F444695

General Info

Members Datasets Scaffolds Average Seq Length
441 172 882 156

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0006009|Ga0395899_0006009_5340_5900
Length 186
Sequence MQPPESLFERKLAEAGGWTTWLGWRSKGAIRMSYVVRGLDPAPFQPLFGLTDEELAKRGVVRMTVTKKPSFPCRISLTDRDVGDQVLLLNHVSHDVTNPYRASHAIFVTEGEGEAAEYVDQVPPVFHTRVLSLRGFDADGMMADALLAQPGEADAAIRKLFQNSTIKTIHAHNAARGCFAARIERK

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
150 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
151 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
152 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
153 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
154 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.49
Rhizosphere 97.05
Stem 0
Stem Tuber 0
Unclassified 6.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0006009 3300037312 Bacteria 9423
2 JGI24741J21665_1006642 3300001915 Bacteria 2306
3 JGI24740J21852_10013193 3300001979 Bacteria 3091
4 JGI24737J22298_10068040 3300001990 Bacteria 1065
5 JGI24735J21928_10019415 3300002067 Bacteria 2089
6 JGI24738J21930_10015138 3300002075 Bacteria 1646
7 JGI24744J21845_10000639 3300002077 Bacteria 6407
8 Ga0065712_10213687 3300005290 Bacteria 1062
9 Ga0070658_10035950 3300005327 Bacteria 3991
10 Ga0070658_10036667 3300005327 Bacteria 3952
11 Ga0070658_10119145 3300005327 Bacteria 2192
12 Ga0070658_11123445 3300005327 Bacteria 683
13 Ga0070658_11148188 3300005327 Bacteria 675
14 Ga0070676_10072200 3300005328 Bacteria 2074
15 Ga0070676_10130648 3300005328 Bacteria 1588
16 Ga0070676_10138754 3300005328 Bacteria 1545
17 Ga0070676_10696467 3300005328 Bacteria 741
18 Ga0070676_11108557 3300005328 Unclassified 598
19 Ga0070683_100077140 3300005329 Bacteria 3115
20 Ga0070683_100267217 3300005329 Bacteria 1627
21 Ga0070670_100006594 3300005331 Bacteria 9838
22 Ga0070670_100025514 3300005331 Bacteria 5084
23 Ga0070670_100890022 3300005331 Bacteria 807
24 Ga0070670_101097853 3300005331 Bacteria 725
25 Ga0070677_10042313 3300005333 Bacteria 1803
26 Ga0070677_10112538 3300005333 Bacteria 1217
27 Ga0068869_100077767 3300005334 Bacteria 2469
28 Ga0070666_10024923 3300005335 Bacteria 3899
29 Ga0070680_100075776 3300005336 Bacteria 2769
30 Ga0070680_100235254 3300005336 Bacteria 1547
31 Ga0070680_100328699 3300005336 Bacteria 1298
32 Ga0070682_100022999 3300005337 Bacteria 3699
33 Ga0070682_101023234 3300005337 Unclassified 687
34 Ga0068868_100205602 3300005338 Bacteria 1643
35 Ga0068868_100385491 3300005338 Bacteria 1207
36 Ga0070660_100021037 3300005339 Bacteria 4804
37 Ga0070660_100062775 3300005339 Bacteria 2887
38 Ga0070660_100069143 3300005339 Bacteria 2753
39 Ga0070660_100288619 3300005339 Bacteria 1343
40 Ga0070660_100425776 3300005339 Bacteria 1099
41 Ga0070691_10014645 3300005341 Bacteria 3599
42 Ga0070691_10126756 3300005341 Bacteria 1290
43 Ga0070687_100467584 3300005343 Bacteria 842
44 Ga0070661_100019677 3300005344 Bacteria 4811
45 Ga0070661_100054119 3300005344 Bacteria 2939
46 Ga0070661_100129241 3300005344 Bacteria 1896
47 Ga0070661_100233577 3300005344 Bacteria 1414
48 Ga0070692_11078694 3300005345 Bacteria 566
49 Ga0070668_100001775 3300005347 Bacteria 15678
50 Ga0070668_100049927 3300005347 Bacteria 3220
51 Ga0070669_100088907 3300005353 Bacteria 2313
52 Ga0070669_100813499 3300005353 Bacteria 795
53 Ga0070675_100261492 3300005354 Bacteria 1517
54 Ga0070671_100000730 3300005355 Bacteria 23532
55 Ga0070671_100374357 3300005355 Bacteria 1216
56 Ga0070671_100627174 3300005355 Bacteria 930
57 Ga0070671_100789534 3300005355 Unclassified 826
58 Ga0070674_100004438 3300005356 Bacteria 8002
59 Ga0070674_100008689 3300005356 Bacteria 6057
60 Ga0070674_100112352 3300005356 Unclassified 2003
61 Ga0070674_100244498 3300005356 Bacteria 1407
62 Ga0070673_100025630 3300005364 Bacteria 4344
63 Ga0070673_100046023 3300005364 Bacteria 3387
64 Ga0070659_100047630 3300005366 Bacteria 3363
65 Ga0070659_100079734 3300005366 Bacteria 2613
66 Ga0070659_100128954 3300005366 Bacteria 2053
67 Ga0070659_100201644 3300005366 Bacteria 1638
68 Ga0070659_100224527 3300005366 Bacteria 1551
69 Ga0070659_100320143 3300005366 Bacteria 1296
70 Ga0070659_100578430 3300005366 Bacteria 963
71 Ga0070659_100636055 3300005366 Unclassified 919
72 Ga0070659_100672563 3300005366 Bacteria 894
73 Ga0070667_100074155 3300005367 Bacteria 2902
74 Ga0070667_100190163 3300005367 Bacteria 1818
75 Ga0070667_100850228 3300005367 Bacteria 848
76 Ga0070694_100124233 3300005444 Bacteria 1856
77 Ga0070663_100044722 3300005455 Bacteria 3124
78 Ga0070663_100099043 3300005455 Bacteria 2172
79 Ga0070663_100149365 3300005455 Bacteria 1791
80 Ga0070663_100255654 3300005455 Bacteria 1388
81 Ga0070678_100122301 3300005456 Bacteria 2054
82 Ga0070678_100224279 3300005456 Bacteria 1563
83 Ga0070662_100021141 3300005457 Bacteria 4441
84 Ga0070662_100138854 3300005457 Bacteria 1881
85 Ga0070662_100183918 3300005457 Bacteria 1649
86 Ga0070662_100276923 3300005457 Bacteria 1357
87 Ga0070662_100984201 3300005457 Unclassified 722
88 Ga0070681_10131250 3300005458 Bacteria 2437
89 Ga0070681_10484416 3300005458 Bacteria 1150
90 Ga0070681_10553223 3300005458 Bacteria 1064
91 Ga0068867_100329281 3300005459 Bacteria 1268
92 Ga0068867_100500779 3300005459 Bacteria 1044
93 Ga0070679_100283535 3300005530 Bacteria 1609
94 Ga0070679_100421300 3300005530 Bacteria 1280
95 Ga0070679_100562587 3300005530 Bacteria 1084
96 Ga0070679_100579280 3300005530 Bacteria 1066
97 Ga0070684_100014442 3300005535 Bacteria 6399
98 Ga0068853_100032968 3300005539 Bacteria 4391
99 Ga0068853_100099163 3300005539 Bacteria 2574
100 Ga0068853_100292904 3300005539 Bacteria 1503
101 Ga0068853_100911090 3300005539 Bacteria 845
102 Ga0068853_101610256 3300005539 Bacteria 629
103 Ga0070672_100014546 3300005543 Bacteria 5578
104 Ga0070672_100042698 3300005543 Bacteria 3492
105 Ga0070672_100250092 3300005543 Bacteria 1493
106 Ga0070672_100351965 3300005543 Bacteria 1256
107 Ga0070695_100017280 3300005545 Bacteria 4374
108 Ga0070696_100012160 3300005546 Bacteria 5768
109 Ga0070696_100148089 3300005546 Bacteria 1721
110 Ga0070693_100108605 3300005547 Bacteria 1702
111 Ga0068855_100202140 3300005563 Bacteria 2236
112 Ga0068855_100256228 3300005563 Bacteria 1951
113 Ga0070664_100007068 3300005564 Bacteria 9058
114 Ga0070664_100127242 3300005564 Bacteria 2236
115 Ga0070664_100155271 3300005564 Bacteria 2022
116 Ga0070664_100221888 3300005564 Bacteria 1691
117 Ga0070664_100514119 3300005564 Bacteria 1105
118 Ga0070664_100674372 3300005564 Bacteria 962
119 Ga0068857_100006935 3300005577 Bacteria 9750
120 Ga0068857_100216745 3300005577 Bacteria 1748
121 Ga0068857_100227852 3300005577 Bacteria 1704
122 Ga0068854_100016602 3300005578 Bacteria 4912
123 Ga0068854_100068171 3300005578 Bacteria 2594
124 Ga0068854_100602654 3300005578 Bacteria 938
125 Ga0068856_100073171 3300005614 Bacteria 3393
126 Ga0068856_100201194 3300005614 Bacteria 2006
127 Ga0068856_100499922 3300005614 Bacteria 1237
128 Ga0068852_100069118 3300005616 Bacteria 3094
129 Ga0068852_100137592 3300005616 Bacteria 2256
130 Ga0068852_101932755 3300005616 Bacteria 612
131 Ga0068859_100577075 3300005617 Bacteria 1218
132 Ga0068864_100009937 3300005618 Bacteria 7849
133 Ga0068864_100153265 3300005618 Bacteria 2090
134 Ga0068864_100256981 3300005618 Bacteria 1624
135 Ga0068864_100613437 3300005618 Bacteria 1057
136 Ga0068866_10047784 3300005718 Bacteria 2160
137 Ga0068866_10544288 3300005718 Unclassified 775
138 Ga0068866_10726609 3300005718 Bacteria 683
139 Ga0068851_10022963 3300005834 Bacteria 3045
140 Ga0068851_10489800 3300005834 Unclassified 736
141 Ga0068863_100099498 3300005841 Bacteria 2763
142 Ga0068862_100218438 3300005844 Bacteria 1725
143 Ga0070717_10739431 3300006028 Bacteria 894
144 Ga0097621_100051826 3300006237 Bacteria 3341
145 Ga0097621_100358990 3300006237 Bacteria 1297
146 Ga0068871_100481994 3300006358 Bacteria 1116
147 Ga0097620_100577082 3300006931 Bacteria 1218
148 Ga0105240_10081848 3300009093 Bacteria 3965
149 Ga0111539_10170313 3300009094 Bacteria 2544
150 Ga0114129_12305498 3300009147 Bacteria 646
151 Ga0105241_10308954 3300009174 Bacteria 1359
152 Ga0105241_12440825 3300009174 Bacteria 523
153 Ga0105242_10097605 3300009176 Bacteria 2484
154 Ga0105248_11111429 3300009177 Bacteria 893
155 Ga0105248_12026940 3300009177 Bacteria 654
156 Ga0105237_10057396 3300009545 Bacteria 3896
157 Ga0105237_12285618 3300009545 Bacteria 550
158 Ga0105238_10035740 3300009551 Bacteria 5050
159 Ga0105239_11700409 3300010375 Bacteria 730
160 Ga0105239_11958641 3300010375 Unclassified 680
161 Ga0157373_10067834 3300013100 Bacteria 2522
162 Ga0157373_10270815 3300013100 Bacteria 1202
163 Ga0157373_10497376 3300013100 Bacteria 880
164 Ga0157373_10619589 3300013100 Bacteria 789
165 Ga0157373_10923673 3300013100 Bacteria 648
166 Ga0157371_10070350 3300013102 Bacteria 2477
167 Ga0157371_10114914 3300013102 Bacteria 1911
168 Ga0157371_10197558 3300013102 Bacteria 1441
169 Ga0157370_10203250 3300013104 Bacteria 1837
170 Ga0157370_10394869 3300013104 Bacteria 1273
171 Ga0157369_10227436 3300013105 Bacteria 1951
172 Ga0157369_10286041 3300013105 Bacteria 1717
173 Ga0157374_10055069 3300013296 Bacteria 3711
174 Ga0157374_10957230 3300013296 Bacteria 875
175 Ga0157378_10025810 3300013297 Bacteria 5176
176 Ga0157378_12409705 3300013297 Bacteria 578
177 Ga0157372_10127883 3300013307 Bacteria 2922
178 Ga0157375_10154033 3300013308 Bacteria 2436
179 Ga0157375_10381633 3300013308 Bacteria 1576
180 Ga0157375_10752481 3300013308 Bacteria 1126
181 Ga0163161_10111597 3300017792 Bacteria 2044
182 Ga0163161_11062777 3300017792 Bacteria 694
183 Ga0213876_10012787 3300021384 Bacteria 4462
184 Ga0207697_10008027 3300025315 Bacteria 4661
185 Ga0207656_10010958 3300025321 Bacteria 3412
186 Ga0207656_10098390 3300025321 Bacteria 1338
187 Ga0207682_10077229 3300025893 Bacteria 1421
188 Ga0207688_10019488 3300025901 Bacteria 3698
189 Ga0207688_10311677 3300025901 Bacteria 964
190 Ga0207680_10424863 3300025903 Bacteria 941
191 Ga0207647_10015694 3300025904 Bacteria 5187
192 Ga0207645_10011752 3300025907 Bacteria 5966
193 Ga0207645_10131994 3300025907 Bacteria 1626
194 Ga0207645_10134643 3300025907 Bacteria 1609
195 Ga0207645_10292483 3300025907 Bacteria 1083
196 Ga0207645_10659616 3300025907 Bacteria 711
197 Ga0207705_10000320 3300025909 Bacteria 43763
198 Ga0207705_10003708 3300025909 Bacteria 11630
199 Ga0207705_10039326 3300025909 Bacteria 3389
200 Ga0207654_10214103 3300025911 Unclassified 1274
201 Ga0207654_11087965 3300025911 Bacteria 582
202 Ga0207707_10120949 3300025912 Bacteria 2289
203 Ga0207707_10250748 3300025912 Bacteria 1538
204 Ga0207707_10474133 3300025912 Bacteria 1069
205 Ga0207695_10008479 3300025913 Bacteria 12860
206 Ga0207671_10016296 3300025914 Bacteria 5781
207 Ga0207660_10015191 3300025917 Bacteria 5080
208 Ga0207660_10262470 3300025917 Bacteria 1366
209 Ga0207660_10272694 3300025917 Bacteria 1340
210 Ga0207662_10642320 3300025918 Bacteria 741
211 Ga0207657_10007072 3300025919 Bacteria 11529
212 Ga0207657_10025380 3300025919 Bacteria 5466
213 Ga0207657_10028021 3300025919 Bacteria 5148
214 Ga0207657_10237699 3300025919 Bacteria 1455
215 Ga0207657_10760373 3300025919 Bacteria 750
216 Ga0207657_10937485 3300025919 Bacteria 666
217 Ga0207657_10937486 3300025919 Bacteria 666
218 Ga0207649_10007272 3300025920 Bacteria 6019
219 Ga0207649_10041974 3300025920 Bacteria 2788
220 Ga0207649_10058041 3300025920 Bacteria 2422
221 Ga0207649_10090876 3300025920 Bacteria 1999
222 Ga0207649_10177149 3300025920 Bacteria 1490
223 Ga0207652_10078139 3300025921 Bacteria 2889
224 Ga0207652_10240738 3300025921 Bacteria 1631
225 Ga0207652_10309090 3300025921 Bacteria 1427
226 Ga0207652_11802126 3300025921 Bacteria 517
227 Ga0207681_10106269 3300025923 Bacteria 2034
228 Ga0207681_10181061 3300025923 Unclassified 1605
229 Ga0207681_10534491 3300025923 Bacteria 963
230 Ga0207694_10069677 3300025924 Bacteria 2748
231 Ga0207650_10026928 3300025925 Bacteria 4108
232 Ga0207650_10157670 3300025925 Bacteria 1796
233 Ga0207650_10206990 3300025925 Bacteria 1574
234 Ga0207650_10730644 3300025925 Bacteria 837
235 Ga0207650_11533576 3300025925 Unclassified 566
236 Ga0207659_10129939 3300025926 Bacteria 1943
237 Ga0207659_10160309 3300025926 Bacteria 1765
238 Ga0207659_10697418 3300025926 Bacteria 869
239 Ga0207687_10103914 3300025927 Bacteria 2096
240 Ga0207644_10015691 3300025931 Bacteria 5089
241 Ga0207644_10101704 3300025931 Bacteria 2160
242 Ga0207644_10125751 3300025931 Bacteria 1957
243 Ga0207644_10160445 3300025931 Bacteria 1747
244 Ga0207644_10245839 3300025931 Bacteria 1426
245 Ga0207690_10009147 3300025932 Bacteria 5879
246 Ga0207690_10073187 3300025932 Bacteria 2369
247 Ga0207690_10093685 3300025932 Bacteria 2129
248 Ga0207690_10127437 3300025932 Bacteria 1858
249 Ga0207690_10157801 3300025932 Bacteria 1688
250 Ga0207690_10545890 3300025932 Bacteria 942
251 Ga0207690_11303208 3300025932 Bacteria 607
252 Ga0207706_10020099 3300025933 Bacteria 6001
253 Ga0207706_10024073 3300025933 Bacteria 5462
254 Ga0207706_10070603 3300025933 Bacteria 3072
255 Ga0207706_10189820 3300025933 Bacteria 1804
256 Ga0207706_10271894 3300025933 Bacteria 1479
257 Ga0207706_10488808 3300025933 Bacteria 1063
258 Ga0207706_10937972 3300025933 Unclassified 730
259 Ga0207686_10426796 3300025934 Bacteria 1015
260 Ga0207669_10017612 3300025937 Bacteria 3671
261 Ga0207669_10088946 3300025937 Unclassified 2004
262 Ga0207669_10208562 3300025937 Bacteria 1424
263 Ga0207669_11241632 3300025937 Unclassified 632
264 Ga0207704_10076974 3300025938 Bacteria 2140
265 Ga0207691_10018232 3300025940 Bacteria 6649
266 Ga0207691_10059081 3300025940 Bacteria 3487
267 Ga0207691_10070598 3300025940 Bacteria 3153
268 Ga0207691_10187129 3300025940 Bacteria 1807
269 Ga0207689_10119346 3300025942 Bacteria 2169
270 Ga0207689_10172250 3300025942 Bacteria 1784
271 Ga0207661_10021760 3300025944 Bacteria 4811
272 Ga0207661_10375604 3300025944 Bacteria 1286
273 Ga0207679_10002375 3300025945 Bacteria 11582
274 Ga0207679_10013759 3300025945 Bacteria 5307
275 Ga0207679_10020008 3300025945 Bacteria 4509
276 Ga0207679_10026421 3300025945 Bacteria 4003
277 Ga0207679_10033674 3300025945 Bacteria 3608
278 Ga0207679_10846421 3300025945 Bacteria 835
279 Ga0207679_10911066 3300025945 Bacteria 804
280 Ga0207667_10016822 3300025949 Bacteria 8250
281 Ga0207667_10467931 3300025949 Bacteria 1280
282 Ga0207667_10475176 3300025949 Bacteria 1269
283 Ga0207651_10038576 3300025960 Bacteria 3141
284 Ga0207651_10047452 3300025960 Bacteria 2896
285 Ga0207651_10070532 3300025960 Unclassified 2472
286 Ga0207668_10000021 3300025972 Bacteria 137592
287 Ga0207668_10009518 3300025972 Bacteria 5830
288 Ga0207668_10226397 3300025972 Bacteria 1505
289 Ga0207668_10450030 3300025972 Bacteria 1099
290 Ga0207668_10840856 3300025972 Unclassified 814
291 Ga0207640_10001442 3300025981 Bacteria 12862
292 Ga0207640_10051471 3300025981 Bacteria 2677
293 Ga0207640_10935257 3300025981 Bacteria 759
294 Ga0207658_10036016 3300025986 Bacteria 3547
295 Ga0207658_10331446 3300025986 Bacteria 1320
296 Ga0207677_10858132 3300026023 Bacteria 816
297 Ga0207677_11113737 3300026023 Bacteria 720
298 Ga0207639_10054970 3300026041 Bacteria 3045
299 Ga0207639_10215531 3300026041 Bacteria 1655
300 Ga0207639_10510775 3300026041 Bacteria 1099
301 Ga0207678_10056626 3300026067 Bacteria 3374
302 Ga0207678_10144808 3300026067 Bacteria 2028
303 Ga0207678_10257576 3300026067 Bacteria 1495
304 Ga0207678_10347037 3300026067 Unclassified 1280
305 Ga0207708_11211461 3300026075 Bacteria 660
306 Ga0207702_10007522 3300026078 Bacteria 9287
307 Ga0207702_10156041 3300026078 Bacteria 2080
308 Ga0207702_10595157 3300026078 Bacteria 1085
309 Ga0207702_11207507 3300026078 Unclassified 750
310 Ga0207641_10035882 3300026088 Bacteria 4135
311 Ga0207648_10050710 3300026089 Bacteria 3628
312 Ga0207648_10145502 3300026089 Bacteria 2090
313 Ga0207674_10010450 3300026116 Bacteria 10513
314 Ga0207674_10051039 3300026116 Bacteria 4222
315 Ga0207683_10029001 3300026121 Bacteria 4790
316 Ga0207683_10159235 3300026121 Bacteria 2040
317 Ga0207698_10000244 3300026142 Bacteria 33363
318 Ga0207698_10029168 3300026142 Bacteria 3946
319 Ga0207698_10255401 3300026142 Bacteria 1607
320 Ga0207698_10392565 3300026142 Bacteria 1324
321 Ga0207698_10720803 3300026142 Bacteria 994
322 Ga0209974_10046367 3300027876 Bacteria 1453
323 Ga0207428_10253197 3300027907 Bacteria 1313
324 Ga0268264_10005993 3300028381 Bacteria 10290
325 Ga0316177_1085771 3300030731 Bacteria 2229
326 Ga0307408_100166897 3300031548 Bacteria 1754
327 Ga0307408_100204437 3300031548 Bacteria 1601
328 Ga0307408_100275905 3300031548 Bacteria 1398
329 Ga0307405_10071053 3300031731 Bacteria 2238
330 Ga0307405_11124210 3300031731 Bacteria 676
331 Ga0307413_10042564 3300031824 Bacteria 2670
332 Ga0307413_10045104 3300031824 Bacteria 2610
333 Ga0307413_10127476 3300031824 Bacteria 1736
334 Ga0307413_10539050 3300031824 Bacteria 944
335 Ga0307410_10172651 3300031852 Unclassified 1630
336 Ga0307410_10246482 3300031852 Bacteria 1387
337 Ga0307410_10261642 3300031852 Bacteria 1349
338 Ga0307410_10282447 3300031852 Bacteria 1303
339 Ga0307410_11038152 3300031852 Unclassified 708
340 Ga0307410_11299982 3300031852 Unclassified 636
341 Ga0307406_10071401 3300031901 Bacteria 2276
342 Ga0307406_10383788 3300031901 Bacteria 1108
343 Ga0307407_10081855 3300031903 Bacteria 1955
344 Ga0307412_10135527 3300031911 Bacteria 1796
345 Ga0307412_10143696 3300031911 Bacteria 1751
346 Ga0307412_10419570 3300031911 Bacteria 1094
347 Ga0307412_10565485 3300031911 Bacteria 957
348 Ga0307412_10795512 3300031911 Bacteria 820
349 Ga0307409_100132867 3300031995 Bacteria 2130
350 Ga0307409_100180474 3300031995 Bacteria 1868
351 Ga0307409_100214466 3300031995 Bacteria 1733
352 Ga0307416_100150234 3300032002 Bacteria 2135
353 Ga0307416_100496157 3300032002 Bacteria 1284
354 Ga0307416_101138375 3300032002 Bacteria 885
355 Ga0307414_11073045 3300032004 Unclassified 743
356 Ga0307414_11650482 3300032004 Unclassified 597
357 Ga0307411_10017047 3300032005 Bacteria 4126
358 Ga0307411_10118130 3300032005 Bacteria 1912
359 Ga0307411_10148550 3300032005 Bacteria 1739
360 Ga0307411_10150505 3300032005 Bacteria 1729
361 Ga0307411_10412058 3300032005 Bacteria 1120
362 Ga0307415_100032444 3300032126 Bacteria 3377
363 Ga0307415_100532156 3300032126 Bacteria 1034
364 Ga0373943_0241242 3300035170 Bacteria 1013
365 Ga0395899_0001221 3300037312 Bacteria 22495
366 Ga0395899_0041783 3300037312 Bacteria 3424
367 Ga0395899_0057419 3300037312 Bacteria 2873
368 Ga0395899_0060955 3300037312 Bacteria 2778
369 Ga0395899_0741575 3300037312 Unclassified 612
370 Ga0395900_0000240 3300037418 Bacteria 86222
371 Ga0395900_0007970 3300037418 Bacteria 10901
372 Ga0395900_0018250 3300037418 Bacteria 7157
373 Ga0395900_0133929 3300037418 Bacteria 2538
374 Ga0395900_0151333 3300037418 Bacteria 2370
375 Ga0395900_0218253 3300037418 Bacteria 1923
376 Ga0395900_0731866 3300037418 Bacteria 921
377 Ga0395900_0732633 3300037418 Bacteria 920
378 Ga0395898_0002338 3300037466 Bacteria 22624
379 Ga0395898_0002390 3300037466 Bacteria 22286
380 Ga0395898_0027656 3300037466 Bacteria 5688
381 Ga0395898_0146579 3300037466 Bacteria 2259
382 Ga0395898_0196343 3300037466 Bacteria 1927
383 Ga0395898_0393343 3300037466 Bacteria 1321
384 Ga0395898_0406371 3300037466 Bacteria 1298
385 Ga0395898_0562562 3300037466 Bacteria 1082
386 Ga0395898_1840201 3300037466 Bacteria 526
387 Ga0395905_0000219 3300037471 Bacteria 87705
388 Ga0395905_0009535 3300037471 Bacteria 9483
389 Ga0395905_0013531 3300037471 Bacteria 7816
390 Ga0395905_0041808 3300037471 Bacteria 4301
391 Ga0395905_0061568 3300037471 Bacteria 3511
392 Ga0395905_0219687 3300037471 Bacteria 1778
393 Ga0395905_0293361 3300037471 Bacteria 1513
394 Ga0395905_0365173 3300037471 Unclassified 1336
395 Ga0395905_1313849 3300037471 Bacteria 627
396 Ga0395901_0000295 3300038443 Bacteria 61830
397 Ga0395901_0003111 3300038443 Bacteria 16674
398 Ga0395901_0008994 3300038443 Bacteria 10112
399 Ga0395901_0014264 3300038443 Bacteria 8090
400 Ga0395901_0029704 3300038443 Bacteria 5628
401 Ga0395901_0071656 3300038443 Bacteria 3611
402 Ga0395901_0130216 3300038443 Bacteria 2643
403 Ga0395901_0219315 3300038443 Bacteria 1989
404 Ga0395901_0540215 3300038443 Bacteria 1182
405 Ga0395901_0589966 3300038443 Bacteria 1122
406 Ga0436365_1113043 3300039437 Bacteria 5223
407 Ga0439445_0002656 3300042004 Bacteria 3983
408 Ga0439449_0011015 3300042007 Bacteria 3411
409 Ga0439462_0101773 3300042015 Unclassified 792
410 Ga0450920_004483 3300042122 Unclassified 2456
411 Ga0450889_000013 3300042144 Bacteria 15867
412 Ga0466969_0042504 3300044656 Bacteria 2269
413 Ga0466966_0194550 3300044684 Bacteria 1228
414 Ga0466966_0992797 3300044684 Unclassified 507
415 Ga0466961_0093356 3300044693 Bacteria 1899
416 Ga0466963_0021753 3300044694 Bacteria 4050
417 Ga0466963_0104425 3300044694 Bacteria 1941
418 Ga0466970_0094811 3300044765 Bacteria 1622
419 Ga0466959_0022643 3300045049 Bacteria 4646
420 Ga0466959_0379569 3300045049 Bacteria 962
421 Ga0466958_0299274 3300045836 Bacteria 1033
422 Ga0466958_0398332 3300045836 Bacteria 889
423 Ga0466958_0774318 3300045836 Bacteria 625
424 Ga0466967_0069693 3300045976 Bacteria 3144
425 Ga0466967_0223967 3300045976 Bacteria 1788
426 Ga0466967_0353514 3300045976 Bacteria 1423
427 Ga0466967_1928018 3300045976 Bacteria 588
428 Ga0495668_0088831 3300046616 Bacteria 1694
429 Ga0495669_0175683 3300046684 Bacteria 1020
430 Ga0496100_0138527 3300048903 Bacteria 1722
431 Ga0496102_0058042 3300048905 Bacteria 3536
432 Ga0496103_0449684 3300048906 Bacteria 826
433 Ga0496108_0664315 3300048911 Bacteria 905
434 Ga0496108_1590735 3300048911 Bacteria 541
435 Ga0496109_0872193 3300048912 Bacteria 838
436 Ga0496109_1000017 3300048912 Bacteria 774
437 Ga0496109_1358547 3300048912 Bacteria 646
438 Ga0496112_0028421 3300048915 Bacteria 5397
439 Ga0496113_0004885 3300048916 Bacteria 8302
440 Ga0496114_0000206 3300048917 Bacteria 42865
441 nmdc:mga08y16_167318_c1 3300050511 Bacteria 2284
442 Ga0395899_0006009
443 JGI24741J21665_1006642
444 JGI24740J21852_10013193
445 JGI24737J22298_10068040
446 JGI24735J21928_10019415
447 JGI24738J21930_10015138
448 JGI24744J21845_10000639
449 Ga0065712_10213687
450 Ga0070658_10035950
451 Ga0070658_10036667
452 Ga0070658_10119145
453 Ga0070658_11123445
454 Ga0070658_11148188
455 Ga0070676_10072200
456 Ga0070676_10130648
457 Ga0070676_10138754
458 Ga0070676_10696467
459 Ga0070676_11108557
460 Ga0070683_100077140
461 Ga0070683_100267217
462 Ga0070670_100006594
463 Ga0070670_100025514
464 Ga0070670_100890022
465 Ga0070670_101097853
466 Ga0070677_10042313
467 Ga0070677_10112538
468 Ga0068869_100077767
469 Ga0070666_10024923
470 Ga0070680_100075776
471 Ga0070680_100235254
472 Ga0070680_100328699
473 Ga0070682_100022999
474 Ga0070682_101023234
475 Ga0068868_100205602
476 Ga0068868_100385491
477 Ga0070660_100021037
478 Ga0070660_100062775
479 Ga0070660_100069143
480 Ga0070660_100288619
481 Ga0070660_100425776
482 Ga0070691_10014645
483 Ga0070691_10126756
484 Ga0070687_100467584
485 Ga0070661_100019677
486 Ga0070661_100054119
487 Ga0070661_100129241
488 Ga0070661_100233577
489 Ga0070692_11078694
490 Ga0070668_100001775
491 Ga0070668_100049927
492 Ga0070669_100088907
493 Ga0070669_100813499
494 Ga0070675_100261492
495 Ga0070671_100000730
496 Ga0070671_100374357
497 Ga0070671_100627174
498 Ga0070671_100789534
499 Ga0070674_100004438
500 Ga0070674_100008689
501 Ga0070674_100112352
502 Ga0070674_100244498
503 Ga0070673_100025630
504 Ga0070673_100046023
505 Ga0070659_100047630
506 Ga0070659_100079734
507 Ga0070659_100128954
508 Ga0070659_100201644
509 Ga0070659_100224527
510 Ga0070659_100320143
511 Ga0070659_100578430
512 Ga0070659_100636055
513 Ga0070659_100672563
514 Ga0070667_100074155
515 Ga0070667_100190163
516 Ga0070667_100850228
517 Ga0070694_100124233
518 Ga0070663_100044722
519 Ga0070663_100099043
520 Ga0070663_100149365
521 Ga0070663_100255654
522 Ga0070678_100122301
523 Ga0070678_100224279
524 Ga0070662_100021141
525 Ga0070662_100138854
526 Ga0070662_100183918
527 Ga0070662_100276923
528 Ga0070662_100984201
529 Ga0070681_10131250
530 Ga0070681_10484416
531 Ga0070681_10553223
532 Ga0068867_100329281
533 Ga0068867_100500779
534 Ga0070679_100283535
535 Ga0070679_100421300
536 Ga0070679_100562587
537 Ga0070679_100579280
538 Ga0070684_100014442
539 Ga0068853_100032968
540 Ga0068853_100099163
541 Ga0068853_100292904
542 Ga0068853_100911090
543 Ga0068853_101610256
544 Ga0070672_100014546
545 Ga0070672_100042698
546 Ga0070672_100250092
547 Ga0070672_100351965
548 Ga0070695_100017280
549 Ga0070696_100012160
550 Ga0070696_100148089
551 Ga0070693_100108605
552 Ga0068855_100202140
553 Ga0068855_100256228
554 Ga0070664_100007068
555 Ga0070664_100127242
556 Ga0070664_100155271
557 Ga0070664_100221888
558 Ga0070664_100514119
559 Ga0070664_100674372
560 Ga0068857_100006935
561 Ga0068857_100216745
562 Ga0068857_100227852
563 Ga0068854_100016602
564 Ga0068854_100068171
565 Ga0068854_100602654
566 Ga0068856_100073171
567 Ga0068856_100201194
568 Ga0068856_100499922
569 Ga0068852_100069118
570 Ga0068852_100137592
571 Ga0068852_101932755
572 Ga0068859_100577075
573 Ga0068864_100009937
574 Ga0068864_100153265
575 Ga0068864_100256981
576 Ga0068864_100613437
577 Ga0068866_10047784
578 Ga0068866_10544288
579 Ga0068866_10726609
580 Ga0068851_10022963
581 Ga0068851_10489800
582 Ga0068863_100099498
583 Ga0068862_100218438
584 Ga0070717_10739431
585 Ga0097621_100051826
586 Ga0097621_100358990
587 Ga0068871_100481994
588 Ga0097620_100577082
589 Ga0105240_10081848
590 Ga0111539_10170313
591 Ga0114129_12305498
592 Ga0105241_10308954
593 Ga0105241_12440825
594 Ga0105242_10097605
595 Ga0105248_11111429
596 Ga0105248_12026940
597 Ga0105237_10057396
598 Ga0105237_12285618
599 Ga0105238_10035740
600 Ga0105239_11700409
601 Ga0105239_11958641
602 Ga0157373_10067834
603 Ga0157373_10270815
604 Ga0157373_10497376
605 Ga0157373_10619589
606 Ga0157373_10923673
607 Ga0157371_10070350
608 Ga0157371_10114914
609 Ga0157371_10197558
610 Ga0157370_10203250
611 Ga0157370_10394869
612 Ga0157369_10227436
613 Ga0157369_10286041
614 Ga0157374_10055069
615 Ga0157374_10957230
616 Ga0157378_10025810
617 Ga0157378_12409705
618 Ga0157372_10127883
619 Ga0157375_10154033
620 Ga0157375_10381633
621 Ga0157375_10752481
622 Ga0163161_10111597
623 Ga0163161_11062777
624 Ga0213876_10012787
625 Ga0207697_10008027
626 Ga0207656_10010958
627 Ga0207656_10098390
628 Ga0207682_10077229
629 Ga0207688_10019488
630 Ga0207688_10311677
631 Ga0207680_10424863
632 Ga0207647_10015694
633 Ga0207645_10011752
634 Ga0207645_10131994
635 Ga0207645_10134643
636 Ga0207645_10292483
637 Ga0207645_10659616
638 Ga0207705_10000320
639 Ga0207705_10003708
640 Ga0207705_10039326
641 Ga0207654_10214103
642 Ga0207654_11087965
643 Ga0207707_10120949
644 Ga0207707_10250748
645 Ga0207707_10474133
646 Ga0207695_10008479
647 Ga0207671_10016296
648 Ga0207660_10015191
649 Ga0207660_10262470
650 Ga0207660_10272694
651 Ga0207662_10642320
652 Ga0207657_10007072
653 Ga0207657_10025380
654 Ga0207657_10028021
655 Ga0207657_10237699
656 Ga0207657_10760373
657 Ga0207657_10937485
658 Ga0207657_10937486
659 Ga0207649_10007272
660 Ga0207649_10041974
661 Ga0207649_10058041
662 Ga0207649_10090876
663 Ga0207649_10177149
664 Ga0207652_10078139
665 Ga0207652_10240738
666 Ga0207652_10309090
667 Ga0207652_11802126
668 Ga0207681_10106269
669 Ga0207681_10181061
670 Ga0207681_10534491
671 Ga0207694_10069677
672 Ga0207650_10026928
673 Ga0207650_10157670
674 Ga0207650_10206990
675 Ga0207650_10730644
676 Ga0207650_11533576
677 Ga0207659_10129939
678 Ga0207659_10160309
679 Ga0207659_10697418
680 Ga0207687_10103914
681 Ga0207644_10015691
682 Ga0207644_10101704
683 Ga0207644_10125751
684 Ga0207644_10160445
685 Ga0207644_10245839
686 Ga0207690_10009147
687 Ga0207690_10073187
688 Ga0207690_10093685
689 Ga0207690_10127437
690 Ga0207690_10157801
691 Ga0207690_10545890
692 Ga0207690_11303208
693 Ga0207706_10020099
694 Ga0207706_10024073
695 Ga0207706_10070603
696 Ga0207706_10189820
697 Ga0207706_10271894
698 Ga0207706_10488808
699 Ga0207706_10937972
700 Ga0207686_10426796
701 Ga0207669_10017612
702 Ga0207669_10088946
703 Ga0207669_10208562
704 Ga0207669_11241632
705 Ga0207704_10076974
706 Ga0207691_10018232
707 Ga0207691_10059081
708 Ga0207691_10070598
709 Ga0207691_10187129
710 Ga0207689_10119346
711 Ga0207689_10172250
712 Ga0207661_10021760
713 Ga0207661_10375604
714 Ga0207679_10002375
715 Ga0207679_10013759
716 Ga0207679_10020008
717 Ga0207679_10026421
718 Ga0207679_10033674
719 Ga0207679_10846421
720 Ga0207679_10911066
721 Ga0207667_10016822
722 Ga0207667_10467931
723 Ga0207667_10475176
724 Ga0207651_10038576
725 Ga0207651_10047452
726 Ga0207651_10070532
727 Ga0207668_10000021
728 Ga0207668_10009518
729 Ga0207668_10226397
730 Ga0207668_10450030
731 Ga0207668_10840856
732 Ga0207640_10001442
733 Ga0207640_10051471
734 Ga0207640_10935257
735 Ga0207658_10036016
736 Ga0207658_10331446
737 Ga0207677_10858132
738 Ga0207677_11113737
739 Ga0207639_10054970
740 Ga0207639_10215531
741 Ga0207639_10510775
742 Ga0207678_10056626
743 Ga0207678_10144808
744 Ga0207678_10257576
745 Ga0207678_10347037
746 Ga0207708_11211461
747 Ga0207702_10007522
748 Ga0207702_10156041
749 Ga0207702_10595157
750 Ga0207702_11207507
751 Ga0207641_10035882
752 Ga0207648_10050710
753 Ga0207648_10145502
754 Ga0207674_10010450
755 Ga0207674_10051039
756 Ga0207683_10029001
757 Ga0207683_10159235
758 Ga0207698_10000244
759 Ga0207698_10029168
760 Ga0207698_10255401
761 Ga0207698_10392565
762 Ga0207698_10720803
763 Ga0209974_10046367
764 Ga0207428_10253197
765 Ga0268264_10005993
766 Ga0316177_1085771
767 Ga0307408_100166897
768 Ga0307408_100204437
769 Ga0307408_100275905
770 Ga0307405_10071053
771 Ga0307405_11124210
772 Ga0307413_10042564
773 Ga0307413_10045104
774 Ga0307413_10127476
775 Ga0307413_10539050
776 Ga0307410_10172651
777 Ga0307410_10246482
778 Ga0307410_10261642
779 Ga0307410_10282447
780 Ga0307410_11038152
781 Ga0307410_11299982
782 Ga0307406_10071401
783 Ga0307406_10383788
784 Ga0307407_10081855
785 Ga0307412_10135527
786 Ga0307412_10143696
787 Ga0307412_10419570
788 Ga0307412_10565485
789 Ga0307412_10795512
790 Ga0307409_100132867
791 Ga0307409_100180474
792 Ga0307409_100214466
793 Ga0307416_100150234
794 Ga0307416_100496157
795 Ga0307416_101138375
796 Ga0307414_11073045
797 Ga0307414_11650482
798 Ga0307411_10017047
799 Ga0307411_10118130
800 Ga0307411_10148550
801 Ga0307411_10150505
802 Ga0307411_10412058
803 Ga0307415_100032444
804 Ga0307415_100532156
805 Ga0373943_0241242
806 Ga0395899_0001221
807 Ga0395899_0041783
808 Ga0395899_0057419
809 Ga0395899_0060955
810 Ga0395899_0741575
811 Ga0395900_0000240
812 Ga0395900_0007970
813 Ga0395900_0018250
814 Ga0395900_0133929
815 Ga0395900_0151333
816 Ga0395900_0218253
817 Ga0395900_0731866
818 Ga0395900_0732633
819 Ga0395898_0002338
820 Ga0395898_0002390
821 Ga0395898_0027656
822 Ga0395898_0146579
823 Ga0395898_0196343
824 Ga0395898_0393343
825 Ga0395898_0406371
826 Ga0395898_0562562
827 Ga0395898_1840201
828 Ga0395905_0000219
829 Ga0395905_0009535
830 Ga0395905_0013531
831 Ga0395905_0041808
832 Ga0395905_0061568
833 Ga0395905_0219687
834 Ga0395905_0293361
835 Ga0395905_0365173
836 Ga0395905_1313849
837 Ga0395901_0000295
838 Ga0395901_0003111
839 Ga0395901_0008994
840 Ga0395901_0014264
841 Ga0395901_0029704
842 Ga0395901_0071656
843 Ga0395901_0130216
844 Ga0395901_0219315
845 Ga0395901_0540215
846 Ga0395901_0589966
847 Ga0436365_1113043
848 Ga0439445_0002656
849 Ga0439449_0011015
850 Ga0439462_0101773
851 Ga0450920_004483
852 Ga0450889_000013
853 Ga0466969_0042504
854 Ga0466966_0194550
855 Ga0466966_0992797
856 Ga0466961_0093356
857 Ga0466963_0021753
858 Ga0466963_0104425
859 Ga0466970_0094811
860 Ga0466959_0022643
861 Ga0466959_0379569
862 Ga0466958_0299274
863 Ga0466958_0398332
864 Ga0466958_0774318
865 Ga0466967_0069693
866 Ga0466967_0223967
867 Ga0466967_0353514
868 Ga0466967_1928018
869 Ga0495668_0088831
870 Ga0495669_0175683
871 Ga0496100_0138527
872 Ga0496102_0058042
873 Ga0496103_0449684
874 Ga0496108_0664315
875 Ga0496108_1590735
876 Ga0496109_0872193
877 Ga0496109_1000017
878 Ga0496109_1358547
879 Ga0496112_0028421
880 Ga0496113_0004885
881 Ga0496114_0000206
882 nmdc:mga08y16_167318_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06718

DUF1203

Protein of unknown function (DUF1203)

70

185

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oda-assembly4.cif.gz_G human parp-1 zinc finger 1 (zn1) bound to dna 0.644 29 77
7s6m-assembly2.cif.gz_A human parp1 deltav687-e688 bound to a dna double strand break. 0.6357 29 77
5hy3-assembly1.cif.gz_B crystal structure of escherichia coli toxin lsoa in complex with t4 phage antitoxin dmd 0.6052 98 155
4opx-assembly1.cif.gz_A structure of human parp-1 bound to a dna double strand break in complex with (2r)-5-fluoro-2-methyl-2,3-dihydro-1-benzofuran-7-carboxamide 0.5976 29 77
5hy3-assembly1.cif.gz_B crystal structure of escherichia coli toxin lsoa in complex with t4 phage antitoxin dmd 0.5893 98 155
ID Description Score Start End Superfamily
af_Q19157_5_75_2.10.110.10 Mainly Beta;Ribbon;Cysteine Rich Protein;Cysteine Rich Protein 0.8418 29 58 2.10.110.10
af_A0A1D6ND74_153_254_3.30.1740.10 Alpha Beta;2-Layer Sandwich;first zn-finger domain of poly(adp-ribose) polymerase-1;Zinc finger, PARP-type 0.6788 29 77 3.30.1740.10
af_Q9N4H4_2_103_3.30.1740.10 Alpha Beta;2-Layer Sandwich;first zn-finger domain of poly(adp-ribose) polymerase-1;Zinc finger, PARP-type 0.6556 29 77 3.30.1740.10
af_A0A1D6F1R4_83_151_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6439 21 55 3.30.40.10
af_Q54X55_7_100_3.30.1740.10 Alpha Beta;2-Layer Sandwich;first zn-finger domain of poly(adp-ribose) polymerase-1;Zinc finger, PARP-type 0.6364 27 77 3.30.1740.10
ID Description Score Start End GO Terms
AF-A0A2G8BS46-F1-model_v4 deleted 0.9704 1 155
AF-A0A7H0G531-F1-model_v4 deleted 0.9634 2 155
AF-A0A1W7M8C9-F1-model_v4 DUF1203 domain-containing protein 0.9613 87 155
AF-A0A2D8AXD9-F1-model_v4 DUF1203 domain-containing protein 0.9597 2 155
AF-A0A2V2BF83-F1-model_v4 Uncharacterized protein DUF1203 0.9586 1 155

Map