F444614

General Info

Members Datasets Scaffolds Average Seq Length
441 206 882 408

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100162647|Ga0068858_1001626471
Length 459
Sequence MSWISLWETWRQRAETAWREKFPSWEKYPEVLRVRLWYSSRVMTHLTRRQFGGTLGGMFLLGTQVPRLSGASGSASSMAIDRTLREGIERRKIPCVAAMAASSDKILYSGAFGKRDSASGIDIQPDSIFQIASMTKAITSVAAMQLVERGKLKLDEPVARHLPELGKLDVLEGFDPSGKPVLRPAKKPITLRHLLTHTSGFAYPNWSEELFKYTQATGPLPPGVVAPLVPLAFEPGTRWQYGYSADWTGRLVESVSGLNLEQYFQRNILGPLGMNDTTFIFPKDKFDRLVSQSRRQDGGPLQEVPRTLPAKPTAFNGGGGLTSTAPDYVRFMQMILRYGRSGVRDEILTAKSVEMMSVNQIGDLRAGVLKTFQPNVSADVDVHPGEVDKWGLGFLINQVAYPGGRSAGSLAWAGVFNTFYWIDPPRGICGVIMMQFLPFVDKEAVGLLGDFERAVYANL

Samples

Sample ID Description Type Environment
1 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
170 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
171 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
192 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
203 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
204 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
205 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
206 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.63
Nodule 0
Rhizoplane 1.36
Rhizosphere 92.52
Stem 0
Stem Tuber 0
Unclassified 4.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068858_100162647 3300005842 Bacteria 2102
2 Ga0070658_10033571 3300005327 Bacteria 4129
3 Ga0070683_100011565 3300005329 Bacteria 7637
4 Ga0070683_100017554 3300005329 Bacteria 6326
5 Ga0070683_100022142 3300005329 Bacteria 5677
6 Ga0070683_100072017 3300005329 Bacteria 3225
7 Ga0070683_100080370 3300005329 Bacteria 3052
8 Ga0070683_100097577 3300005329 Bacteria 2764
9 Ga0070690_100007501 3300005330 Bacteria 6246
10 Ga0070670_100002847 3300005331 Bacteria 14296
11 Ga0068869_100000609 3300005334 Bacteria 20182
12 Ga0068869_100151026 3300005334 Bacteria 1802
13 Ga0068869_100226068 3300005334 Unclassified 1485
14 Ga0070666_10003849 3300005335 Bacteria 9106
15 Ga0070680_100001194 3300005336 Bacteria 18719
16 Ga0068868_100005480 3300005338 Bacteria 8927
17 Ga0068868_100115110 3300005338 Bacteria 2189
18 Ga0070660_100141234 3300005339 Bacteria 1932
19 Ga0070689_100043270 3300005340 Unclassified 3460
20 Ga0070689_100083686 3300005340 Bacteria 2507
21 Ga0070689_100109583 3300005340 Bacteria 2194
22 Ga0070691_10002783 3300005341 Bacteria 7802
23 Ga0070687_100076115 3300005343 Bacteria 1817
24 Ga0070661_100079003 3300005344 Bacteria 2427
25 Ga0070669_100019240 3300005353 Bacteria 4877
26 Ga0070669_100182898 3300005353 Bacteria 1641
27 Ga0070675_100000267 3300005354 Bacteria 34364
28 Ga0070675_100000624 3300005354 Bacteria 24512
29 Ga0070675_100006103 3300005354 Bacteria 9241
30 Ga0070675_100010406 3300005354 Bacteria 7266
31 Ga0070671_100008411 3300005355 Bacteria 8271
32 Ga0070671_100013461 3300005355 Bacteria 6595
33 Ga0070671_100028262 3300005355 Bacteria 4617
34 Ga0070674_100035778 3300005356 Bacteria 3328
35 Ga0070674_100082996 3300005356 Bacteria 2294
36 Ga0070673_100019425 3300005364 Bacteria 4877
37 Ga0070673_100104002 3300005364 Bacteria 2344
38 Ga0070659_100036593 3300005366 Bacteria 3827
39 Ga0070667_100001967 3300005367 Bacteria 18242
40 Ga0070667_100035416 3300005367 Bacteria 4182
41 Ga0070709_10001586 3300005434 Bacteria 12271
42 Ga0070709_10061821 3300005434 Bacteria 2385
43 Ga0070709_10212340 3300005434 Bacteria 1376
44 Ga0070714_100010818 3300005435 Bacteria 7226
45 Ga0070714_100013701 3300005435 Bacteria 6502
46 Ga0070714_100017662 3300005435 Bacteria 5783
47 Ga0070714_100101289 3300005435 Bacteria 2538
48 Ga0070713_100001750 3300005436 Bacteria 13991
49 Ga0070713_100006770 3300005436 Bacteria 7985
50 Ga0070713_100023291 3300005436 Bacteria 4802
51 Ga0070713_100047077 3300005436 Bacteria 3542
52 Ga0070713_100068425 3300005436 Unclassified 2992
53 Ga0070713_100273455 3300005436 Bacteria 1548
54 Ga0070710_10000207 3300005437 Bacteria 27705
55 Ga0070711_100052188 3300005439 Bacteria 2813
56 Ga0070705_100029854 3300005440 Bacteria 3004
57 Ga0070700_100021086 3300005441 Bacteria 3785
58 Ga0070700_100040211 3300005441 Bacteria 2861
59 Ga0070678_100060062 3300005456 Bacteria 2797
60 Ga0070678_100070187 3300005456 Bacteria 2618
61 Ga0070662_100022339 3300005457 Bacteria 4331
62 Ga0070681_10024664 3300005458 Bacteria 6051
63 Ga0070681_10091058 3300005458 Bacteria 3000
64 Ga0068867_100012917 3300005459 Bacteria 5909
65 Ga0068867_100023518 3300005459 Bacteria 4411
66 Ga0070685_10065240 3300005466 Bacteria 2143
67 Ga0070706_100064635 3300005467 Bacteria 3382
68 Ga0070698_100002475 3300005471 Bacteria 20373
69 Ga0070698_100063243 3300005471 Bacteria 3732
70 Ga0070699_100029488 3300005518 Bacteria 4730
71 Ga0070699_100078392 3300005518 Bacteria 2877
72 Ga0070679_100001453 3300005530 Bacteria 20967
73 Ga0070679_100196730 3300005530 Unclassified 1983
74 Ga0070684_100028774 3300005535 Bacteria 4702
75 Ga0070684_100047124 3300005535 Unclassified 3735
76 Ga0070697_100001815 3300005536 Bacteria 16312
77 Ga0070697_100036735 3300005536 Bacteria 3957
78 Ga0070672_100006660 3300005543 Bacteria 7781
79 Ga0070672_100029891 3300005543 Bacteria 4089
80 Ga0070686_100043712 3300005544 Bacteria 2812
81 Ga0070686_100076972 3300005544 Bacteria 2198
82 Ga0070696_100059046 3300005546 Bacteria 2680
83 Ga0068855_100001264 3300005563 Bacteria 31380
84 Ga0068855_100002190 3300005563 Bacteria 24156
85 Ga0068855_100009973 3300005563 Bacteria 11448
86 Ga0068855_100068189 3300005563 Bacteria 4142
87 Ga0070664_100037303 3300005564 Bacteria 4086
88 Ga0068857_100000716 3300005577 Bacteria 24726
89 Ga0068857_100004053 3300005577 Bacteria 12334
90 Ga0068857_100027548 3300005577 Bacteria 5013
91 Ga0068856_100000584 3300005614 Bacteria 39905
92 Ga0068856_100005705 3300005614 Bacteria 12261
93 Ga0068856_100017485 3300005614 Bacteria 6948
94 Ga0068852_100018095 3300005616 Bacteria 5544
95 Ga0068859_100000967 3300005617 Bacteria 29415
96 Ga0068859_100061678 3300005617 Unclassified 3779
97 Ga0068859_100088968 3300005617 Bacteria 3137
98 Ga0068859_100150055 3300005617 Bacteria 2406
99 Ga0068864_100040981 3300005618 Bacteria 3961
100 Ga0068864_100052927 3300005618 Bacteria 3500
101 Ga0068861_100008656 3300005719 Bacteria 6999
102 Ga0068861_100030933 3300005719 Bacteria 3927
103 Ga0068851_10006167 3300005834 Bacteria 5470
104 Ga0068870_10075860 3300005840 Bacteria 1845
105 Ga0068863_100000478 3300005841 Bacteria 41029
106 Ga0068863_100002123 3300005841 Bacteria 19662
107 Ga0068863_100087223 3300005841 Unclassified 2957
108 Ga0068863_100144944 3300005841 Bacteria 2271
109 Ga0068863_100243282 3300005841 Bacteria 1737
110 Ga0068858_100019805 3300005842 Bacteria 6289
111 Ga0068858_100020930 3300005842 Bacteria 6113
112 Ga0068858_100033532 3300005842 Bacteria 4763
113 Ga0068858_100052407 3300005842 Bacteria 3775
114 Ga0068858_100062094 3300005842 Bacteria 3455
115 Ga0068860_100001909 3300005843 Bacteria 22122
116 Ga0068860_100001986 3300005843 Bacteria 21595
117 Ga0068860_100092057 3300005843 Bacteria 2889
118 Ga0068862_100059101 3300005844 Bacteria 3291
119 Ga0068862_100099621 3300005844 Bacteria 2540
120 Ga0081455_10021611 3300005937 Bacteria 6031
121 Ga0070717_10000334 3300006028 Bacteria 30315
122 Ga0070717_10025531 3300006028 Unclassified 4700
123 Ga0070717_10065636 3300006028 Bacteria 3017
124 Ga0070717_10102569 3300006028 Bacteria 2431
125 Ga0070717_10238206 3300006028 Unclassified 1604
126 Ga0075365_10063326 3300006038 Bacteria 2476
127 Ga0075365_10114538 3300006038 Bacteria 1855
128 Ga0075368_10010737 3300006042 Bacteria 3317
129 Ga0075364_10024393 3300006051 Bacteria 3840
130 Ga0070715_10029642 3300006163 Bacteria 2205
131 Ga0070715_10093535 3300006163 Bacteria 1388
132 Ga0070712_100039601 3300006175 Unclassified 3226
133 Ga0075362_10031816 3300006177 Bacteria 2286
134 Ga0075367_10000802 3300006178 Bacteria 12383
135 Ga0075366_10000178 3300006195 Bacteria 27695
136 Ga0097621_100013427 3300006237 Bacteria 6105
137 Ga0097621_100014824 3300006237 Bacteria 5847
138 Ga0097621_100028682 3300006237 Bacteria 4388
139 Ga0097621_100038664 3300006237 Bacteria 3829
140 Ga0097621_100054325 3300006237 Bacteria 3266
141 Ga0068871_100008395 3300006358 Bacteria 7428
142 Ga0068871_100022568 3300006358 Bacteria 4854
143 Ga0068871_100041089 3300006358 Bacteria 3707
144 Ga0068871_100076522 3300006358 Bacteria 2764
145 Ga0075428_100034989 3300006844 Bacteria 5537
146 Ga0075428_100068652 3300006844 Bacteria 3877
147 Ga0075428_100068817 3300006844 Bacteria 3872
148 Ga0075428_100103635 3300006844 Bacteria 3102
149 Ga0075430_100077951 3300006846 Bacteria 2778
150 Ga0075431_100290173 3300006847 Bacteria 1655
151 Ga0075433_10104003 3300006852 Bacteria 2516
152 Ga0075434_100001959 3300006871 Bacteria 17846
153 Ga0075434_100023917 3300006871 Bacteria 5963
154 Ga0075434_100129712 3300006871 Bacteria 2540
155 Ga0068865_100008199 3300006881 Bacteria 6449
156 Ga0068865_100011040 3300006881 Bacteria 5639
157 Ga0068865_100013149 3300006881 Bacteria 5224
158 Ga0068865_100044436 3300006881 Bacteria 3041
159 Ga0075436_100001309 3300006914 Bacteria 16926
160 Ga0097620_100000967 3300006931 Bacteria 29415
161 Ga0097620_100061674 3300006931 Unclassified 3779
162 Ga0097620_100088967 3300006931 Bacteria 3137
163 Ga0097620_100150054 3300006931 Bacteria 2406
164 Ga0075435_100000889 3300007076 Bacteria 18785
165 Ga0075435_100010123 3300007076 Bacteria 6885
166 Ga0105240_10004769 3300009093 Bacteria 20468
167 Ga0105240_10008912 3300009093 Bacteria 14272
168 Ga0105240_10023870 3300009093 Bacteria 8077
169 Ga0111539_10002812 3300009094 Bacteria 23123
170 Ga0111539_10014551 3300009094 Bacteria 9824
171 Ga0111539_10022728 3300009094 Bacteria 7702
172 Ga0111539_10073663 3300009094 Bacteria 4026
173 Ga0111539_10219842 3300009094 Bacteria 2213
174 Ga0105245_10002670 3300009098 Bacteria 16053
175 Ga0105245_10004570 3300009098 Bacteria 12221
176 Ga0105245_10017021 3300009098 Bacteria 6346
177 Ga0105245_10022023 3300009098 Bacteria 5593
178 Ga0105247_10004388 3300009101 Bacteria 9006
179 Ga0105247_10114931 3300009101 Unclassified 1736
180 Ga0105243_10028917 3300009148 Bacteria 4259
181 Ga0105243_10079380 3300009148 Bacteria 2675
182 Ga0105243_10087254 3300009148 Bacteria 2561
183 Ga0105241_10082348 3300009174 Bacteria 2522
184 Ga0105242_10005289 3300009176 Bacteria 9963
185 Ga0105242_10031908 3300009176 Bacteria 4211
186 Ga0105242_10041934 3300009176 Bacteria 3694
187 Ga0105242_10065252 3300009176 Unclassified 3003
188 Ga0105242_10071018 3300009176 Bacteria 2888
189 Ga0105242_10170978 3300009176 Unclassified 1910
190 Ga0105242_10225293 3300009176 Bacteria 1678
191 Ga0105248_10000867 3300009177 Bacteria 33991
192 Ga0105248_10015144 3300009177 Bacteria 8496
193 Ga0105248_10019966 3300009177 Bacteria 7418
194 Ga0105248_10031169 3300009177 Bacteria 5960
195 Ga0105248_10055098 3300009177 Bacteria 4460
196 Ga0105248_10409449 3300009177 Bacteria 1527
197 Ga0105238_10000959 3300009551 Bacteria 29509
198 Ga0105238_10002785 3300009551 Bacteria 17453
199 Ga0105238_10004557 3300009551 Bacteria 13713
200 Ga0105238_10023953 3300009551 Bacteria 6223
201 Ga0105238_10036128 3300009551 Bacteria 5022
202 Ga0105249_10011766 3300009553 Bacteria 7692
203 Ga0105249_10107642 3300009553 Bacteria 2631
204 Ga0105239_10003048 3300010375 Bacteria 20831
205 Ga0105239_10004021 3300010375 Bacteria 17804
206 Ga0105239_10020130 3300010375 Bacteria 7361
207 Ga0105246_10003902 3300011119 Bacteria 9033
208 Ga0105246_10037664 3300011119 Bacteria 3246
209 Ga0157370_10003423 3300013104 Bacteria 18634
210 Ga0157370_10028274 3300013104 Bacteria 5518
211 Ga0157370_10037517 3300013104 Bacteria 4698
212 Ga0157370_10067782 3300013104 Unclassified 3373
213 Ga0157370_10116604 3300013104 Bacteria 2494
214 Ga0157369_10002413 3300013105 Bacteria 22447
215 Ga0157369_10002738 3300013105 Bacteria 21047
216 Ga0157369_10007110 3300013105 Bacteria 12908
217 Ga0157369_10210004 3300013105 Bacteria 2041
218 Ga0157369_10303314 3300013105 Unclassified 1661
219 Ga0157374_10016316 3300013296 Bacteria 6524
220 Ga0157374_10030821 3300013296 Bacteria 4871
221 Ga0157374_10074736 3300013296 Bacteria 3201
222 Ga0157374_10389540 3300013296 Bacteria 1389
223 Ga0157378_10002546 3300013297 Bacteria 16220
224 Ga0163162_10007390 3300013306 Bacteria 10684
225 Ga0163162_10013628 3300013306 Bacteria 7942
226 Ga0163162_10046126 3300013306 Bacteria 4368
227 Ga0157372_10013461 3300013307 Bacteria 8740
228 Ga0157372_10018473 3300013307 Bacteria 7495
229 Ga0157372_10072918 3300013307 Bacteria 3869
230 Ga0157375_10001654 3300013308 Bacteria 19166
231 Ga0157375_10002401 3300013308 Bacteria 16217
232 Ga0157375_10008895 3300013308 Bacteria 8789
233 Ga0157375_10176057 3300013308 Bacteria 2289
234 Ga0157375_10217141 3300013308 Unclassified 2070
235 Ga0163163_10008222 3300014325 Bacteria 9258
236 Ga0163163_10008800 3300014325 Bacteria 8985
237 Ga0163163_10014119 3300014325 Bacteria 7335
238 Ga0163163_10033211 3300014325 Bacteria 4990
239 Ga0163163_10102972 3300014325 Bacteria 2879
240 Ga0157380_10005896 3300014326 Bacteria 8572
241 Ga0157380_10018493 3300014326 Bacteria 5174
242 Ga0157380_10077920 3300014326 Bacteria 2703
243 Ga0157379_10000223 3300014968 Bacteria 44424
244 Ga0157379_10002153 3300014968 Bacteria 16343
245 Ga0157379_10034327 3300014968 Bacteria 4523
246 Ga0157379_10070200 3300014968 Bacteria 3134
247 Ga0157379_10086912 3300014968 Bacteria 2803
248 Ga0157376_10017326 3300014969 Bacteria 5491
249 Ga0213875_10000023 3300021388 Bacteria 213455
250 Ga0213875_10006291 3300021388 Bacteria 6250
251 Ga0207692_10001818 3300025898 Bacteria 8098
252 Ga0207680_10007137 3300025903 Bacteria 5432
253 Ga0207680_10150462 3300025903 Bacteria 1551
254 Ga0207699_10002764 3300025906 Bacteria 8290
255 Ga0207699_10056122 3300025906 Bacteria 2346
256 Ga0207699_10117651 3300025906 Bacteria 1713
257 Ga0207645_10002043 3300025907 Bacteria 16198
258 Ga0207705_10023146 3300025909 Bacteria 4431
259 Ga0207684_10003070 3300025910 Bacteria 16550
260 Ga0207654_10100524 3300025911 Bacteria 1781
261 Ga0207707_10000224 3300025912 Bacteria 60855
262 Ga0207707_10039736 3300025912 Bacteria 4112
263 Ga0207707_10068683 3300025912 Bacteria 3088
264 Ga0207695_10000533 3300025913 Bacteria 79615
265 Ga0207695_10004086 3300025913 Bacteria 20051
266 Ga0207695_10005305 3300025913 Bacteria 17168
267 Ga0207695_10122522 3300025913 Bacteria 2567
268 Ga0207671_10041889 3300025914 Bacteria 3390
269 Ga0207693_10104192 3300025915 Unclassified 2225
270 Ga0207663_10000751 3300025916 Bacteria 14466
271 Ga0207663_10157426 3300025916 Bacteria 1600
272 Ga0207660_10181250 3300025917 Bacteria 1636
273 Ga0207662_10074166 3300025918 Bacteria 2065
274 Ga0207657_10029533 3300025919 Archaea 4988
275 Ga0207652_10115034 3300025921 Bacteria 2389
276 Ga0207646_10010592 3300025922 Bacteria 8986
277 Ga0207646_10148342 3300025922 Bacteria 2114
278 Ga0207681_10038836 3300025923 Bacteria 3156
279 Ga0207681_10156484 3300025923 Bacteria 1713
280 Ga0207694_10000545 3300025924 Bacteria 34152
281 Ga0207694_10005878 3300025924 Bacteria 9404
282 Ga0207694_10008721 3300025924 Bacteria 7652
283 Ga0207694_10017392 3300025924 Bacteria 5437
284 Ga0207694_10029831 3300025924 Bacteria 4164
285 Ga0207650_10007581 3300025925 Bacteria 7399
286 Ga0207659_10000974 3300025926 Bacteria 17071
287 Ga0207659_10008108 3300025926 Bacteria 6501
288 Ga0207659_10008542 3300025926 Bacteria 6365
289 Ga0207687_10015851 3300025927 Bacteria 4945
290 Ga0207687_10027930 3300025927 Bacteria 3788
291 Ga0207687_10057996 3300025927 Bacteria 2722
292 Ga0207687_10058448 3300025927 Bacteria 2713
293 Ga0207687_10139443 3300025927 Bacteria 1838
294 Ga0207687_10225372 3300025927 Bacteria 1478
295 Ga0207700_10004944 3300025928 Bacteria 7922
296 Ga0207700_10014023 3300025928 Bacteria 5238
297 Ga0207700_10052702 3300025928 Unclassified 3044
298 Ga0207664_10002261 3300025929 Bacteria 12685
299 Ga0207664_10005105 3300025929 Bacteria 8942
300 Ga0207664_10057826 3300025929 Bacteria 3084
301 Ga0207664_10079882 3300025929 Bacteria 2657
302 Ga0207644_10009516 3300025931 Bacteria 6384
303 Ga0207644_10011483 3300025931 Bacteria 5862
304 Ga0207706_10021517 3300025933 Bacteria 5790
305 Ga0207686_10003205 3300025934 Bacteria 8798
306 Ga0207686_10003527 3300025934 Bacteria 8398
307 Ga0207686_10132866 3300025934 Bacteria 1709
308 Ga0207709_10019817 3300025935 Bacteria 3786
309 Ga0207669_10028126 3300025937 Bacteria 3089
310 Ga0207669_10143267 3300025937 Bacteria 1662
311 Ga0207704_10055158 3300025938 Bacteria 2427
312 Ga0207704_10102760 3300025938 Bacteria 1910
313 Ga0207691_10009702 3300025940 Bacteria 9238
314 Ga0207691_10032058 3300025940 Bacteria 4902
315 Ga0207691_10035627 3300025940 Bacteria 4617
316 Ga0207711_10001844 3300025941 Bacteria 19333
317 Ga0207711_10006402 3300025941 Bacteria 9925
318 Ga0207711_10012990 3300025941 Bacteria 6918
319 Ga0207711_10103006 3300025941 Bacteria 2527
320 Ga0207711_10119846 3300025941 Bacteria 2348
321 Ga0207711_10163752 3300025941 Bacteria 2015
322 Ga0207689_10002483 3300025942 Bacteria 17130
323 Ga0207689_10021481 3300025942 Bacteria 5426
324 Ga0207689_10041582 3300025942 Bacteria 3804
325 Ga0207689_10110816 3300025942 Bacteria 2255
326 Ga0207661_10066300 3300025944 Bacteria 2933
327 Ga0207661_10094996 3300025944 Bacteria 2491
328 Ga0207679_10030501 3300025945 Bacteria 3766
329 Ga0207679_10069811 3300025945 Bacteria 2645
330 Ga0207667_10000322 3300025949 Bacteria 66404
331 Ga0207667_10016994 3300025949 Bacteria 8207
332 Ga0207667_10027512 3300025949 Bacteria 6188
333 Ga0207667_10103612 3300025949 Unclassified 2935
334 Ga0207651_10001607 3300025960 Bacteria 10345
335 Ga0207651_10029641 3300025960 Bacteria 3470
336 Ga0207651_10217913 3300025960 Bacteria 1541
337 Ga0207712_10115561 3300025961 Bacteria 2020
338 Ga0207712_10123339 3300025961 Bacteria 1964
339 Ga0207658_10017375 3300025986 Bacteria 4956
340 Ga0207658_10018422 3300025986 Bacteria 4821
341 Ga0207677_10005546 3300026023 Bacteria 6857
342 Ga0207703_10071627 3300026035 Bacteria 2863
343 Ga0207703_10242903 3300026035 Bacteria 1619
344 Ga0207639_10103468 3300026041 Bacteria 2307
345 Ga0207708_10006293 3300026075 Bacteria 8800
346 Ga0207708_10061822 3300026075 Bacteria 2860
347 Ga0207702_10003469 3300026078 Bacteria 14368
348 Ga0207702_10338497 3300026078 Bacteria 1437
349 Ga0207641_10000354 3300026088 Bacteria 54823
350 Ga0207641_10002785 3300026088 Bacteria 15920
351 Ga0207641_10123513 3300026088 Bacteria 2314
352 Ga0207641_10250403 3300026088 Bacteria 1654
353 Ga0207648_10000580 3300026089 Bacteria 41032
354 Ga0207648_10013460 3300026089 Bacteria 7610
355 Ga0207648_10156748 3300026089 Bacteria 2010
356 Ga0207648_10222168 3300026089 Bacteria 1679
357 Ga0207676_10036235 3300026095 Bacteria 3751
358 Ga0207676_10039925 3300026095 Bacteria 3594
359 Ga0207674_10000350 3300026116 Bacteria 59446
360 Ga0207674_10016978 3300026116 Bacteria 7948
361 Ga0207674_10017189 3300026116 Bacteria 7893
362 Ga0207674_10200663 3300026116 Unclassified 1944
363 Ga0207675_100006372 3300026118 Bacteria 11189
364 Ga0207675_100009545 3300026118 Bacteria 9075
365 Ga0207675_100081741 3300026118 Bacteria 3030
366 Ga0207683_10077779 3300026121 Bacteria 2939
367 Ga0207683_10082500 3300026121 Bacteria 2856
368 Ga0209813_10006945 3300027866 Bacteria 2809
369 Ga0207428_10000174 3300027907 Bacteria 89762
370 Ga0207428_10026761 3300027907 Bacteria 4808
371 Ga0268265_10163598 3300028380 Bacteria 1893
372 Ga0268264_10016599 3300028381 Bacteria 6029
373 Ga0268264_10317963 3300028381 Bacteria 1471
374 Ga0265338_10021467 3300028800 Bacteria 6733
375 Ga0307509_10040936 3300031507 Bacteria 5035
376 Ga0265314_10001232 3300031711 Bacteria 29204
377 Ga0265314_10013674 3300031711 Bacteria 6543
378 Ga0307414_10215743 3300032004 Bacteria 1572
379 Ga0307510_10059097 3300033180 Bacteria 3963
380 Ga0373934_0008366 3300035086 Bacteria 3856
381 Ga0373954_0001032 3300035118 Bacteria 11047
382 Ga0373954_0018024 3300035118 Bacteria 3175
383 Ga0373955_0070331 3300035172 Bacteria 1955
384 Ga0373933_0044434 3300035724 Bacteria 2632
385 Ga0373947_0012815 3300035725 Bacteria 4805
386 Ga0373937_0172066 3300036401 Unclassified 2032
387 Ga0373925_0012052 3300037068 Bacteria 6261
388 Ga0373925_0017271 3300037068 Bacteria 5227
389 Ga0436364_0684751 3300037853 Bacteria 3563
390 Ga0436364_1230958 3300037853 Bacteria 11165
391 Ga0436364_1416054 3300037853 Bacteria 38310
392 Ga0436365_1020709 3300039437 Bacteria 3748
393 Ga0436360_1328161 3300039438 Bacteria 1803
394 Ga0436362_1291199 3300039453 Bacteria 1410
395 Ga0439433_0001258 3300041999 Bacteria 5230
396 Ga0466961_0073820 3300044693 Bacteria 2163
397 Ga0466963_0007790 3300044694 Bacteria 6404
398 Ga0466964_0018782 3300044706 Bacteria 2655
399 Ga0451576_0033881 3300045051 Bacteria 5427
400 Ga0466958_0030835 3300045836 Bacteria 3187
401 Ga0466958_0142661 3300045836 Bacteria 1508
402 Ga0466967_0621108 3300045976 Bacteria 1067
403 Ga0495580_0015236 3300046472 Bacteria 5808
404 Ga0495582_0127027 3300046473 Bacteria 1439
405 Ga0495587_0001707 3300046536 Bacteria 14667
406 Ga0495599_0006413 3300046678 Bacteria 7099
407 Ga0495658_0118150 3300046683 Bacteria 1601
408 Ga0495602_0020532 3300048088 Bacteria 6526
409 Ga0496104_0077505 3300048907 Bacteria 3167
410 Ga0496104_0085037 3300048907 Bacteria 3019
411 Ga0496104_0191193 3300048907 Bacteria 1958
412 Ga0496109_0277951 3300048912 Bacteria 1578
413 Ga0496112_0062556 3300048915 Bacteria 3671
414 Ga0496114_0285406 3300048917 Bacteria 1456
415 Ga0496121_0057406 3300048924 Bacteria 3227
416 nmdc:mga00v17_3375_c1 3300050491 Bacteria 8239
417 nmdc:mga00v17_82748_c1 3300050491 Bacteria 2006
418 nmdc:mga0yw44_29578_c1 3300050492 Bacteria 2741
419 nmdc:mga0yw44_47513_c1 3300050492 Bacteria 2584
420 nmdc:mga0k408_6790_c1 3300050493 Bacteria 6103
421 nmdc:mga06z11_2624_c1 3300050494 Bacteria 6887
422 nmdc:mga05p37_48726_c1 3300050507 Bacteria 5210
423 nmdc:mga09592_36322_c1 3300050508 Bacteria 4126
424 nmdc:mga0qj67_225433_c1 3300050509 Bacteria 1521
425 nmdc:mga06r32_139755_c1 3300050510 Bacteria 2397
426 nmdc:mga08y16_2073_c1 3300050511 Bacteria 20553
427 nmdc:mga08y16_27899_c1 3300050511 Bacteria 5952
428 nmdc:mga08y16_35297_c1 3300050511 Bacteria 5251
429 nmdc:mga0n895_14_c1 3300050512 Bacteria 102430
430 nmdc:mga0n895_5204_c1 3300050512 Bacteria 10827
431 nmdc:mga0rr50_100752_c1 3300050513 Bacteria 2269
432 nmdc:mga0rr50_103541_c1 3300050513 Bacteria 2241
433 nmdc:mga0rr50_214_c1 3300050513 Bacteria 31142
434 nmdc:mga08x19_32013_c1 3300050514 Bacteria 3313
435 nmdc:mga08x19_757_c1 3300050514 Bacteria 20617
436 Ga0495619_0196445 3300053085 Bacteria 1397
437 Ga0500595_018917 3300053119 Bacteria 2509
438 Ga0500568_0000476 3300053139 Bacteria 29662
439 Ga0590075_003256 3300059424 Bacteria 3871
440 2558908041 2558860112 Bacteria 9931328
441 2870789364 2870782633 Bacteria 9624083
442 Ga0068858_100162647
443 Ga0070658_10033571
444 Ga0070683_100011565
445 Ga0070683_100017554
446 Ga0070683_100022142
447 Ga0070683_100072017
448 Ga0070683_100080370
449 Ga0070683_100097577
450 Ga0070690_100007501
451 Ga0070670_100002847
452 Ga0068869_100000609
453 Ga0068869_100151026
454 Ga0068869_100226068
455 Ga0070666_10003849
456 Ga0070680_100001194
457 Ga0068868_100005480
458 Ga0068868_100115110
459 Ga0070660_100141234
460 Ga0070689_100043270
461 Ga0070689_100083686
462 Ga0070689_100109583
463 Ga0070691_10002783
464 Ga0070687_100076115
465 Ga0070661_100079003
466 Ga0070669_100019240
467 Ga0070669_100182898
468 Ga0070675_100000267
469 Ga0070675_100000624
470 Ga0070675_100006103
471 Ga0070675_100010406
472 Ga0070671_100008411
473 Ga0070671_100013461
474 Ga0070671_100028262
475 Ga0070674_100035778
476 Ga0070674_100082996
477 Ga0070673_100019425
478 Ga0070673_100104002
479 Ga0070659_100036593
480 Ga0070667_100001967
481 Ga0070667_100035416
482 Ga0070709_10001586
483 Ga0070709_10061821
484 Ga0070709_10212340
485 Ga0070714_100010818
486 Ga0070714_100013701
487 Ga0070714_100017662
488 Ga0070714_100101289
489 Ga0070713_100001750
490 Ga0070713_100006770
491 Ga0070713_100023291
492 Ga0070713_100047077
493 Ga0070713_100068425
494 Ga0070713_100273455
495 Ga0070710_10000207
496 Ga0070711_100052188
497 Ga0070705_100029854
498 Ga0070700_100021086
499 Ga0070700_100040211
500 Ga0070678_100060062
501 Ga0070678_100070187
502 Ga0070662_100022339
503 Ga0070681_10024664
504 Ga0070681_10091058
505 Ga0068867_100012917
506 Ga0068867_100023518
507 Ga0070685_10065240
508 Ga0070706_100064635
509 Ga0070698_100002475
510 Ga0070698_100063243
511 Ga0070699_100029488
512 Ga0070699_100078392
513 Ga0070679_100001453
514 Ga0070679_100196730
515 Ga0070684_100028774
516 Ga0070684_100047124
517 Ga0070697_100001815
518 Ga0070697_100036735
519 Ga0070672_100006660
520 Ga0070672_100029891
521 Ga0070686_100043712
522 Ga0070686_100076972
523 Ga0070696_100059046
524 Ga0068855_100001264
525 Ga0068855_100002190
526 Ga0068855_100009973
527 Ga0068855_100068189
528 Ga0070664_100037303
529 Ga0068857_100000716
530 Ga0068857_100004053
531 Ga0068857_100027548
532 Ga0068856_100000584
533 Ga0068856_100005705
534 Ga0068856_100017485
535 Ga0068852_100018095
536 Ga0068859_100000967
537 Ga0068859_100061678
538 Ga0068859_100088968
539 Ga0068859_100150055
540 Ga0068864_100040981
541 Ga0068864_100052927
542 Ga0068861_100008656
543 Ga0068861_100030933
544 Ga0068851_10006167
545 Ga0068870_10075860
546 Ga0068863_100000478
547 Ga0068863_100002123
548 Ga0068863_100087223
549 Ga0068863_100144944
550 Ga0068863_100243282
551 Ga0068858_100019805
552 Ga0068858_100020930
553 Ga0068858_100033532
554 Ga0068858_100052407
555 Ga0068858_100062094
556 Ga0068860_100001909
557 Ga0068860_100001986
558 Ga0068860_100092057
559 Ga0068862_100059101
560 Ga0068862_100099621
561 Ga0081455_10021611
562 Ga0070717_10000334
563 Ga0070717_10025531
564 Ga0070717_10065636
565 Ga0070717_10102569
566 Ga0070717_10238206
567 Ga0075365_10063326
568 Ga0075365_10114538
569 Ga0075368_10010737
570 Ga0075364_10024393
571 Ga0070715_10029642
572 Ga0070715_10093535
573 Ga0070712_100039601
574 Ga0075362_10031816
575 Ga0075367_10000802
576 Ga0075366_10000178
577 Ga0097621_100013427
578 Ga0097621_100014824
579 Ga0097621_100028682
580 Ga0097621_100038664
581 Ga0097621_100054325
582 Ga0068871_100008395
583 Ga0068871_100022568
584 Ga0068871_100041089
585 Ga0068871_100076522
586 Ga0075428_100034989
587 Ga0075428_100068652
588 Ga0075428_100068817
589 Ga0075428_100103635
590 Ga0075430_100077951
591 Ga0075431_100290173
592 Ga0075433_10104003
593 Ga0075434_100001959
594 Ga0075434_100023917
595 Ga0075434_100129712
596 Ga0068865_100008199
597 Ga0068865_100011040
598 Ga0068865_100013149
599 Ga0068865_100044436
600 Ga0075436_100001309
601 Ga0097620_100000967
602 Ga0097620_100061674
603 Ga0097620_100088967
604 Ga0097620_100150054
605 Ga0075435_100000889
606 Ga0075435_100010123
607 Ga0105240_10004769
608 Ga0105240_10008912
609 Ga0105240_10023870
610 Ga0111539_10002812
611 Ga0111539_10014551
612 Ga0111539_10022728
613 Ga0111539_10073663
614 Ga0111539_10219842
615 Ga0105245_10002670
616 Ga0105245_10004570
617 Ga0105245_10017021
618 Ga0105245_10022023
619 Ga0105247_10004388
620 Ga0105247_10114931
621 Ga0105243_10028917
622 Ga0105243_10079380
623 Ga0105243_10087254
624 Ga0105241_10082348
625 Ga0105242_10005289
626 Ga0105242_10031908
627 Ga0105242_10041934
628 Ga0105242_10065252
629 Ga0105242_10071018
630 Ga0105242_10170978
631 Ga0105242_10225293
632 Ga0105248_10000867
633 Ga0105248_10015144
634 Ga0105248_10019966
635 Ga0105248_10031169
636 Ga0105248_10055098
637 Ga0105248_10409449
638 Ga0105238_10000959
639 Ga0105238_10002785
640 Ga0105238_10004557
641 Ga0105238_10023953
642 Ga0105238_10036128
643 Ga0105249_10011766
644 Ga0105249_10107642
645 Ga0105239_10003048
646 Ga0105239_10004021
647 Ga0105239_10020130
648 Ga0105246_10003902
649 Ga0105246_10037664
650 Ga0157370_10003423
651 Ga0157370_10028274
652 Ga0157370_10037517
653 Ga0157370_10067782
654 Ga0157370_10116604
655 Ga0157369_10002413
656 Ga0157369_10002738
657 Ga0157369_10007110
658 Ga0157369_10210004
659 Ga0157369_10303314
660 Ga0157374_10016316
661 Ga0157374_10030821
662 Ga0157374_10074736
663 Ga0157374_10389540
664 Ga0157378_10002546
665 Ga0163162_10007390
666 Ga0163162_10013628
667 Ga0163162_10046126
668 Ga0157372_10013461
669 Ga0157372_10018473
670 Ga0157372_10072918
671 Ga0157375_10001654
672 Ga0157375_10002401
673 Ga0157375_10008895
674 Ga0157375_10176057
675 Ga0157375_10217141
676 Ga0163163_10008222
677 Ga0163163_10008800
678 Ga0163163_10014119
679 Ga0163163_10033211
680 Ga0163163_10102972
681 Ga0157380_10005896
682 Ga0157380_10018493
683 Ga0157380_10077920
684 Ga0157379_10000223
685 Ga0157379_10002153
686 Ga0157379_10034327
687 Ga0157379_10070200
688 Ga0157379_10086912
689 Ga0157376_10017326
690 Ga0213875_10000023
691 Ga0213875_10006291
692 Ga0207692_10001818
693 Ga0207680_10007137
694 Ga0207680_10150462
695 Ga0207699_10002764
696 Ga0207699_10056122
697 Ga0207699_10117651
698 Ga0207645_10002043
699 Ga0207705_10023146
700 Ga0207684_10003070
701 Ga0207654_10100524
702 Ga0207707_10000224
703 Ga0207707_10039736
704 Ga0207707_10068683
705 Ga0207695_10000533
706 Ga0207695_10004086
707 Ga0207695_10005305
708 Ga0207695_10122522
709 Ga0207671_10041889
710 Ga0207693_10104192
711 Ga0207663_10000751
712 Ga0207663_10157426
713 Ga0207660_10181250
714 Ga0207662_10074166
715 Ga0207657_10029533
716 Ga0207652_10115034
717 Ga0207646_10010592
718 Ga0207646_10148342
719 Ga0207681_10038836
720 Ga0207681_10156484
721 Ga0207694_10000545
722 Ga0207694_10005878
723 Ga0207694_10008721
724 Ga0207694_10017392
725 Ga0207694_10029831
726 Ga0207650_10007581
727 Ga0207659_10000974
728 Ga0207659_10008108
729 Ga0207659_10008542
730 Ga0207687_10015851
731 Ga0207687_10027930
732 Ga0207687_10057996
733 Ga0207687_10058448
734 Ga0207687_10139443
735 Ga0207687_10225372
736 Ga0207700_10004944
737 Ga0207700_10014023
738 Ga0207700_10052702
739 Ga0207664_10002261
740 Ga0207664_10005105
741 Ga0207664_10057826
742 Ga0207664_10079882
743 Ga0207644_10009516
744 Ga0207644_10011483
745 Ga0207706_10021517
746 Ga0207686_10003205
747 Ga0207686_10003527
748 Ga0207686_10132866
749 Ga0207709_10019817
750 Ga0207669_10028126
751 Ga0207669_10143267
752 Ga0207704_10055158
753 Ga0207704_10102760
754 Ga0207691_10009702
755 Ga0207691_10032058
756 Ga0207691_10035627
757 Ga0207711_10001844
758 Ga0207711_10006402
759 Ga0207711_10012990
760 Ga0207711_10103006
761 Ga0207711_10119846
762 Ga0207711_10163752
763 Ga0207689_10002483
764 Ga0207689_10021481
765 Ga0207689_10041582
766 Ga0207689_10110816
767 Ga0207661_10066300
768 Ga0207661_10094996
769 Ga0207679_10030501
770 Ga0207679_10069811
771 Ga0207667_10000322
772 Ga0207667_10016994
773 Ga0207667_10027512
774 Ga0207667_10103612
775 Ga0207651_10001607
776 Ga0207651_10029641
777 Ga0207651_10217913
778 Ga0207712_10115561
779 Ga0207712_10123339
780 Ga0207658_10017375
781 Ga0207658_10018422
782 Ga0207677_10005546
783 Ga0207703_10071627
784 Ga0207703_10242903
785 Ga0207639_10103468
786 Ga0207708_10006293
787 Ga0207708_10061822
788 Ga0207702_10003469
789 Ga0207702_10338497
790 Ga0207641_10000354
791 Ga0207641_10002785
792 Ga0207641_10123513
793 Ga0207641_10250403
794 Ga0207648_10000580
795 Ga0207648_10013460
796 Ga0207648_10156748
797 Ga0207648_10222168
798 Ga0207676_10036235
799 Ga0207676_10039925
800 Ga0207674_10000350
801 Ga0207674_10016978
802 Ga0207674_10017189
803 Ga0207674_10200663
804 Ga0207675_100006372
805 Ga0207675_100009545
806 Ga0207675_100081741
807 Ga0207683_10077779
808 Ga0207683_10082500
809 Ga0209813_10006945
810 Ga0207428_10000174
811 Ga0207428_10026761
812 Ga0268265_10163598
813 Ga0268264_10016599
814 Ga0268264_10317963
815 Ga0265338_10021467
816 Ga0307509_10040936
817 Ga0265314_10001232
818 Ga0265314_10013674
819 Ga0307414_10215743
820 Ga0307510_10059097
821 Ga0373934_0008366
822 Ga0373954_0001032
823 Ga0373954_0018024
824 Ga0373955_0070331
825 Ga0373933_0044434
826 Ga0373947_0012815
827 Ga0373937_0172066
828 Ga0373925_0012052
829 Ga0373925_0017271
830 Ga0436364_0684751
831 Ga0436364_1230958
832 Ga0436364_1416054
833 Ga0436365_1020709
834 Ga0436360_1328161
835 Ga0436362_1291199
836 Ga0439433_0001258
837 Ga0466961_0073820
838 Ga0466963_0007790
839 Ga0466964_0018782
840 Ga0451576_0033881
841 Ga0466958_0030835
842 Ga0466958_0142661
843 Ga0466967_0621108
844 Ga0495580_0015236
845 Ga0495582_0127027
846 Ga0495587_0001707
847 Ga0495599_0006413
848 Ga0495658_0118150
849 Ga0495602_0020532
850 Ga0496104_0077505
851 Ga0496104_0085037
852 Ga0496104_0191193
853 Ga0496109_0277951
854 Ga0496112_0062556
855 Ga0496114_0285406
856 Ga0496121_0057406
857 nmdc:mga00v17_3375_c1
858 nmdc:mga00v17_82748_c1
859 nmdc:mga0yw44_29578_c1
860 nmdc:mga0yw44_47513_c1
861 nmdc:mga0k408_6790_c1
862 nmdc:mga06z11_2624_c1
863 nmdc:mga05p37_48726_c1
864 nmdc:mga09592_36322_c1
865 nmdc:mga0qj67_225433_c1
866 nmdc:mga06r32_139755_c1
867 nmdc:mga08y16_2073_c1
868 nmdc:mga08y16_27899_c1
869 nmdc:mga08y16_35297_c1
870 nmdc:mga0n895_14_c1
871 nmdc:mga0n895_5204_c1
872 nmdc:mga0rr50_100752_c1
873 nmdc:mga0rr50_103541_c1
874 nmdc:mga0rr50_214_c1
875 nmdc:mga08x19_32013_c1
876 nmdc:mga08x19_757_c1
877 Ga0495619_0196445
878 Ga0500595_018917
879 Ga0500568_0000476
880 Ga0590075_003256
881 2558908041
882 2870789364

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00144

Beta-lactamase

Beta-lactamase

80

450

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hld-assembly1.cif.gz_A simvastatin synthase (lovd), from aspergillus terreus, s5 mutant complex with monacolin j acid 0.8613 26 406
3hle-assembly1.cif.gz_A simvastatin synthase (lovd), from aspergillus terreus, s5 mutant, s76a mutant, complex with monacolin j acid 0.8584 26 403
4lcl-assembly2.cif.gz_B simvastatin synthase (lovd), from aspergillus terreus, lovd6 mutant (simh6208) 0.8566 29 405
4lcl-assembly1.cif.gz_A simvastatin synthase (lovd), from aspergillus terreus, lovd6 mutant (simh6208) 0.8553 28 405
4e6x-assembly3.cif.gz_C clbp in complex boron-based inhibitor 0.8552 34 401
ID Description Score Start End Superfamily
af_A0A1D8PKX8_25_403_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8549 40 398 3.40.710.10
4p6bB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8388 34 404 3.40.710.10
af_P9WLZ3_5_376_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8259 37 394 3.40.710.10
3hl9C00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8182 28 403 3.40.710.10
3i7jB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8138 38 405 3.40.710.10
ID Description Score Start End GO Terms
AF-A0A2N9MQR0-F1-model_v4 Beta-lactamase 0.9645 30 405
AF-A0A2V6X1X4-F1-model_v4 1,4-butanediol diacrylate esterase 0.9548 142 404
AF-A0A192IH52-F1-model_v4 deleted 0.951 34 406
AF-A1WLG3-F1-model_v4 Beta-lactamase 0.9483 32 403
AF-A0A1I3MFY0-F1-model_v4 CubicO group peptidase, beta-lactamase class C family 0.9438 34 406

Map