F444700

General Info

Members Datasets Scaffolds Average Seq Length
441 197 882 183

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1164638|Ga0436365_1164638_323_961
Length 212
Sequence MMTSEHLSLFSYEILGLVGSQGAGAHDLLRMAQRARLLAWAGESQYYTEPKRLAKLGFLSAHKEPGKTRERTVYTLTEAGRGALREWGRTPVGVSPLKSEALIRVLIADLVGGAVTAESMASLRSDVADLQRRLDASEQLAGELPHREQNLGIVFGFLQRFLDLHLELVEAVERQLDPARSGDPADDDRAPPEDLDGVALPAHRDVGGLTAQ

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
128 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
129 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
130 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
131 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
132 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
133 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
138 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
186 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
187 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.13
Nodule 0
Rhizoplane 9.3
Rhizosphere 88.89
Stem 0
Stem Tuber 0
Unclassified 13.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1164638 3300039437 Bacteria 1055
2 JGI25407J50210_10025860 3300003373 Bacteria 1522
3 Ga0070683_100001111 3300005329 Bacteria 20308
4 Ga0070690_100275156 3300005330 Unclassified 1199
5 Ga0068869_100301453 3300005334 Unclassified 1294
6 Ga0070682_100041009 3300005337 Bacteria 2851
7 Ga0068868_100003880 3300005338 Bacteria 10441
8 Ga0070660_100044749 3300005339 Bacteria 3387
9 Ga0070689_101111807 3300005340 Unclassified 707
10 Ga0070691_10063350 3300005341 Bacteria 1782
11 Ga0070692_10068485 3300005345 Bacteria 1886
12 Ga0070692_10189558 3300005345 Bacteria 1197
13 Ga0070668_100462519 3300005347 Unclassified 1092
14 Ga0070669_100208952 3300005353 Unclassified 1539
15 Ga0070675_100014590 3300005354 Bacteria 6196
16 Ga0070671_100082108 3300005355 Bacteria 2695
17 Ga0070671_100437461 3300005355 Unclassified 1121
18 Ga0070674_100254158 3300005356 Unclassified 1381
19 Ga0070674_100534767 3300005356 Bacteria 981
20 Ga0070673_100129326 3300005364 Bacteria 2116
21 Ga0070688_100103938 3300005365 Bacteria 1878
22 Ga0070659_100006186 3300005366 Bacteria 8646
23 Ga0070659_100022591 3300005366 Bacteria 4802
24 Ga0070714_100596557 3300005435 Bacteria 1060
25 Ga0070710_10030822 3300005437 Bacteria 2888
26 Ga0070701_10284354 3300005438 Unclassified 1011
27 Ga0070705_100042462 3300005440 Bacteria 2600
28 Ga0070700_100008131 3300005441 Bacteria 5704
29 Ga0070678_100283360 3300005456 Bacteria 1402
30 Ga0070662_100124358 3300005457 Bacteria 1980
31 Ga0070662_100296675 3300005457 Bacteria 1312
32 Ga0070681_10609591 3300005458 Bacteria 1006
33 Ga0068867_100986988 3300005459 Bacteria 763
34 Ga0070685_10022272 3300005466 Bacteria 3452
35 Ga0070699_100145303 3300005518 Bacteria 2095
36 Ga0070679_100813598 3300005530 Unclassified 877
37 Ga0070684_100005299 3300005535 Bacteria 9870
38 Ga0070684_100020278 3300005535 Bacteria 5514
39 Ga0070684_100079013 3300005535 Bacteria 2908
40 Ga0070686_100057126 3300005544 Unclassified 2506
41 Ga0070696_100627533 3300005546 Bacteria 869
42 Ga0070693_100398734 3300005547 Bacteria 953
43 Ga0070665_100048442 3300005548 Bacteria 4267
44 Ga0068855_100866127 3300005563 Unclassified 956
45 Ga0070664_100021260 3300005564 Bacteria 5346
46 Ga0070664_100107515 3300005564 Bacteria 2432
47 Ga0070664_100464149 3300005564 Bacteria 1164
48 Ga0068857_100045969 3300005577 Bacteria 3874
49 Ga0068856_100027140 3300005614 Bacteria 5586
50 Ga0068852_100024936 3300005616 Bacteria 4839
51 Ga0068852_100728170 3300005616 Bacteria 1003
52 Ga0068852_101809075 3300005616 Bacteria 633
53 Ga0068861_100087416 3300005719 Bacteria 2453
54 Ga0068861_100141351 3300005719 Bacteria 1965
55 Ga0068861_100152099 3300005719 Bacteria 1900
56 Ga0068851_10049189 3300005834 Bacteria 2138
57 Ga0068870_10329681 3300005840 Unclassified 973
58 Ga0068863_100274739 3300005841 Bacteria 1632
59 Ga0068862_101494117 3300005844 Unclassified 681
60 Ga0081455_10007594 3300005937 Bacteria 11397
61 Ga0081455_10015191 3300005937 Bacteria 7490
62 Ga0081455_10016924 3300005937 Bacteria 7009
63 Ga0081455_10031863 3300005937 Bacteria 4760
64 Ga0081455_10153635 3300005937 Bacteria 1772
65 Ga0081455_10393230 3300005937 Bacteria 965
66 Ga0081538_10001794 3300005981 Bacteria 21673
67 Ga0081538_10007773 3300005981 Bacteria 9216
68 Ga0081538_10056529 3300005981 Bacteria 2297
69 Ga0081540_1091165 3300005983 Bacteria 1340
70 Ga0070717_10099132 3300006028 Bacteria 2472
71 Ga0075365_10016704 3300006038 Bacteria 4472
72 Ga0075363_100210149 3300006048 Unclassified 1114
73 Ga0070712_100004065 3300006175 Bacteria 8983
74 Ga0075428_100225756 3300006844 Bacteria 2021
75 Ga0075428_100767737 3300006844 Bacteria 1025
76 Ga0075430_100055388 3300006846 Bacteria 3335
77 Ga0075431_100017520 3300006847 Bacteria 7281
78 Ga0075431_100152396 3300006847 Bacteria 2380
79 Ga0075431_100915595 3300006847 Unclassified 846
80 Ga0075433_10000119 3300006852 Bacteria 39528
81 Ga0075433_10934450 3300006852 Bacteria 756
82 Ga0075434_100002284 3300006871 Bacteria 16769
83 Ga0075434_100038418 3300006871 Bacteria 4741
84 Ga0075434_100222158 3300006871 Bacteria 1909
85 Ga0068865_100053308 3300006881 Bacteria 2806
86 Ga0075436_100051804 3300006914 Bacteria 2832
87 Ga0075435_100011259 3300007076 Bacteria 6568
88 Ga0075435_100109428 3300007076 Bacteria 2297
89 Ga0111539_10036186 3300009094 Bacteria 5970
90 Ga0111539_10045148 3300009094 Bacteria 5275
91 Ga0111539_10155689 3300009094 Bacteria 2674
92 Ga0111539_10343798 3300009094 Bacteria 1737
93 Ga0105245_10006153 3300009098 Bacteria 10562
94 Ga0105245_10218902 3300009098 Bacteria 1836
95 Ga0105245_11628636 3300009098 Bacteria 697
96 Ga0114129_10176126 3300009147 Bacteria 2913
97 Ga0114129_10500682 3300009147 Bacteria 1587
98 Ga0114129_10572506 3300009147 Bacteria 1466
99 Ga0114129_11379285 3300009147 Bacteria 870
100 Ga0105243_10019030 3300009148 Bacteria 5205
101 Ga0105243_10399339 3300009148 Bacteria 1277
102 Ga0105242_10476835 3300009176 Bacteria 1182
103 Ga0105248_11037582 3300009177 Bacteria 926
104 Ga0105249_10064257 3300009553 Bacteria 3374
105 Ga0105249_10303462 3300009553 Bacteria 1602
106 Ga0105249_10447373 3300009553 Bacteria 1330
107 Ga0105239_10130761 3300010375 Bacteria 2792
108 Ga0105239_10474349 3300010375 Bacteria 1421
109 Ga0105239_10701816 3300010375 Bacteria 1157
110 Ga0105239_10703803 3300010375 Bacteria 1155
111 Ga0105246_10069706 3300011119 Bacteria 2470
112 Ga0105246_10234899 3300011119 Bacteria 1446
113 Ga0157369_10355664 3300013105 Bacteria 1521
114 Ga0157374_10173676 3300013296 Bacteria 2103
115 Ga0157378_10914518 3300013297 Unclassified 909
116 Ga0163162_10359667 3300013306 Bacteria 1588
117 Ga0163162_11338912 3300013306 Bacteria 814
118 Ga0157372_10015876 3300013307 Bacteria 8078
119 Ga0157372_10283484 3300013307 Bacteria 1926
120 Ga0157372_10394810 3300013307 Bacteria 1612
121 Ga0163163_10026147 3300014325 Bacteria 5574
122 Ga0163163_10343494 3300014325 Bacteria 1548
123 Ga0157380_10022046 3300014326 Bacteria 4786
124 Ga0157380_10039603 3300014326 Bacteria 3666
125 Ga0157377_10002698 3300014745 Bacteria 7891
126 Ga0157377_10801127 3300014745 Bacteria 694
127 Ga0157376_11010705 3300014969 Bacteria 854
128 Ga0157376_11045808 3300014969 Bacteria 841
129 Ga0182006_1028600 3300015261 Bacteria 2266
130 Ga0207656_10528576 3300025321 Unclassified 600
131 Ga0207692_10060912 3300025898 Bacteria 1954
132 Ga0207688_10006058 3300025901 Bacteria 6580
133 Ga0207688_10072698 3300025901 Bacteria 1954
134 Ga0207643_10234413 3300025908 Bacteria 1127
135 Ga0207693_10015837 3300025915 Bacteria 6040
136 Ga0207660_10124244 3300025917 Bacteria 1958
137 Ga0207662_10290746 3300025918 Unclassified 1084
138 Ga0207657_10215083 3300025919 Bacteria 1541
139 Ga0207649_10322205 3300025920 Bacteria 1136
140 Ga0207652_10326589 3300025921 Bacteria 1385
141 Ga0207659_10047675 3300025926 Bacteria 3031
142 Ga0207687_10034586 3300025927 Bacteria 3431
143 Ga0207687_10300044 3300025927 Bacteria 1294
144 Ga0207664_10000933 3300025929 Bacteria 19646
145 Ga0207644_10251512 3300025931 Bacteria 1410
146 Ga0207690_10103202 3300025932 Bacteria 2041
147 Ga0207690_10104346 3300025932 Bacteria 2030
148 Ga0207706_10016828 3300025933 Bacteria 6600
149 Ga0207706_10053063 3300025933 Bacteria 3579
150 Ga0207709_10090502 3300025935 Bacteria 1998
151 Ga0207709_10246409 3300025935 Bacteria 1303
152 Ga0207709_11129752 3300025935 Bacteria 644
153 Ga0207670_10847637 3300025936 Unclassified 763
154 Ga0207669_10172385 3300025937 Bacteria 1542
155 Ga0207704_10081294 3300025938 Bacteria 2095
156 Ga0207689_10055251 3300025942 Bacteria 3268
157 Ga0207661_10021528 3300025944 Bacteria 4832
158 Ga0207661_10024665 3300025944 Bacteria 4560
159 Ga0207661_10061270 3300025944 Bacteria 3039
160 Ga0207679_10027449 3300025945 Bacteria 3937
161 Ga0207679_10289039 3300025945 Bacteria 1409
162 Ga0207651_10101507 3300025960 Bacteria 2136
163 Ga0207712_10091892 3300025961 Bacteria 2236
164 Ga0207677_10038747 3300026023 Bacteria 3127
165 Ga0207677_10335761 3300026023 Bacteria 1261
166 Ga0207708_10046809 3300026075 Bacteria 3294
167 Ga0207702_10088195 3300026078 Bacteria 2710
168 Ga0207702_11042488 3300026078 Bacteria 811
169 Ga0207641_10257737 3300026088 Bacteria 1632
170 Ga0207648_10769877 3300026089 Bacteria 895
171 Ga0207648_10802017 3300026089 Unclassified 876
172 Ga0207676_10036742 3300026095 Bacteria 3729
173 Ga0207675_100044292 3300026118 Bacteria 4158
174 Ga0207675_100202740 3300026118 Bacteria 1906
175 Ga0207675_100442477 3300026118 Bacteria 1287
176 Ga0207683_10030633 3300026121 Bacteria 4663
177 Ga0207683_10312092 3300026121 Bacteria 1439
178 Ga0207683_10376815 3300026121 Bacteria 1304
179 Ga0207698_10022944 3300026142 Bacteria 4352
180 Ga0207698_10861491 3300026142 Bacteria 911
181 Ga0207428_10061548 3300027907 Bacteria 2971
182 Ga0207428_10156937 3300027907 Bacteria 1730
183 Ga0268265_11462008 3300028380 Unclassified 686
184 Ga0307408_101751408 3300031548 Bacteria 593
185 Ga0307409_100295541 3300031995 Bacteria 1504
186 Ga0307416_100082487 3300032002 Bacteria 2724
187 Ga0307415_100011348 3300032126 Bacteria 5093
188 Ga0373942_0167350 3300035207 Unclassified 714
189 Ga0395899_0168902 3300037312 Unclassified 1541
190 Ga0395899_0384698 3300037312 Bacteria 932
191 Ga0395900_0013852 3300037418 Bacteria 8228
192 Ga0395900_0015948 3300037418 Bacteria 7656
193 Ga0395900_0161849 3300037418 Bacteria 2282
194 Ga0395900_0280010 3300037418 Bacteria 1660
195 Ga0395900_0433428 3300037418 Unclassified 1273
196 Ga0395898_0005130 3300037466 Bacteria 14177
197 Ga0395898_0032416 3300037466 Bacteria 5215
198 Ga0395898_0080152 3300037466 Unclassified 3149
199 Ga0395898_0206280 3300037466 Bacteria 1875
200 Ga0395898_0594957 3300037466 Bacteria 1049
201 Ga0395898_0992448 3300037466 Bacteria 776
202 Ga0395905_0009350 3300037471 Bacteria 9584
203 Ga0395905_0012187 3300037471 Bacteria 8281
204 Ga0395905_0041312 3300037471 Bacteria 4328
205 Ga0395905_0081032 3300037471 Bacteria 3042
206 Ga0395905_0443907 3300037471 Bacteria 1195
207 Ga0395905_0590796 3300037471 Bacteria 1012
208 Ga0395905_0934474 3300037471 Unclassified 770
209 Ga0395905_1395365 3300037471 Bacteria 605
210 Ga0395901_0004590 3300038443 Bacteria 13948
211 Ga0395901_0005652 3300038443 Bacteria 12654
212 Ga0395901_0014038 3300038443 Bacteria 8152
213 Ga0395901_0061330 3300038443 Bacteria 3913
214 Ga0395901_0062654 3300038443 Bacteria 3870
215 Ga0395901_0076846 3300038443 Unclassified 3484
216 Ga0395901_0105862 3300038443 Bacteria 2952
217 Ga0395901_0134741 3300038443 Bacteria 2596
218 Ga0395901_0368430 3300038443 Bacteria 1480
219 Ga0395901_0375533 3300038443 Bacteria 1464
220 Ga0439461_0069803 3300041410 Bacteria 812
221 Ga0451853_4071234 3300041512 Unclassified 673
222 Ga0439448_0196213 3300042005 Unclassified 707
223 Ga0439450_062022 3300042008 Bacteria 905
224 Ga0439463_056070 3300042016 Bacteria 1006
225 Ga0439464_0112172 3300042439 Bacteria 835
226 Ga0466969_0047852 3300044656 Bacteria 2116
227 Ga0466969_0308606 3300044656 Bacteria 716
228 Ga0466966_0025968 3300044684 Bacteria 3826
229 Ga0466961_0046081 3300044693 Bacteria 2789
230 Ga0466961_0076858 3300044693 Bacteria 2115
231 Ga0466961_0140522 3300044693 Bacteria 1512
232 Ga0466961_0173658 3300044693 Unclassified 1340
233 Ga0466963_0001840 3300044694 Bacteria 11558
234 Ga0466963_0004037 3300044694 Bacteria 8492
235 Ga0466963_0011913 3300044694 Bacteria 5310
236 Ga0466963_0016494 3300044694 Bacteria 4594
237 Ga0466963_0032226 3300044694 Bacteria 3392
238 Ga0466963_0175683 3300044694 Bacteria 1494
239 Ga0466963_0297133 3300044694 Bacteria 1135
240 Ga0466971_0001412 3300044719 Bacteria 10082
241 Ga0466971_0025675 3300044719 Bacteria 2631
242 Ga0466968_0012569 3300044735 Bacteria 3317
243 Ga0466968_0044077 3300044735 Bacteria 1890
244 Ga0466970_0030400 3300044765 Bacteria 2848
245 Ga0466970_0437568 3300044765 Unclassified 749
246 Ga0466957_0011833 3300044842 Bacteria 5044
247 Ga0466957_0013967 3300044842 Unclassified 4669
248 Ga0466957_0073246 3300044842 Unclassified 2122
249 Ga0466957_0148852 3300044842 Unclassified 1513
250 Ga0466957_0156001 3300044842 Bacteria 1479
251 Ga0466957_0386382 3300044842 Bacteria 955
252 Ga0466959_0009294 3300045049 Bacteria 6985
253 Ga0466959_0014099 3300045049 Bacteria 5800
254 Ga0466959_0031597 3300045049 Bacteria 3917
255 Ga0466959_0035286 3300045049 Unclassified 3700
256 Ga0466958_0001758 3300045836 Bacteria 10491
257 Ga0466958_0005461 3300045836 Bacteria 6846
258 Ga0466958_0011631 3300045836 Unclassified 4961
259 Ga0466958_0013753 3300045836 Bacteria 4612
260 Ga0466958_0020626 3300045836 Bacteria 3845
261 Ga0466958_0031827 3300045836 Unclassified 3135
262 Ga0466958_0040665 3300045836 Bacteria 2794
263 Ga0466958_0042368 3300045836 Bacteria 2741
264 Ga0466958_0160006 3300045836 Bacteria 1422
265 Ga0466958_0199779 3300045836 Bacteria 1272
266 Ga0466958_0367148 3300045836 Bacteria 927
267 Ga0466958_0541559 3300045836 Bacteria 756
268 Ga0466958_0567166 3300045836 Bacteria 738
269 Ga0466967_0002429 3300045976 Bacteria 11589
270 Ga0466967_0011164 3300045976 Bacteria 6786
271 Ga0466967_0018255 3300045976 Bacteria 5600
272 Ga0466967_0024969 3300045976 Bacteria 4920
273 Ga0466967_0073670 3300045976 Bacteria 3064
274 Ga0466967_0086495 3300045976 Unclassified 2840
275 Ga0466967_0087745 3300045976 Unclassified 2821
276 Ga0466967_0096910 3300045976 Bacteria 2691
277 Ga0466967_0112296 3300045976 Bacteria 2505
278 Ga0466967_0188387 3300045976 Bacteria 1949
279 Ga0466967_0226214 3300045976 Bacteria 1780
280 Ga0466967_0295133 3300045976 Bacteria 1558
281 Ga0466967_0542436 3300045976 Bacteria 1144
282 Ga0466967_0681852 3300045976 Bacteria 1017
283 Ga0466967_0874701 3300045976 Bacteria 893
284 Ga0496100_0005681 3300048903 Bacteria 6747
285 Ga0496100_0176966 3300048903 Unclassified 1541
286 Ga0496100_0227003 3300048903 Bacteria 1372
287 Ga0496101_0028447 3300048904 Bacteria 3902
288 Ga0496101_0399288 3300048904 Unclassified 1082
289 Ga0496101_1023475 3300048904 Unclassified 649
290 Ga0496102_0005015 3300048905 Bacteria 11209
291 Ga0496102_0010579 3300048905 Bacteria 7947
292 Ga0496102_0018139 3300048905 Bacteria 6176
293 Ga0496102_0819112 3300048905 Bacteria 853
294 Ga0496103_0045159 3300048906 Bacteria 2718
295 Ga0496103_0209013 3300048906 Bacteria 1255
296 Ga0496104_0041672 3300048907 Bacteria 4306
297 Ga0496105_0021165 3300048908 Bacteria 5260
298 Ga0496106_0000253 3300048909 Bacteria 37605
299 Ga0496106_0018296 3300048909 Bacteria 5178
300 Ga0496107_0004575 3300048910 Bacteria 9377
301 Ga0496107_0054932 3300048910 Bacteria 2875
302 Ga0496108_0045918 3300048911 Bacteria 3648
303 Ga0496108_0075364 3300048911 Bacteria 2850
304 Ga0496108_0084133 3300048911 Bacteria 2699
305 Ga0496109_0004138 3300048912 Bacteria 12114
306 Ga0496109_0039604 3300048912 Bacteria 4266
307 Ga0496109_0050321 3300048912 Bacteria 3795
308 Ga0496109_0139903 3300048912 Bacteria 2263
309 Ga0496109_0378198 3300048912 Bacteria 1338
310 Ga0496109_1245245 3300048912 Bacteria 680
311 Ga0496110_0003068 3300048913 Bacteria 12663
312 Ga0496110_0025660 3300048913 Bacteria 5039
313 Ga0496110_0030240 3300048913 Bacteria 4667
314 Ga0496110_0080589 3300048913 Bacteria 2901
315 Ga0496111_0025445 3300048914 Bacteria 4176
316 Ga0496111_0052474 3300048914 Bacteria 2945
317 Ga0496111_0757965 3300048914 Bacteria 704
318 Ga0496112_0027424 3300048915 Bacteria 5490
319 Ga0496112_0169621 3300048915 Bacteria 2148
320 Ga0496113_0011037 3300048916 Bacteria 6005
321 Ga0496114_0001863 3300048917 Bacteria 15983
322 Ga0496114_0201216 3300048917 Bacteria 1744
323 Ga0496114_0327978 3300048917 Bacteria 1353
324 Ga0496115_0419793 3300048918 Bacteria 1084
325 Ga0496121_0050774 3300048924 Bacteria 3500
326 Ga0501033_0040467 3300049570 Bacteria 3479
327 Ga0501033_0532347 3300049570 Unclassified 811
328 Ga0501036_0009305 3300049572 Bacteria 8078
329 Ga0501036_0029691 3300049572 Bacteria 4619
330 Ga0501036_0353854 3300049572 Bacteria 1226
331 Ga0501036_0581162 3300049572 Bacteria 930
332 Ga0501036_1086631 3300049572 Unclassified 654
333 Ga0501037_0076629 3300049573 Bacteria 2427
334 Ga0501038_0005522 3300049574 Bacteria 11742
335 Ga0501039_0007288 3300049575 Bacteria 8424
336 Ga0501039_0380288 3300049575 Unclassified 1109
337 Ga0501039_0616149 3300049575 Bacteria 850
338 Ga0501040_0000884 3300049576 Bacteria 18825
339 Ga0501040_0061981 3300049576 Bacteria 2573
340 Ga0501040_0063465 3300049576 Bacteria 2542
341 Ga0501041_0004084 3300049577 Bacteria 8428
342 Ga0501041_0077795 3300049577 Bacteria 2041
343 Ga0501041_0391071 3300049577 Bacteria 880
344 Ga0501042_0002182 3300049578 Bacteria 11930
345 Ga0501042_0274877 3300049578 Bacteria 1216
346 Ga0501046_0009660 3300049580 Bacteria 8319
347 Ga0501048_0002775 3300049582 Bacteria 13366
348 Ga0501048_0049663 3300049582 Bacteria 2990
349 Ga0501048_0575099 3300049582 Bacteria 809
350 Ga0501067_0115142 3300049583 Bacteria 1495
351 Ga0501067_0255634 3300049583 Bacteria 975
352 Ga0501067_0291096 3300049583 Bacteria 909
353 Ga0501068_0020822 3300049584 Bacteria 3827
354 Ga0501068_0231217 3300049584 Bacteria 1176
355 Ga0501068_0527688 3300049584 Unclassified 767
356 Ga0501069_0013658 3300049585 Bacteria 4333
357 Ga0501070_0424135 3300049586 Bacteria 1074
358 Ga0501071_0005088 3300049587 Bacteria 8416
359 Ga0501071_0080497 3300049587 Bacteria 2382
360 Ga0501071_0123026 3300049587 Bacteria 1924
361 Ga0501071_0403690 3300049587 Unclassified 1043
362 Ga0501072_0031369 3300049588 Bacteria 4160
363 Ga0501072_0039672 3300049588 Bacteria 3696
364 Ga0501072_0078491 3300049588 Bacteria 2614
365 Ga0501072_0146301 3300049588 Bacteria 1884
366 Ga0501072_0301610 3300049588 Bacteria 1273
367 Ga0501072_0734224 3300049588 Unclassified 775
368 Ga0501074_0002905 3300049590 Bacteria 12018
369 Ga0501074_0732529 3300049590 Bacteria 697
370 Ga0501075_0074445 3300049591 Bacteria 2568
371 Ga0501075_0302118 3300049591 Bacteria 1219
372 Ga0501076_0000479 3300049592 Bacteria 25208
373 Ga0501076_0044961 3300049592 Bacteria 3485
374 Ga0501076_0126913 3300049592 Bacteria 2068
375 Ga0501076_0267137 3300049592 Unclassified 1401
376 Ga0501076_0505285 3300049592 Unclassified 996
377 Ga0501076_0753023 3300049592 Bacteria 804
378 Ga0501077_0033114 3300049593 Bacteria 3290
379 Ga0501077_0034916 3300049593 Bacteria 3201
380 Ga0501077_0044973 3300049593 Bacteria 2805
381 Ga0501077_0085106 3300049593 Bacteria 2004
382 Ga0501079_0001830 3300049741 Bacteria 15216
383 Ga0501079_0207566 3300049741 Bacteria 1530
384 Ga0501079_0256735 3300049741 Bacteria 1366
385 Ga0501079_0379331 3300049741 Bacteria 1108
386 Ga0501080_0179797 3300049742 Bacteria 1947
387 Ga0501080_0280692 3300049742 Unclassified 1514
388 Ga0501080_0341479 3300049742 Bacteria 1353
389 Ga0501081_0005269 3300049743 Bacteria 8335
390 Ga0501081_0029185 3300049743 Bacteria 3726
391 Ga0501045_0000842 3300049824 Bacteria 19895
392 Ga0501045_0304004 3300049824 Bacteria 1187
393 Ga0501045_1080978 3300049824 Unclassified 587
394 nmdc:mga03n38_168668_c1 3300050490 Unclassified 1113
395 nmdc:mga0yw44_107772_c1 3300050492 Bacteria 1782
396 nmdc:mga0yw44_452395_c1 3300050492 Bacteria 870
397 nmdc:mga0qj67_29537_c1 3300050509 Bacteria 4258
398 nmdc:mga0qj67_70867_c1 3300050509 Bacteria 2781
399 nmdc:mga06r32_31283_c1 3300050510 Bacteria 4997
400 nmdc:mga06r32_362093_c1 3300050510 Bacteria 1434
401 nmdc:mga06r32_408768_c1 3300050510 Bacteria 1339
402 nmdc:mga06r32_72175_c1 3300050510 Bacteria 3342
403 nmdc:mga06r32_796113_c1 3300050510 Unclassified 906
404 nmdc:mga08y16_110797_c1 3300050511 Bacteria 2858
405 nmdc:mga08y16_1690883_c1 3300050511 Bacteria 588
406 nmdc:mga08y16_557066_c1 3300050511 Bacteria 1159
407 nmdc:mga08y16_68837_c1 3300050511 Bacteria 3690
408 nmdc:mga08y16_80145_c1 3300050511 Bacteria 3404
409 nmdc:mga0n895_112626_c1 3300050512 Bacteria 2738
410 nmdc:mga0n895_164681_c1 3300050512 Bacteria 2249
411 nmdc:mga0n895_590401_c1 3300050512 Unclassified 1114
412 nmdc:mga0n895_637502_c1 3300050512 Bacteria 1065
413 nmdc:mga0rr50_517028_c1 3300050513 Bacteria 1016
414 nmdc:mga08x19_122015_c1 3300050514 Bacteria 1748
415 nmdc:mga0a205_501827_c1 3300050515 Bacteria 1070
416 nmdc:mga0a205_58687_c1 3300050515 Bacteria 3717
417 nmdc:mga0a205_78617_c1 3300050515 Bacteria 3187
418 Ga0501084_0004420 3300054114 Bacteria 11471
419 Ga0501084_0052137 3300054114 Bacteria 3424
420 Ga0501084_0098144 3300054114 Bacteria 2460
421 Ga0501084_0160331 3300054114 Bacteria 1898
422 Ga0501084_0253867 3300054114 Bacteria 1484
423 Ga0501084_0641954 3300054114 Bacteria 896
424 Ga0501082_0171034 3300060353 Bacteria 1889
425 Ga0501082_0300530 3300060353 Bacteria 1398
426 Ga0501082_0468746 3300060353 Unclassified 1101
427 Ga0501082_0572987 3300060353 Bacteria 988
428 Ga0501082_0598315 3300060353 Unclassified 965
429 Ga0501082_0697203 3300060353 Unclassified 889
430 Ga0501082_0836203 3300060353 Bacteria 805
431 Ga0466962_0001424 3300061719 Bacteria 11136
432 Ga0466962_0003942 3300061719 Bacteria 7103
433 Ga0466962_0004430 3300061719 Bacteria 6727
434 Ga0466962_0053646 3300061719 Bacteria 1926
435 Ga0466962_0499736 3300061719 Unclassified 615
436 Ga0530510_0020061 3300061734 Bacteria 4753
437 Ga0530510_0021564 3300061734 Bacteria 4584
438 Ga0530510_0061970 3300061734 Bacteria 2708
439 Ga0530510_0090141 3300061734 Bacteria 2236
440 Ga0530510_0133117 3300061734 Bacteria 1830
441 Ga0530510_0210590 3300061734 Archaea 1444
442 Ga0436365_1164638
443 JGI25407J50210_10025860
444 Ga0070683_100001111
445 Ga0070690_100275156
446 Ga0068869_100301453
447 Ga0070682_100041009
448 Ga0068868_100003880
449 Ga0070660_100044749
450 Ga0070689_101111807
451 Ga0070691_10063350
452 Ga0070692_10068485
453 Ga0070692_10189558
454 Ga0070668_100462519
455 Ga0070669_100208952
456 Ga0070675_100014590
457 Ga0070671_100082108
458 Ga0070671_100437461
459 Ga0070674_100254158
460 Ga0070674_100534767
461 Ga0070673_100129326
462 Ga0070688_100103938
463 Ga0070659_100006186
464 Ga0070659_100022591
465 Ga0070714_100596557
466 Ga0070710_10030822
467 Ga0070701_10284354
468 Ga0070705_100042462
469 Ga0070700_100008131
470 Ga0070678_100283360
471 Ga0070662_100124358
472 Ga0070662_100296675
473 Ga0070681_10609591
474 Ga0068867_100986988
475 Ga0070685_10022272
476 Ga0070699_100145303
477 Ga0070679_100813598
478 Ga0070684_100005299
479 Ga0070684_100020278
480 Ga0070684_100079013
481 Ga0070686_100057126
482 Ga0070696_100627533
483 Ga0070693_100398734
484 Ga0070665_100048442
485 Ga0068855_100866127
486 Ga0070664_100021260
487 Ga0070664_100107515
488 Ga0070664_100464149
489 Ga0068857_100045969
490 Ga0068856_100027140
491 Ga0068852_100024936
492 Ga0068852_100728170
493 Ga0068852_101809075
494 Ga0068861_100087416
495 Ga0068861_100141351
496 Ga0068861_100152099
497 Ga0068851_10049189
498 Ga0068870_10329681
499 Ga0068863_100274739
500 Ga0068862_101494117
501 Ga0081455_10007594
502 Ga0081455_10015191
503 Ga0081455_10016924
504 Ga0081455_10031863
505 Ga0081455_10153635
506 Ga0081455_10393230
507 Ga0081538_10001794
508 Ga0081538_10007773
509 Ga0081538_10056529
510 Ga0081540_1091165
511 Ga0070717_10099132
512 Ga0075365_10016704
513 Ga0075363_100210149
514 Ga0070712_100004065
515 Ga0075428_100225756
516 Ga0075428_100767737
517 Ga0075430_100055388
518 Ga0075431_100017520
519 Ga0075431_100152396
520 Ga0075431_100915595
521 Ga0075433_10000119
522 Ga0075433_10934450
523 Ga0075434_100002284
524 Ga0075434_100038418
525 Ga0075434_100222158
526 Ga0068865_100053308
527 Ga0075436_100051804
528 Ga0075435_100011259
529 Ga0075435_100109428
530 Ga0111539_10036186
531 Ga0111539_10045148
532 Ga0111539_10155689
533 Ga0111539_10343798
534 Ga0105245_10006153
535 Ga0105245_10218902
536 Ga0105245_11628636
537 Ga0114129_10176126
538 Ga0114129_10500682
539 Ga0114129_10572506
540 Ga0114129_11379285
541 Ga0105243_10019030
542 Ga0105243_10399339
543 Ga0105242_10476835
544 Ga0105248_11037582
545 Ga0105249_10064257
546 Ga0105249_10303462
547 Ga0105249_10447373
548 Ga0105239_10130761
549 Ga0105239_10474349
550 Ga0105239_10701816
551 Ga0105239_10703803
552 Ga0105246_10069706
553 Ga0105246_10234899
554 Ga0157369_10355664
555 Ga0157374_10173676
556 Ga0157378_10914518
557 Ga0163162_10359667
558 Ga0163162_11338912
559 Ga0157372_10015876
560 Ga0157372_10283484
561 Ga0157372_10394810
562 Ga0163163_10026147
563 Ga0163163_10343494
564 Ga0157380_10022046
565 Ga0157380_10039603
566 Ga0157377_10002698
567 Ga0157377_10801127
568 Ga0157376_11010705
569 Ga0157376_11045808
570 Ga0182006_1028600
571 Ga0207656_10528576
572 Ga0207692_10060912
573 Ga0207688_10006058
574 Ga0207688_10072698
575 Ga0207643_10234413
576 Ga0207693_10015837
577 Ga0207660_10124244
578 Ga0207662_10290746
579 Ga0207657_10215083
580 Ga0207649_10322205
581 Ga0207652_10326589
582 Ga0207659_10047675
583 Ga0207687_10034586
584 Ga0207687_10300044
585 Ga0207664_10000933
586 Ga0207644_10251512
587 Ga0207690_10103202
588 Ga0207690_10104346
589 Ga0207706_10016828
590 Ga0207706_10053063
591 Ga0207709_10090502
592 Ga0207709_10246409
593 Ga0207709_11129752
594 Ga0207670_10847637
595 Ga0207669_10172385
596 Ga0207704_10081294
597 Ga0207689_10055251
598 Ga0207661_10021528
599 Ga0207661_10024665
600 Ga0207661_10061270
601 Ga0207679_10027449
602 Ga0207679_10289039
603 Ga0207651_10101507
604 Ga0207712_10091892
605 Ga0207677_10038747
606 Ga0207677_10335761
607 Ga0207708_10046809
608 Ga0207702_10088195
609 Ga0207702_11042488
610 Ga0207641_10257737
611 Ga0207648_10769877
612 Ga0207648_10802017
613 Ga0207676_10036742
614 Ga0207675_100044292
615 Ga0207675_100202740
616 Ga0207675_100442477
617 Ga0207683_10030633
618 Ga0207683_10312092
619 Ga0207683_10376815
620 Ga0207698_10022944
621 Ga0207698_10861491
622 Ga0207428_10061548
623 Ga0207428_10156937
624 Ga0268265_11462008
625 Ga0307408_101751408
626 Ga0307409_100295541
627 Ga0307416_100082487
628 Ga0307415_100011348
629 Ga0373942_0167350
630 Ga0395899_0168902
631 Ga0395899_0384698
632 Ga0395900_0013852
633 Ga0395900_0015948
634 Ga0395900_0161849
635 Ga0395900_0280010
636 Ga0395900_0433428
637 Ga0395898_0005130
638 Ga0395898_0032416
639 Ga0395898_0080152
640 Ga0395898_0206280
641 Ga0395898_0594957
642 Ga0395898_0992448
643 Ga0395905_0009350
644 Ga0395905_0012187
645 Ga0395905_0041312
646 Ga0395905_0081032
647 Ga0395905_0443907
648 Ga0395905_0590796
649 Ga0395905_0934474
650 Ga0395905_1395365
651 Ga0395901_0004590
652 Ga0395901_0005652
653 Ga0395901_0014038
654 Ga0395901_0061330
655 Ga0395901_0062654
656 Ga0395901_0076846
657 Ga0395901_0105862
658 Ga0395901_0134741
659 Ga0395901_0368430
660 Ga0395901_0375533
661 Ga0439461_0069803
662 Ga0451853_4071234
663 Ga0439448_0196213
664 Ga0439450_062022
665 Ga0439463_056070
666 Ga0439464_0112172
667 Ga0466969_0047852
668 Ga0466969_0308606
669 Ga0466966_0025968
670 Ga0466961_0046081
671 Ga0466961_0076858
672 Ga0466961_0140522
673 Ga0466961_0173658
674 Ga0466963_0001840
675 Ga0466963_0004037
676 Ga0466963_0011913
677 Ga0466963_0016494
678 Ga0466963_0032226
679 Ga0466963_0175683
680 Ga0466963_0297133
681 Ga0466971_0001412
682 Ga0466971_0025675
683 Ga0466968_0012569
684 Ga0466968_0044077
685 Ga0466970_0030400
686 Ga0466970_0437568
687 Ga0466957_0011833
688 Ga0466957_0013967
689 Ga0466957_0073246
690 Ga0466957_0148852
691 Ga0466957_0156001
692 Ga0466957_0386382
693 Ga0466959_0009294
694 Ga0466959_0014099
695 Ga0466959_0031597
696 Ga0466959_0035286
697 Ga0466958_0001758
698 Ga0466958_0005461
699 Ga0466958_0011631
700 Ga0466958_0013753
701 Ga0466958_0020626
702 Ga0466958_0031827
703 Ga0466958_0040665
704 Ga0466958_0042368
705 Ga0466958_0160006
706 Ga0466958_0199779
707 Ga0466958_0367148
708 Ga0466958_0541559
709 Ga0466958_0567166
710 Ga0466967_0002429
711 Ga0466967_0011164
712 Ga0466967_0018255
713 Ga0466967_0024969
714 Ga0466967_0073670
715 Ga0466967_0086495
716 Ga0466967_0087745
717 Ga0466967_0096910
718 Ga0466967_0112296
719 Ga0466967_0188387
720 Ga0466967_0226214
721 Ga0466967_0295133
722 Ga0466967_0542436
723 Ga0466967_0681852
724 Ga0466967_0874701
725 Ga0496100_0005681
726 Ga0496100_0176966
727 Ga0496100_0227003
728 Ga0496101_0028447
729 Ga0496101_0399288
730 Ga0496101_1023475
731 Ga0496102_0005015
732 Ga0496102_0010579
733 Ga0496102_0018139
734 Ga0496102_0819112
735 Ga0496103_0045159
736 Ga0496103_0209013
737 Ga0496104_0041672
738 Ga0496105_0021165
739 Ga0496106_0000253
740 Ga0496106_0018296
741 Ga0496107_0004575
742 Ga0496107_0054932
743 Ga0496108_0045918
744 Ga0496108_0075364
745 Ga0496108_0084133
746 Ga0496109_0004138
747 Ga0496109_0039604
748 Ga0496109_0050321
749 Ga0496109_0139903
750 Ga0496109_0378198
751 Ga0496109_1245245
752 Ga0496110_0003068
753 Ga0496110_0025660
754 Ga0496110_0030240
755 Ga0496110_0080589
756 Ga0496111_0025445
757 Ga0496111_0052474
758 Ga0496111_0757965
759 Ga0496112_0027424
760 Ga0496112_0169621
761 Ga0496113_0011037
762 Ga0496114_0001863
763 Ga0496114_0201216
764 Ga0496114_0327978
765 Ga0496115_0419793
766 Ga0496121_0050774
767 Ga0501033_0040467
768 Ga0501033_0532347
769 Ga0501036_0009305
770 Ga0501036_0029691
771 Ga0501036_0353854
772 Ga0501036_0581162
773 Ga0501036_1086631
774 Ga0501037_0076629
775 Ga0501038_0005522
776 Ga0501039_0007288
777 Ga0501039_0380288
778 Ga0501039_0616149
779 Ga0501040_0000884
780 Ga0501040_0061981
781 Ga0501040_0063465
782 Ga0501041_0004084
783 Ga0501041_0077795
784 Ga0501041_0391071
785 Ga0501042_0002182
786 Ga0501042_0274877
787 Ga0501046_0009660
788 Ga0501048_0002775
789 Ga0501048_0049663
790 Ga0501048_0575099
791 Ga0501067_0115142
792 Ga0501067_0255634
793 Ga0501067_0291096
794 Ga0501068_0020822
795 Ga0501068_0231217
796 Ga0501068_0527688
797 Ga0501069_0013658
798 Ga0501070_0424135
799 Ga0501071_0005088
800 Ga0501071_0080497
801 Ga0501071_0123026
802 Ga0501071_0403690
803 Ga0501072_0031369
804 Ga0501072_0039672
805 Ga0501072_0078491
806 Ga0501072_0146301
807 Ga0501072_0301610
808 Ga0501072_0734224
809 Ga0501074_0002905
810 Ga0501074_0732529
811 Ga0501075_0074445
812 Ga0501075_0302118
813 Ga0501076_0000479
814 Ga0501076_0044961
815 Ga0501076_0126913
816 Ga0501076_0267137
817 Ga0501076_0505285
818 Ga0501076_0753023
819 Ga0501077_0033114
820 Ga0501077_0034916
821 Ga0501077_0044973
822 Ga0501077_0085106
823 Ga0501079_0001830
824 Ga0501079_0207566
825 Ga0501079_0256735
826 Ga0501079_0379331
827 Ga0501080_0179797
828 Ga0501080_0280692
829 Ga0501080_0341479
830 Ga0501081_0005269
831 Ga0501081_0029185
832 Ga0501045_0000842
833 Ga0501045_0304004
834 Ga0501045_1080978
835 nmdc:mga03n38_168668_c1
836 nmdc:mga0yw44_107772_c1
837 nmdc:mga0yw44_452395_c1
838 nmdc:mga0qj67_29537_c1
839 nmdc:mga0qj67_70867_c1
840 nmdc:mga06r32_31283_c1
841 nmdc:mga06r32_362093_c1
842 nmdc:mga06r32_408768_c1
843 nmdc:mga06r32_72175_c1
844 nmdc:mga06r32_796113_c1
845 nmdc:mga08y16_110797_c1
846 nmdc:mga08y16_1690883_c1
847 nmdc:mga08y16_557066_c1
848 nmdc:mga08y16_68837_c1
849 nmdc:mga08y16_80145_c1
850 nmdc:mga0n895_112626_c1
851 nmdc:mga0n895_164681_c1
852 nmdc:mga0n895_590401_c1
853 nmdc:mga0n895_637502_c1
854 nmdc:mga0rr50_517028_c1
855 nmdc:mga08x19_122015_c1
856 nmdc:mga0a205_501827_c1
857 nmdc:mga0a205_58687_c1
858 nmdc:mga0a205_78617_c1
859 Ga0501084_0004420
860 Ga0501084_0052137
861 Ga0501084_0098144
862 Ga0501084_0160331
863 Ga0501084_0253867
864 Ga0501084_0641954
865 Ga0501082_0171034
866 Ga0501082_0300530
867 Ga0501082_0468746
868 Ga0501082_0572987
869 Ga0501082_0598315
870 Ga0501082_0697203
871 Ga0501082_0836203
872 Ga0466962_0001424
873 Ga0466962_0003942
874 Ga0466962_0004430
875 Ga0466962_0053646
876 Ga0466962_0499736
877 Ga0530510_0020061
878 Ga0530510_0021564
879 Ga0530510_0061970
880 Ga0530510_0090141
881 Ga0530510_0133117
882 Ga0530510_0210590

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lg2-assembly1.cif.gz_B vanr bound to vanillate 0.8673 7 175
5h20-assembly1.cif.gz_A-2 x-ray structure of padr-like transcription factor from bacteroid fragilis 0.8647 8 87
6dma-assembly4.cif.gz_G dhd15_closed 0.8494 112 178
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.8259 8 88
6pcp-assembly2.cif.gz_C mechanism for regulation of dna binding of bordetella bronchiseptica bpsr by 6-hydroxynicotinic acid 0.822 4 87
ID Description Score Start End Superfamily
5h20A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8647 8 87 1.10.10.10
5x11A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8606 3 95 1.10.10.10
3l9fD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8605 10 93 1.10.10.10
af_O50432_1_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8532 6 92 1.10.10.10
5x11A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.836 3 95 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A538LC22-F1-model_v4 PadR family transcriptional regulator 0.9776 5 177
AF-A0A838I8X2-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9768 1 177
AF-A0A838I8X2-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9713 1 177
AF-A0A7J9YR85-F1-model_v4 PadR family transcriptional regulator 0.9617 1 176
AF-A0A6N7YCZ0-F1-model_v4 PadR family transcriptional regulator 0.9544 6 175

Map