003385 3300048910 Bacteria 10664
344 Ga0496107_0059042 3300048910 Bacteria 2775
345 Ga0496107_0081961 3300048910 Bacteria 2353
346 Ga0496108_0006048 3300048911 Bacteria 9795
347 Ga0496108_0008335 3300048911 Bacteria 8407
348 Ga0496108_0025696 3300048911 Bacteria 4855
349 Ga0496108_0385786 3300048911 Bacteria 1223
350 Ga0496108_0408003 3300048911 Bacteria 1187
351 Ga0496109_0016623 3300048912 Bacteria 6435
352 Ga0496109_0032804 3300048912 Bacteria 4670
353 Ga0496109_0347475 3300048912 Bacteria 1401
354 Ga0496110_0036695 3300048913 Bacteria 4258
355 Ga0496110_0074772 3300048913 Bacteria 3010
356 Ga0496110_0077224 3300048913 Bacteria 2962
357 Ga0496111_0717527 3300048914 Bacteria 726
358 Ga0496112_0001686 3300048915 Bacteria 17213
359 Ga0496112_0024360 3300048915 Bacteria 5793
360 Ga0496112_0109913 3300048915 Bacteria 2727
361 Ga0496112_0128754 3300048915 Bacteria 2502
362 Ga0496113_0349396 3300048916 Bacteria 1186
363 Ga0496113_0354433 3300048916 Bacteria 1177
364 Ga0496114_0003685 3300048917 Bacteria 11785
365 Ga0496114_0004362 3300048917 Bacteria 10953
366 Ga0496114_0768830 3300048917 Bacteria 841
367 Ga0496115_0188814 3300048918 Bacteria 1703
368 Ga0496116_0027247 3300048919 Bacteria 4163
369 Ga0496117_0005770 3300048920 Bacteria 12857
370 Ga0496118_0000272 3300048921 Bacteria 91016
371 Ga0496118_0003575 3300048921 Bacteria 19367
372 Ga0496119_0001469 3300048922 Bacteria 28203
373 Ga0496120_0026118 3300048923 Bacteria 3611
374 Ga0496124_0215112 3300048927 Bacteria 1450
375 Ga0496126_0007764 3300048929 Bacteria 11691
376 Ga0496126_0097303 3300048929 Bacteria 2579
377 Ga0501032_0025311 3300049569 Bacteria 4092
378 Ga0501032_0027297 3300049569 Bacteria 3924
379 Ga0501033_0058994 3300049570 Bacteria 2834
380 Ga0501033_0066659 3300049570 Bacteria 2647
381 Ga0501034_0001406 3300049571 Bacteria 32322
382 Ga0501034_0025622 3300049571 Bacteria 6006
383 Ga0501034_0218076 3300049571 Bacteria 1861
384 Ga0501036_0056865 3300049572 Bacteria 3314
385 Ga0501037_0005160 3300049573 Bacteria 9505
386 Ga0501038_0317744 3300049574 Bacteria 1219
387 Ga0501039_0400500 3300049575 Bacteria 1078
388 Ga0501046_0000302 3300049580 Bacteria 49738
389 Ga0501047_0035404 3300049581 Bacteria 4823
390 Ga0501047_0141701 3300049581 Bacteria 2282
391 Ga0501048_0152730 3300049582 Bacteria 1633
392 Ga0501070_0000731 3300049586 Bacteria 30025
393 Ga0501070_0012738 3300049586 Bacteria 7090
394 Ga0501035_0000742 3300049822 Bacteria 35160
395 Ga0501035_0006371 3300049822 Bacteria 11096
396 Ga0501044_0000313 3300049823 Bacteria 61310
397 Ga0501044_0022214 3300049823 Bacteria 6761
398 nmdc:mga03n38_1994_c1 3300050490 Bacteria 6148
399 nmdc:mga03n38_221323_c1 3300050490 Bacteria 988
400 nmdc:mga03n38_4713_c1 3300050490 Bacteria 4556
401 nmdc:mga03n38_50390_c1 3300050490 Bacteria 1855
402 nmdc:mga03n38_60165_c1 3300050490 Bacteria 1726
403 nmdc:mga03n38_6367_c1 3300050490 Bacteria 4096
404 nmdc:mga00v17_2735_c1 3300050491 Bacteria 9051
405 nmdc:mga00v17_3093_c1 3300050491 Bacteria 8560
406 nmdc:mga0yw44_228390_c1 3300050492 Bacteria 1235
407 nmdc:mga0yw44_2783_c1 3300050492 Bacteria 7577
408 nmdc:mga0yw44_335245_c1 3300050492 Bacteria 1017
409 nmdc:mga0yw44_62925_c1 3300050492 Bacteria 2280
410 nmdc:mga06z11_178456_c1 3300050494 Bacteria 1223
411 nmdc:mga06z11_21230_c1 3300050494 Bacteria 3015
412 nmdc:mga07m45_12582_c1 3300050496 Bacteria 4474
413 nmdc:mga07m45_222865_c1 3300050496 Bacteria 1097
414 nmdc:mga05p37_17907_c1 3300050507 Bacteria 8551
415 nmdc:mga0qj67_118334_c1 3300050509 Bacteria 2142
416 nmdc:mga0sz30_101492_c1 3300050516 Bacteria 1257
417 nmdc:mga0sz30_17655_c1 3300050516 Bacteria 2848
418 nmdc:mga0sz30_2644_c1 3300050516 Bacteria 6384
419 nmdc:mga0sz30_9361_c1 3300050516 Bacteria 3725
420 nmdc:mga0sz30_9965_c1 3300050516 Bacteria 3631
421 Ga0500635_0039456 3300053080 Bacteria 1571
422 Ga0500643_034637 3300053087 Bacteria 1519
423 Ga0500641_0095066 3300053096 Bacteria 1275
424 Ga0500652_063095 3300053131 Bacteria 1529
425 Ga0500559_0013721 3300053136 Bacteria 3427
426 Ga0500627_0008809 3300053158 Bacteria 3603
427 Ga0500645_000016 3300053730 Bacteria 147392
428 Ga0500645_021663 3300053730 Bacteria 1982
429 Ga0500645_044856 3300053730 Bacteria 1300
430 Ga0466962_0011881 3300061719 Bacteria 4192
431 Ga0466962_0070677 3300061719 Bacteria 1668

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048914 Ga0496111_0717527 Ga0496111_0717527_26_703 225
2 3300039450 Ga0436363_0005942 Ga0436363_0005942_1787_2479 230
3 3300048917 Ga0496114_0768830 Ga0496114_0768830_114_821 235
4 3300053080 Ga0500635_0039456 Ga0500635_0039456_827_1546 239
5 3300049574 Ga0501038_0317744 Ga0501038_0317744_46_789 240
6 3300038443 Ga0395901_0587284 Ga0395901_0587284_340_1071 243
7 iso_pu_bacteria 2744054611 2744954956 258
8 iso_pu_bacteria 2939582691 2939588848 259
9 3300044684 Ga0466966_0010057 Ga0466966_0010057_3954_4751 263
10 3300044693 Ga0466961_0020608 Ga0466961_0020608_2839_3636 263
11 3300044694 Ga0466963_0018937 Ga0466963_0018937_1223_2020 263
12 3300044735 Ga0466968_0006620 Ga0466968_0006620_2422_3219 263
13 3300044765 Ga0466970_0008373 Ga0466970_0008373_3833_4630 263
14 3300044901 Ga0466960_0001146 Ga0466960_0001146_8463_9254 263
15 3300045049 Ga0466959_0100421 Ga0466959_0100421_1191_1988 263
16 3300045836 Ga0466958_0014906 Ga0466958_0014906_1208_2005 263
17 3300045976 Ga0466967_0204644 Ga0466967_0204644_419_1210 263
18 3300047472 Ga0495686_0035607 Ga0495686_0035607_2127_2930 263
19 3300053096 Ga0500641_0095066 Ga0500641_0095066_423_1214 263
20 3300061719 Ga0466962_0070677 Ga0466962_0070677_212_1009 263
21 iso_pu_bacteria 2738541274 2738704507 263
22 iso_pu_bacteria 2738543028 2739331010 263
23 3300049571 Ga0501034_0218076 Ga0501034_0218076_20_814 264
24 iso_pu_bacteria 2738541274 2738708124 264
25 iso_pu_bacteria 2738543028 2739334723 264
26 iso_pu_bacteria 2902799365 2902802209 264
27 iso_pu_bacteria 2902799365 2902803815 264
28 3300006038 Ga0075365_10034408 Ga0075365_100344082 265
29 3300006038 Ga0075365_10162682 Ga0075365_101626822 265
30 3300011119 Ga0105246_10114130 Ga0105246_101141302 265
31 3300013308 Ga0157375_10323995 Ga0157375_103239952 265
32 3300045976 Ga0466967_0039777 Ga0466967_0039777_922_1719 265
33 3300050492 nmdc:mga0yw44_335245_c1 nmdc:mga0yw44_335245_c1_184_981 265
34 3300006038 Ga0075365_10003735 Ga0075365_100037352 266
35 3300006048 Ga0075363_100000301 Ga0075363_1000003019 266
36 3300006048 Ga0075363_100003512 Ga0075363_1000035126 266
37 3300006048 Ga0075363_100005377 Ga0075363_1000053773 266
38 3300006048 Ga0075363_100094913 Ga0075363_1000949132 266
39 3300006048 Ga0075363_100264509 Ga0075363_1002645091 266
40 3300006178 Ga0075367_10004632 Ga0075367_100046326 266
41 3300006353 Ga0075370_10000890 Ga0075370_100008902 266
42 3300006353 Ga0075370_10004551 Ga0075370_100045516 266
43 3300006353 Ga0075370_10083473 Ga0075370_100834732 266
44 3300031824 Ga0307413_10015591 Ga0307413_100155913 266
45 3300031852 Ga0307410_10009089 Ga0307410_100090893 266
46 3300031995 Ga0307409_100138476 Ga0307409_1001384762 266
47 3300032002 Ga0307416_100034035 Ga0307416_1000340354 266
48 3300032005 Ga0307411_10059219 Ga0307411_100592192 266
49 3300041512 Ga0451853_1512470 Ga0451853_1512470_297_1115 266
50 3300047320 Ga0495672_0228035 Ga0495672_0228035_74_874 266
51 3300050490 nmdc:mga03n38_1994_c1 nmdc:mga03n38_1994_c1_3155_3955 266
52 3300050490 nmdc:mga03n38_4713_c1 nmdc:mga03n38_4713_c1_860_1660 266
53 3300050490 nmdc:mga03n38_60165_c1 nmdc:mga03n38_60165_c1_454_1257 266
54 3300050490 nmdc:mga03n38_6367_c1 nmdc:mga03n38_6367_c1_565_1365 266
55 3300050492 nmdc:mga0yw44_2783_c1 nmdc:mga0yw44_2783_c1_3825_4625 266
56 3300050494 nmdc:mga06z11_21230_c1 nmdc:mga06z11_21230_c1_2184_2984 266
57 3300050516 nmdc:mga0sz30_9361_c1 nmdc:mga0sz30_9361_c1_1896_2696 266
58 iso_pu_bacteria 2929212328 2929216805 266
59 3300005334 Ga0068869_100026751 Ga0068869_1000267514 267
60 3300005337 Ga0070682_100060269 Ga0070682_1000602691 267
61 3300005338 Ga0068868_100060928 Ga0068868_1000609282 267
62 3300005339 Ga0070660_100667576 Ga0070660_1006675761 267
63 3300005345 Ga0070692_10206782 Ga0070692_102067822 267
64 3300005353 Ga0070669_100208492 Ga0070669_1002084922 267
65 3300005367 Ga0070667_100460440 Ga0070667_1004604402 267
66 3300005439 Ga0070711_100015566 Ga0070711_1000155662 267
67 3300005456 Ga0070678_100085628 Ga0070678_1000856282 267
68 3300005456 Ga0070678_100521211 Ga0070678_1005212111 267
69 3300005535 Ga0070684_100403302 Ga0070684_1004033022 267
70 3300005546 Ga0070696_100458033 Ga0070696_1004580331 267
71 3300005547 Ga0070693_100256341 Ga0070693_1002563412 267
72 3300005548 Ga0070665_100084282 Ga0070665_1000842822 267
73 3300005549 Ga0070704_100342416 Ga0070704_1003424162 267
74 3300005615 Ga0070702_100034359 Ga0070702_1000343592 267
75 3300005615 Ga0070702_100174269 Ga0070702_1001742692 267
76 3300005618 Ga0068864_100039998 Ga0068864_1000399983 267
77 3300005718 Ga0068866_10207910 Ga0068866_102079101 267
78 3300005719 Ga0068861_100080787 Ga0068861_1000807872 267
79 3300005842 Ga0068858_100058958 Ga0068858_1000589582 267
80 3300005937 Ga0081455_10139110 Ga0081455_101391102 267
81 3300006048 Ga0075363_100002272 Ga0075363_1000022722 267
82 3300006048 Ga0075363_100005175 Ga0075363_1000051755 267
83 3300006048 Ga0075363_100010832 Ga0075363_1000108325 267
84 3300006051 Ga0075364_10003925 Ga0075364_100039257 267
85 3300006051 Ga0075364_10009589 Ga0075364_100095895 267
86 3300006163 Ga0070715_10048157 Ga0070715_100481572 267
87 3300006173 Ga0070716_100004132 Ga0070716_1000041326 267
88 3300006178 Ga0075367_10084765 Ga0075367_100847652 267
89 3300006186 Ga0075369_10006868 Ga0075369_100068684 267
90 3300006186 Ga0075369_10081999 Ga0075369_100819992 267
91 3300006353 Ga0075370_10014001 Ga0075370_100140016 267
92 3300006844 Ga0075428_100006189 Ga0075428_10000618913 267
93 3300006846 Ga0075430_100117388 Ga0075430_1001173882 267
94 3300006881 Ga0068865_100155609 Ga0068865_1001556091 267
95 3300009098 Ga0105245_10022670 Ga0105245_100226704 267
96 3300009098 Ga0105245_10062155 Ga0105245_100621552 267
97 3300009101 Ga0105247_10014653 Ga0105247_100146533 267
98 3300009148 Ga0105243_10135388 Ga0105243_101353882 267
99 3300009174 Ga0105241_10195166 Ga0105241_101951661 267
100 3300009176 Ga0105242_10070058 Ga0105242_100700582 267
101 3300009177 Ga0105248_10089746 Ga0105248_100897462 267
102 3300009551 Ga0105238_10407264 Ga0105238_104072641 267
103 3300009553 Ga0105249_10060875 Ga0105249_100608751 267
104 3300010375 Ga0105239_10082222 Ga0105239_100822222 267
105 3300010375 Ga0105239_10502591 Ga0105239_105025912 267
106 3300011119 Ga0105246_10117230 Ga0105246_101172302 267
107 3300011119 Ga0105246_10628877 Ga0105246_106288771 267
108 3300013296 Ga0157374_10007254 Ga0157374_100072545 267
109 3300013297 Ga0157378_10060973 Ga0157378_100609732 267
110 3300013306 Ga0163162_10007824 Ga0163162_100078245 267
111 3300021384 Ga0213876_10002900 Ga0213876_100029004 267
112 3300021388 Ga0213875_10015087 Ga0213875_100150875 267
113 3300021388 Ga0213875_10036418 Ga0213875_100364182 267
114 3300021388 Ga0213875_10082712 Ga0213875_100827122 267
115 3300025303 Ga0209051_1056992 Ga0209051_10569921 267
116 3300025901 Ga0207688_10049978 Ga0207688_100499782 267
117 3300025905 Ga0207685_10093368 Ga0207685_100933682 267
118 3300025916 Ga0207663_10049297 Ga0207663_100492972 267
119 3300025919 Ga0207657_10217863 Ga0207657_102178632 267
120 3300025927 Ga0207687_10158328 Ga0207687_101583282 267
121 3300025927 Ga0207687_10368025 Ga0207687_103680252 267
122 3300025933 Ga0207706_10053669 Ga0207706_100536691 267
123 3300025934 Ga0207686_10074112 Ga0207686_100741122 267
124 3300025935 Ga0207709_10106126 Ga0207709_101061262 267
125 3300025939 Ga0207665_10007811 Ga0207665_100078116 267
126 3300025942 Ga0207689_10010719 Ga0207689_100107195 267
127 3300025960 Ga0207651_10172082 Ga0207651_101720822 267
128 3300025986 Ga0207658_10271092 Ga0207658_102710922 267
129 3300026067 Ga0207678_10003908 Ga0207678_100039082 267
130 3300026067 Ga0207678_10057320 Ga0207678_100573202 267
131 3300026095 Ga0207676_10016432 Ga0207676_100164323 267
132 3300026095 Ga0207676_10415952 Ga0207676_104159522 267
133 3300026118 Ga0207675_100116948 Ga0207675_1001169482 267
134 3300026121 Ga0207683_10131193 Ga0207683_101311932 267
135 3300028380 Ga0268265_10041932 Ga0268265_100419323 267
136 3300031727 Ga0316576_10472212 Ga0316576_104722121 267
137 3300035170 Ga0373943_0210186 Ga0373943_0210186_186_998 267
138 3300035691 Ga0373931_0067563 Ga0373931_0067563_1051_1854 267
139 3300037853 Ga0436364_0166962 Ga0436364_0166962_4147_4953 267
140 3300037853 Ga0436364_0706017 Ga0436364_0706017_3074_3877 267
141 3300037853 Ga0436364_0907426 Ga0436364_0907426_1298_2107 267
142 3300039437 Ga0436365_0271296 Ga0436365_0271296_31519_32322 267
143 3300039437 Ga0436365_1685157 Ga0436365_1685157_11840_12646 267
144 3300039437 Ga0436365_1781365 Ga0436365_1781365_23936_24745 267
145 3300041411 Ga0439466_0038715 Ga0439466_0038715_262_1065 267
146 3300044683 Ga0466965_0103242 Ga0466965_0103242_147_950 267
147 3300044684 Ga0466966_0019768 Ga0466966_0019768_2025_2828 267
148 3300044693 Ga0466961_0016900 Ga0466961_0016900_714_1517 267
149 3300044719 Ga0466971_0060527 Ga0466971_0060527_877_1680 267
150 3300044765 Ga0466970_0009540 Ga0466970_0009540_883_1686 267
151 3300044842 Ga0466957_0022738 Ga0466957_0022738_802_1605 267
152 3300045049 Ga0466959_0016228 Ga0466959_0016228_2478_3281 267
153 3300045836 Ga0466958_0026895 Ga0466958_0026895_771_1574 267
154 3300046459 Ga0495629_0013469 Ga0495629_0013469_2299_3111 267
155 3300046475 Ga0495639_0040540 Ga0495639_0040540_514_1326 267
156 3300046476 Ga0495662_0081425 Ga0495662_0081425_152_964 267
157 3300046533 Ga0495640_0044166 Ga0495640_0044166_1554_2366 267
158 3300046559 Ga0495667_0114901 Ga0495667_0114901_463_1275 267
159 3300047315 Ga0495581_0036565 Ga0495581_0036565_490_1302 267
160 3300047321 Ga0495676_0068711 Ga0495676_0068711_409_1221 267
161 3300048905 Ga0496102_0032917 Ga0496102_0032917_2575_3378 267
162 3300048909 Ga0496106_0327760 Ga0496106_0327760_56_859 267
163 3300048910 Ga0496107_0081961 Ga0496107_0081961_89_892 267
164 3300048911 Ga0496108_0006048 Ga0496108_0006048_6666_7478 267
165 3300048911 Ga0496108_0008335 Ga0496108_0008335_6845_7648 267
166 3300048911 Ga0496108_0385786 Ga0496108_0385786_210_1031 267
167 3300048911 Ga0496108_0408003 Ga0496108_0408003_167_970 267
168 3300048912 Ga0496109_0032804 Ga0496109_0032804_235_1038 267
169 3300048913 Ga0496110_0074772 Ga0496110_0074772_1385_2197 267
170 3300048913 Ga0496110_0077224 Ga0496110_0077224_207_1010 267
171 3300048915 Ga0496112_0024360 Ga0496112_0024360_1731_2534 267
172 3300048915 Ga0496112_0128754 Ga0496112_0128754_197_1018 267
173 3300048916 Ga0496113_0349396 Ga0496113_0349396_215_1027 267
174 3300048918 Ga0496115_0188814 Ga0496115_0188814_814_1617 267
175 3300048929 Ga0496126_0097303 Ga0496126_0097303_606_1409 267
176 3300049586 Ga0501070_0012738 Ga0501070_0012738_707_1510 267
177 3300050490 nmdc:mga03n38_221323_c1 nmdc:mga03n38_221323_c1_12_815 267
178 3300050490 nmdc:mga03n38_50390_c1 nmdc:mga03n38_50390_c1_149_952 267
179 3300050491 nmdc:mga00v17_2735_c1 nmdc:mga00v17_2735_c1_1947_2753 267
180 3300050491 nmdc:mga00v17_3093_c1 nmdc:mga00v17_3093_c1_3557_4360 267
181 3300050492 nmdc:mga0yw44_62925_c1 nmdc:mga0yw44_62925_c1_279_1082 267
182 3300050494 nmdc:mga06z11_178456_c1 nmdc:mga06z11_178456_c1_135_938 267
183 3300050496 nmdc:mga07m45_12582_c1 nmdc:mga07m45_12582_c1_1919_2725 267
184 3300050496 nmdc:mga07m45_222865_c1 nmdc:mga07m45_222865_c1_282_1085 267
185 3300050507 nmdc:mga05p37_17907_c1 nmdc:mga05p37_17907_c1_3905_4708 267
186 3300050509 nmdc:mga0qj67_118334_c1 nmdc:mga0qj67_118334_c1_1013_1816 267
187 3300050516 nmdc:mga0sz30_101492_c1 nmdc:mga0sz30_101492_c1_111_914 267
188 3300050516 nmdc:mga0sz30_17655_c1 nmdc:mga0sz30_17655_c1_1291_2097 267
189 3300050516 nmdc:mga0sz30_2644_c1 nmdc:mga0sz30_2644_c1_2025_2828 267
190 3300053087 Ga0500643_034637 Ga0500643_034637_617_1429 267
191 3300053131 Ga0500652_063095 Ga0500652_063095_559_1362 267
192 3300053136 Ga0500559_0013721 Ga0500559_0013721_1049_1852 267
193 3300053158 Ga0500627_0008809 Ga0500627_0008809_1260_2063 267
194 3300053730 Ga0500645_000016 Ga0500645_000016_126773_127576 267
195 3300053730 Ga0500645_021663 Ga0500645_021663_294_1106 267
196 3300053730 Ga0500645_044856 Ga0500645_044856_238_1041 267
197 3300001990 JGI24737J22298_10086576 JGI24737J22298_100865761 268
198 3300002074 JGI24748J21848_1007397 JGI24748J21848_10073971 268
199 3300002077 JGI24744J21845_10000056 JGI24744J21845_100000568 268
200 3300002244 JGI24742J22300_10000298 JGI24742J22300_100002986 268
201 3300005328 Ga0070676_10009360 Ga0070676_100093602 268
202 3300005329 Ga0070683_100573764 Ga0070683_1005737641 268
203 3300005330 Ga0070690_100138849 Ga0070690_1001388492 268
204 3300005334 Ga0068869_100031639 Ga0068869_1000316394 268
205 3300005336 Ga0070680_100189390 Ga0070680_1001893902 268
206 3300005337 Ga0070682_100002572 Ga0070682_1000025724 268
207 3300005338 Ga0068868_100003487 Ga0068868_1000034875 268
208 3300005340 Ga0070689_100092810 Ga0070689_1000928102 268
209 3300005347 Ga0070668_100001188 Ga0070668_1000011889 268
210 3300005347 Ga0070668_100060067 Ga0070668_1000600672 268
211 3300005353 Ga0070669_100000597 Ga0070669_10000059714 268
212 3300005353 Ga0070669_100008771 Ga0070669_1000087716 268
213 3300005355 Ga0070671_100035331 Ga0070671_1000353312 268
214 3300005356 Ga0070674_100043807 Ga0070674_1000438071 268
215 3300005365 Ga0070688_100094295 Ga0070688_1000942951 268
216 3300005366 Ga0070659_100010064 Ga0070659_1000100644 268
217 3300005367 Ga0070667_100000388 Ga0070667_10000038834 268
218 3300005367 Ga0070667_100009690 Ga0070667_1000096905 268
219 3300005435 Ga0070714_100056402 Ga0070714_1000564023 268
220 3300005437 Ga0070710_10002861 Ga0070710_100028612 268
221 3300005439 Ga0070711_100050470 Ga0070711_1000504703 268
222 3300005439 Ga0070711_100455780 Ga0070711_1004557801 268
223 3300005440 Ga0070705_100003517 Ga0070705_1000035172 268
224 3300005441 Ga0070700_100001498 Ga0070700_1000014985 268
225 3300005444 Ga0070694_100294658 Ga0070694_1002946581 268
226 3300005456 Ga0070678_100001466 Ga0070678_1000014666 268
227 3300005456 Ga0070678_100124376 Ga0070678_1001243762 268
228 3300005459 Ga0068867_100007367 Ga0068867_1000073675 268
229 3300005466 Ga0070685_10040055 Ga0070685_100400552 268
230 3300005535 Ga0070684_100095799 Ga0070684_1000957993 268
231 3300005539 Ga0068853_100003962 Ga0068853_1000039622 268
232 3300005543 Ga0070672_100310512 Ga0070672_1003105122 268
233 3300005545 Ga0070695_100003335 Ga0070695_1000033355 268
234 3300005546 Ga0070696_100294219 Ga0070696_1002942192 268
235 3300005547 Ga0070693_100043486 Ga0070693_1000434862 268
236 3300005548 Ga0070665_100004946 Ga0070665_1000049468 268
237 3300005548 Ga0070665_100006513 Ga0070665_1000065134 268
238 3300005549 Ga0070704_100002412 Ga0070704_1000024129 268
239 3300005578 Ga0068854_100002546 Ga0068854_1000025465 268
240 3300005614 Ga0068856_100134700 Ga0068856_1001347002 268
241 3300005615 Ga0070702_100013152 Ga0070702_1000131522 268
242 3300005615 Ga0070702_100266012 Ga0070702_1002660121 268
243 3300005617 Ga0068859_100000276 Ga0068859_10000027615 268
244 3300005617 Ga0068859_100008624 Ga0068859_1000086247 268
245 3300005718 Ga0068866_10001276 Ga0068866_100012768 268
246 3300005719 Ga0068861_100000307 Ga0068861_10000030722 268
247 3300005719 Ga0068861_100608388 Ga0068861_1006083882 268
248 3300005841 Ga0068863_100000431 Ga0068863_10000043115 268
249 3300005841 Ga0068863_100090030 Ga0068863_1000900303 268
250 3300005841 Ga0068863_100119240 Ga0068863_1001192402 268
251 3300005842 Ga0068858_100000440 Ga0068858_10000044025 268
252 3300005843 Ga0068860_100000232 Ga0068860_10000023275 268
253 3300005843 Ga0068860_100007260 Ga0068860_1000072604 268
254 3300005843 Ga0068860_100274904 Ga0068860_1002749042 268
255 3300005844 Ga0068862_100000055 Ga0068862_10000005515 268
256 3300005844 Ga0068862_100002080 Ga0068862_10000208010 268
257 3300005937 Ga0081455_10096905 Ga0081455_100969052 268
258 3300006038 Ga0075365_10002978 Ga0075365_100029785 268
259 3300006048 Ga0075363_100104820 Ga0075363_1001048202 268
260 3300006051 Ga0075364_10141109 Ga0075364_101411092 268
261 3300006163 Ga0070715_10028473 Ga0070715_100284732 268
262 3300006173 Ga0070716_100003667 Ga0070716_1000036672 268
263 3300006175 Ga0070712_100003774 Ga0070712_1000037744 268
264 3300006186 Ga0075369_10016492 Ga0075369_100164922 268
265 3300006881 Ga0068865_100001579 Ga0068865_10000157910 268
266 3300006931 Ga0097620_100000276 Ga0097620_10000027615 268
267 3300006931 Ga0097620_100008624 Ga0097620_1000086247 268
268 3300009092 Ga0105250_10058617 Ga0105250_100586172 268
269 3300009098 Ga0105245_10002313 Ga0105245_100023137 268
270 3300009101 Ga0105247_10000029 Ga0105247_10000029188 268
271 3300009101 Ga0105247_10000584 Ga0105247_1000058426 268
272 3300009148 Ga0105243_10001688 Ga0105243_1000168816 268
273 3300009174 Ga0105241_10014332 Ga0105241_100143323 268
274 3300009176 Ga0105242_10000923 Ga0105242_1000092310 268
275 3300009176 Ga0105242_10146632 Ga0105242_101466322 268
276 3300009177 Ga0105248_10000136 Ga0105248_1000013674 268
277 3300009177 Ga0105248_10002643 Ga0105248_1000264310 268
278 3300009177 Ga0105248_10182458 Ga0105248_101824582 268
279 3300009545 Ga0105237_10024507 Ga0105237_100245074 268
280 3300009553 Ga0105249_10000077 Ga0105249_1000007715 268
281 3300009553 Ga0105249_10003484 Ga0105249_100034849 268
282 3300009553 Ga0105249_10057305 Ga0105249_100573052 268
283 3300010375 Ga0105239_10131889 Ga0105239_101318891 268
284 3300013297 Ga0157378_10002579 Ga0157378_100025796 268
285 3300013297 Ga0157378_10218295 Ga0157378_102182952 268
286 3300013306 Ga0163162_10002796 Ga0163162_1000279610 268
287 3300013307 Ga0157372_10000875 Ga0157372_1000087519 268
288 3300013308 Ga0157375_10002649 Ga0157375_100026497 268
289 3300013308 Ga0157375_10200845 Ga0157375_102008452 268
290 3300014325 Ga0163163_10108311 Ga0163163_101083113 268
291 3300014325 Ga0163163_10121163 Ga0163163_101211633 268
292 3300014325 Ga0163163_11066633 Ga0163163_110666331 268
293 3300014326 Ga0157380_10000844 Ga0157380_1000084413 268
294 3300014497 Ga0182008_10122575 Ga0182008_101225752 268
295 3300014968 Ga0157379_10003466 Ga0157379_100034666 268
296 3300014968 Ga0157379_10256439 Ga0157379_102564392 268
297 3300017792 Ga0163161_10001223 Ga0163161_100012239 268
298 3300025898 Ga0207692_10002758 Ga0207692_100027586 268
299 3300025899 Ga0207642_10000230 Ga0207642_1000023015 268
300 3300025900 Ga0207710_10000046 Ga0207710_1000004615 268
301 3300025901 Ga0207688_10000208 Ga0207688_100002088 268
302 3300025904 Ga0207647_10046619 Ga0207647_100466192 268
303 3300025905 Ga0207685_10002125 Ga0207685_100021252 268
304 3300025907 Ga0207645_10022908 Ga0207645_100229085 268
305 3300025915 Ga0207693_10000614 Ga0207693_100006146 268
306 3300025923 Ga0207681_10000948 Ga0207681_100009489 268
307 3300025923 Ga0207681_10006923 Ga0207681_100069234 268
308 3300025927 Ga0207687_10007362 Ga0207687_100073626 268
309 3300025931 Ga0207644_10182382 Ga0207644_101823822 268
310 3300025931 Ga0207644_10653573 Ga0207644_106535731 268
311 3300025932 Ga0207690_10020349 Ga0207690_100203495 268
312 3300025934 Ga0207686_10004857 Ga0207686_100048576 268
313 3300025934 Ga0207686_10104701 Ga0207686_101047012 268
314 3300025935 Ga0207709_10006644 Ga0207709_100066446 268
315 3300025936 Ga0207670_10008584 Ga0207670_100085842 268
316 3300025937 Ga0207669_10010358 Ga0207669_100103584 268
317 3300025938 Ga0207704_10003738 Ga0207704_100037385 268
318 3300025939 Ga0207665_10002840 Ga0207665_100028406 268
319 3300025939 Ga0207665_10086686 Ga0207665_100866862 268
320 3300025940 Ga0207691_10314124 Ga0207691_103141242 268
321 3300025941 Ga0207711_10000111 Ga0207711_1000011115 268
322 3300025941 Ga0207711_10119968 Ga0207711_101199682 268
323 3300025941 Ga0207711_10130156 Ga0207711_101301561 268
324 3300025944 Ga0207661_10689547 Ga0207661_106895471 268
325 3300025961 Ga0207712_10000017 Ga0207712_10000017211 268
326 3300025972 Ga0207668_10022542 Ga0207668_100225421 268
327 3300025972 Ga0207668_10026222 Ga0207668_100262224 268
328 3300025981 Ga0207640_10044024 Ga0207640_100440242 268
329 3300025986 Ga0207658_10000016 Ga0207658_10000016201 268
330 3300025986 Ga0207658_10020042 Ga0207658_100200423 268
331 3300026023 Ga0207677_10015294 Ga0207677_100152944 268
332 3300026035 Ga0207703_10016881 Ga0207703_100168813 268
333 3300026035 Ga0207703_10057977 Ga0207703_100579772 268
334 3300026035 Ga0207703_10202926 Ga0207703_102029262 268
335 3300026078 Ga0207702_10280142 Ga0207702_102801422 268
336 3300026088 Ga0207641_10001756 Ga0207641_1000175610 268
337 3300026088 Ga0207641_10008314 Ga0207641_100083147 268
338 3300026088 Ga0207641_10207975 Ga0207641_102079752 268
339 3300026088 Ga0207641_10444271 Ga0207641_104442712 268
340 3300026089 Ga0207648_10000112 Ga0207648_1000011272 268
341 3300026118 Ga0207675_100000917 Ga0207675_10000091721 268
342 3300026121 Ga0207683_10000451 Ga0207683_1000045121 268
343 3300026121 Ga0207683_10150364 Ga0207683_101503642 268
344 3300028379 Ga0268266_10005455 Ga0268266_100054554 268
345 3300028379 Ga0268266_10010157 Ga0268266_100101578 268
346 3300028380 Ga0268265_10000067 Ga0268265_1000006715 268
347 3300028380 Ga0268265_10006910 Ga0268265_100069104 268
348 3300028381 Ga0268264_10000146 Ga0268264_10000146134 268
349 3300032002 Ga0307416_100233677 Ga0307416_1002336772 268
350 3300032126 Ga0307415_100594449 Ga0307415_1005944492 268
351 3300035241 Ga0373961_0024187 Ga0373961_0024187_114_920 268
352 3300035691 Ga0373931_0002988 Ga0373931_0002988_3384_4190 268
353 3300036457 Ga0265778_014599 Ga0265778_014599_68_874 268
354 3300039437 Ga0436365_0430385 Ga0436365_0430385_10074_10889 268
355 3300039450 Ga0436363_1257506 Ga0436363_1257506_2658_3464 268
356 3300041410 Ga0439461_0004961 Ga0439461_0004961_181_987 268
357 3300041411 Ga0439466_0009445 Ga0439466_0009445_1472_2278 268
358 3300041413 Ga0439465_0005630 Ga0439465_0005630_39_845 268
359 3300041413 Ga0439465_0005901 Ga0439465_0005901_281_1087 268
360 3300041997 Ga0439431_0025764 Ga0439431_0025764_525_1331 268
361 3300042002 Ga0439442_004437 Ga0439442_004437_1969_2775 268
362 3300044656 Ga0466969_0025918 Ga0466969_0025918_1821_2627 268
363 3300044658 Ga0466972_0182318 Ga0466972_0182318_33_839 268
364 3300044684 Ga0466966_0043857 Ga0466966_0043857_1706_2512 268
365 3300044684 Ga0466966_0066671 Ga0466966_0066671_1189_1995 268
366 3300044693 Ga0466961_0017544 Ga0466961_0017544_3095_3901 268
367 3300044694 Ga0466963_0010509 Ga0466963_0010509_4298_5113 268
368 3300044694 Ga0466963_0335173 Ga0466963_0335173_232_1047 268
369 3300044694 Ga0466963_0429218 Ga0466963_0429218_80_886 268
370 3300044735 Ga0466968_0016883 Ga0466968_0016883_1109_1915 268
371 3300044842 Ga0466957_0064590 Ga0466957_0064590_28_834 268
372 3300044842 Ga0466957_0333676 Ga0466957_0333676_196_1011 268
373 3300044901 Ga0466960_0004090 Ga0466960_0004090_4297_5112 268
374 3300044901 Ga0466960_0061109 Ga0466960_0061109_325_1131 268
375 3300044901 Ga0466960_0225131 Ga0466960_0225131_205_1011 268
376 3300045049 Ga0466959_0312413 Ga0466959_0312413_55_861 268
377 3300045836 Ga0466958_0001611 Ga0466958_0001611_7182_7988 268
378 3300045976 Ga0466967_0004425 Ga0466967_0004425_8408_9223 268
379 3300045976 Ga0466967_0131491 Ga0466967_0131491_1077_1883 268
380 3300047472 Ga0495686_0178961 Ga0495686_0178961_362_1177 268
381 3300048903 Ga0496100_0005283 Ga0496100_0005283_481_1296 268
382 3300048903 Ga0496100_0032895 Ga0496100_0032895_370_1176 268
383 3300048903 Ga0496100_0412653 Ga0496100_0412653_47_853 268
384 3300048904 Ga0496101_0005556 Ga0496101_0005556_1418_2224 268
385 3300048904 Ga0496101_0009026 Ga0496101_0009026_4437_5252 268
386 3300048904 Ga0496101_0023436 Ga0496101_0023436_1232_2038 268
387 3300048905 Ga0496102_0000587 Ga0496102_0000587_31558_32373 268
388 3300048905 Ga0496102_0012278 Ga0496102_0012278_2331_3137 268
389 3300048905 Ga0496102_0026207 Ga0496102_0026207_3156_3962 268
390 3300048905 Ga0496102_0157975 Ga0496102_0157975_811_1626 268
391 3300048905 Ga0496102_0177824 Ga0496102_0177824_326_1141 268
392 3300048906 Ga0496103_0001354 Ga0496103_0001354_12196_13011 268
393 3300048907 Ga0496104_0011430 Ga0496104_0011430_1732_2538 268
394 3300048907 Ga0496104_0033199 Ga0496104_0033199_2144_2959 268
395 3300048907 Ga0496104_0228536 Ga0496104_0228536_671_1477 268
396 3300048908 Ga0496105_0023567 Ga0496105_0023567_3451_4266 268
397 3300048908 Ga0496105_0153779 Ga0496105_0153779_367_1173 268
398 3300048909 Ga0496106_0005094 Ga0496106_0005094_794_1609 268
399 3300048909 Ga0496106_0008195 Ga0496106_0008195_616_1422 268
400 3300048910 Ga0496107_0001833 Ga0496107_0001833_8303_9118 268
401 3300048910 Ga0496107_0003385 Ga0496107_0003385_8932_9738 268
402 3300048910 Ga0496107_0059042 Ga0496107_0059042_1109_1924 268
403 3300048911 Ga0496108_0025696 Ga0496108_0025696_3972_4778 268
404 3300048912 Ga0496109_0016623 Ga0496109_0016623_3913_4719 268
405 3300048912 Ga0496109_0347475 Ga0496109_0347475_122_928 268
406 3300048913 Ga0496110_0036695 Ga0496110_0036695_1759_2565 268
407 3300048915 Ga0496112_0001686 Ga0496112_0001686_10703_11509 268
408 3300048915 Ga0496112_0109913 Ga0496112_0109913_1169_1975 268
409 3300048916 Ga0496113_0354433 Ga0496113_0354433_351_1157 268
410 3300048917 Ga0496114_0003685 Ga0496114_0003685_9798_10613 268
411 3300048917 Ga0496114_0004362 Ga0496114_0004362_5461_6267 268
412 3300048919 Ga0496116_0027247 Ga0496116_0027247_1687_2502 268
413 3300048920 Ga0496117_0005770 Ga0496117_0005770_1410_2225 268
414 3300048921 Ga0496118_0000272 Ga0496118_0000272_24421_25236 268
415 3300048921 Ga0496118_0003575 Ga0496118_0003575_6943_7758 268
416 3300048922 Ga0496119_0001469 Ga0496119_0001469_10761_11576 268
417 3300048923 Ga0496120_0026118 Ga0496120_0026118_1480_2295 268
418 3300048927 Ga0496124_0215112 Ga0496124_0215112_12_827 268
419 3300048929 Ga0496126_0007764 Ga0496126_0007764_10520_11326 268
420 3300049569 Ga0501032_0025311 Ga0501032_0025311_1401_2216 268
421 3300049569 Ga0501032_0027297 Ga0501032_0027297_143_958 268
422 3300049570 Ga0501033_0058994 Ga0501033_0058994_1958_2773 268
423 3300049570 Ga0501033_0066659 Ga0501033_0066659_1735_2550 268
424 3300049571 Ga0501034_0001406 Ga0501034_0001406_6703_7518 268
425 3300049571 Ga0501034_0025622 Ga0501034_0025622_1664_2479 268
426 3300049572 Ga0501036_0056865 Ga0501036_0056865_1034_1849 268
427 3300049573 Ga0501037_0005160 Ga0501037_0005160_2290_3105 268
428 3300049575 Ga0501039_0400500 Ga0501039_0400500_251_1066 268
429 3300049580 Ga0501046_0000302 Ga0501046_0000302_9441_10256 268
430 3300049581 Ga0501047_0035404 Ga0501047_0035404_2353_3168 268
431 3300049581 Ga0501047_0141701 Ga0501047_0141701_971_1786 268
432 3300049582 Ga0501048_0152730 Ga0501048_0152730_161_976 268
433 3300049586 Ga0501070_0000731 Ga0501070_0000731_6437_7252 268
434 3300049822 Ga0501035_0000742 Ga0501035_0000742_730_1545 268
435 3300049822 Ga0501035_0006371 Ga0501035_0006371_1956_2771 268
436 3300049823 Ga0501044_0000313 Ga0501044_0000313_17744_18559 268
437 3300049823 Ga0501044_0022214 Ga0501044_0022214_3183_3998 268
438 3300050492 nmdc:mga0yw44_228390_c1 nmdc:mga0yw44_228390_c1_272_1084 268
439 3300050516 nmdc:mga0sz30_9965_c1 nmdc:mga0sz30_9965_c1_833_1639 268
440 3300061719 Ga0466962_0011881 Ga0466962_0011881_129_944 268
441 iso_pu_bacteria 2842134933 2842140229 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

Acyltransferase

41

172

0.92

PF03982

DAGAT

Diacylglycerol acyltransferase

70

270

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7929 19 258
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7688 19 264
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.6422 19 258
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.6299 19 264
3ld9-assembly1.cif.gz_A crystal structure of thymidylate kinase from ehrlichia chaffeensis at 2.15a resolution 0.5491 48 125
ID Description Score Start End Superfamily
af_O06830_42_173_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9102 35 167 3.40.50.2000
af_O06830_42_173_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9036 35 167 3.40.50.2000
af_P9WKT1_129_261_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.826 37 165 3.40.50.2000
af_P9WKT1_129_261_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7981 37 165 3.40.50.2000
af_Q2FXJ7_19_144_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7889 40 165 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A7I7YD69-F1-model_v4 Phospholipid/glycerol acyltransferase domain-containing protein 0.8992 7 171 GO:0016020
GO:0016746
AF-A0A2S8M934-F1-model_v4 deleted 0.8846 14 126
AF-A0A7X5WME4-F1-model_v4 Glycerol acyltransferase 0.8809 7 171 GO:0016020
GO:0016746
AF-A0A7G1IS05-F1-model_v4 Phospholipid/glycerol acyltransferase domain-containing protein 0.8804 54 167 GO:0016020
GO:0016746
AF-A0A498QZ32-F1-model_v4 Phospholipid/glycerol acyltransferase domain-containing protein 0.875 7 146 GO:0016746

Feature Viewer

pLDDT pTM Quality
74.19 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map