F444590

General Info

Members Datasets Scaffolds Average Seq Length
441 165 882 205

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100249510|Ga0070660_1002495102
Length 221
Sequence LVSLGRVSLAGVWKWFIGPVLMGTGCVAGSVYGRDAEQVVHKSPDDAYSALEQAIDGVPESGMTSFEGGTPIAYQTKVDRLAGQQLVVTLFFDGREGARARFDFTPQDGGDATLVALRVHGDGAVLSQVLAGTKNERLAYAPDWLLNLAARPVLAQVAGEIDRGEIAKFTGPTSEGEAQAQWEQNLSDQQRNDVEAWREYDATRPTTDPDAAAANQTGNPS

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
142 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
143 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
148 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
157 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.27
Rhizosphere 97.28
Stem 0
Stem Tuber 0
Unclassified 12.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100249510 3300005339 Unclassified 1447
2 JGI24740J21852_10026805 3300001979 Bacteria 1926
3 JGI24737J22298_10004502 3300001990 Bacteria 4853
4 JGI24737J22298_10007107 3300001990 Bacteria 3793
5 JGI24737J22298_10013985 3300001990 Bacteria 2608
6 JGI24735J21928_10008304 3300002067 Bacteria 3362
7 Ga0070658_10091270 3300005327 Bacteria 2510
8 Ga0070658_10155077 3300005327 Bacteria 1919
9 Ga0070658_10394560 3300005327 Bacteria 1188
10 Ga0070658_10695855 3300005327 Bacteria 882
11 Ga0070676_10169768 3300005328 Bacteria 1410
12 Ga0070683_100013808 3300005329 Bacteria 7052
13 Ga0070683_100100679 3300005329 Bacteria 2720
14 Ga0070683_100167796 3300005329 Bacteria 2083
15 Ga0070683_100238460 3300005329 Bacteria 1729
16 Ga0070670_100024976 3300005331 Bacteria 5141
17 Ga0070670_100049678 3300005331 Bacteria 3606
18 Ga0070670_100085075 3300005331 Bacteria 2717
19 Ga0070670_100168177 3300005331 Unclassified 1901
20 Ga0068869_100102159 3300005334 Bacteria 2170
21 Ga0070666_10004062 3300005335 Bacteria 8883
22 Ga0070666_10073626 3300005335 Bacteria 2327
23 Ga0070680_100013994 3300005336 Bacteria 6262
24 Ga0070680_100022046 3300005336 Bacteria 5067
25 Ga0070680_100036089 3300005336 Bacteria 3993
26 Ga0070680_100093467 3300005336 Bacteria 2492
27 Ga0070680_100094239 3300005336 Bacteria 2481
28 Ga0070680_100109095 3300005336 Bacteria 2303
29 Ga0070680_100167225 3300005336 Unclassified 1849
30 Ga0070680_100475735 3300005336 Unclassified 1068
31 Ga0070682_100023631 3300005337 Bacteria 3651
32 Ga0070682_100584012 3300005337 Bacteria 879
33 Ga0068868_100243584 3300005338 Unclassified 1511
34 Ga0070660_100013931 3300005339 Bacteria 5786
35 Ga0070660_100058561 3300005339 Bacteria 2986
36 Ga0070660_100112482 3300005339 Bacteria 2167
37 Ga0070660_100182941 3300005339 Bacteria 1696
38 Ga0070660_100214086 3300005339 Bacteria 1565
39 Ga0070660_100264574 3300005339 Bacteria 1405
40 Ga0070660_100675426 3300005339 Unclassified 865
41 Ga0070691_10028519 3300005341 Bacteria 2609
42 Ga0070661_100020670 3300005344 Bacteria 4695
43 Ga0070661_100039315 3300005344 Bacteria 3447
44 Ga0070661_100125096 3300005344 Bacteria 1928
45 Ga0070661_100324756 3300005344 Bacteria 1202
46 Ga0070661_100377418 3300005344 Bacteria 1117
47 Ga0070692_10114868 3300005345 Bacteria 1494
48 Ga0070675_100240375 3300005354 Bacteria 1582
49 Ga0070671_100066796 3300005355 Plasmid 2997
50 Ga0070671_100201212 3300005355 Bacteria 1689
51 Ga0070671_100425942 3300005355 Unclassified 1137
52 Ga0070673_100005129 3300005364 Bacteria 8352
53 Ga0070673_100198004 3300005364 Bacteria 1729
54 Ga0070659_100006892 3300005366 Bacteria 8228
55 Ga0070659_100011798 3300005366 Bacteria 6468
56 Ga0070659_100031334 3300005366 Bacteria 4118
57 Ga0070659_100069326 3300005366 Bacteria 2799
58 Ga0070659_100403958 3300005366 Unclassified 1154
59 Ga0070659_100438483 3300005366 Bacteria 1106
60 Ga0070659_100796735 3300005366 Unclassified 821
61 Ga0070659_100856438 3300005366 Bacteria 792
62 Ga0070667_100022261 3300005367 Bacteria 5258
63 Ga0070667_100194895 3300005367 Bacteria 1796
64 Ga0070667_100754063 3300005367 Bacteria 902
65 Ga0070714_100025467 3300005435 Bacteria 4882
66 Ga0070714_100175103 3300005435 Bacteria 1949
67 Ga0070713_100039654 3300005436 Bacteria 3824
68 Ga0070713_100514255 3300005436 Bacteria 1131
69 Ga0070694_100039101 3300005444 Bacteria 3156
70 Ga0070663_100007911 3300005455 Bacteria 6508
71 Ga0070663_100078999 3300005455 Bacteria 2413
72 Ga0070663_100080255 3300005455 Bacteria 2396
73 Ga0070662_100021453 3300005457 Bacteria 4410
74 Ga0070662_100063135 3300005457 Bacteria 2709
75 Ga0070662_100064693 3300005457 Bacteria 2679
76 Ga0070662_100105579 3300005457 Bacteria 2138
77 Ga0070662_100114121 3300005457 Unclassified 2062
78 Ga0070662_100176556 3300005457 Bacteria 1681
79 Ga0070662_100244261 3300005457 Bacteria 1441
80 Ga0070681_10064906 3300005458 Unclassified 3621
81 Ga0070681_10420932 3300005458 Bacteria 1248
82 Ga0068867_100092779 3300005459 Bacteria 2293
83 Ga0068867_100287028 3300005459 Unclassified 1351
84 Ga0070679_100027952 3300005530 Bacteria 5557
85 Ga0070679_100098642 3300005530 Plasmid 2909
86 Ga0070679_100146890 3300005530 Bacteria 2335
87 Ga0070679_100252517 3300005530 Bacteria 1719
88 Ga0070684_100100556 3300005535 Bacteria 2582
89 Ga0070684_100425903 3300005535 Bacteria 1225
90 Ga0068853_100113195 3300005539 Bacteria 2412
91 Ga0068853_100295213 3300005539 Bacteria 1497
92 Ga0070672_100025209 3300005543 Bacteria 4408
93 Ga0070672_100079261 3300005543 Bacteria 2629
94 Ga0070686_100676278 3300005544 Unclassified 821
95 Ga0070696_100007522 3300005546 Bacteria 7285
96 Ga0070665_100042613 3300005548 Bacteria 4562
97 Ga0070665_100635099 3300005548 Bacteria 1081
98 Ga0070704_100168490 3300005549 Bacteria 1739
99 Ga0068855_100034983 3300005563 Bacteria 5986
100 Ga0068855_100050178 3300005563 Bacteria 4918
101 Ga0068855_100097808 3300005563 Bacteria 3381
102 Ga0068855_100113619 3300005563 Bacteria 3106
103 Ga0068855_100942667 3300005563 Bacteria 910
104 Ga0068855_100988946 3300005563 Unclassified 884
105 Ga0070664_100016939 3300005564 Bacteria 5980
106 Ga0070664_100021471 3300005564 Bacteria 5321
107 Ga0070664_100027286 3300005564 Bacteria 4744
108 Ga0070664_100275887 3300005564 Bacteria 1515
109 Ga0070664_100558476 3300005564 Bacteria 1059
110 Ga0068857_100034561 3300005577 Bacteria 4471
111 Ga0068857_100064967 3300005577 Bacteria 3244
112 Ga0068857_100568770 3300005577 Bacteria 1069
113 Ga0068854_100005066 3300005578 Bacteria 8298
114 Ga0068854_100009788 3300005578 Bacteria 6197
115 Ga0068854_100102370 3300005578 Bacteria 2149
116 Ga0068854_100150235 3300005578 Bacteria 1795
117 Ga0068856_100010945 3300005614 Bacteria 8803
118 Ga0068856_100029881 3300005614 Bacteria 5325
119 Ga0068856_100155899 3300005614 Bacteria 2293
120 Ga0068856_100159946 3300005614 Bacteria 2262
121 Ga0068856_100314206 3300005614 Bacteria 1584
122 Ga0068852_100006338 3300005616 Bacteria 8537
123 Ga0068852_100030646 3300005616 Bacteria 4431
124 Ga0068852_100066434 3300005616 Bacteria 3149
125 Ga0068852_100118712 3300005616 Bacteria 2417
126 Ga0068852_100132562 3300005616 Unclassified 2296
127 Ga0068852_100287983 3300005616 Bacteria 1586
128 Ga0068852_100980773 3300005616 Unclassified 863
129 Ga0068859_100046625 3300005617 Bacteria 4352
130 Ga0068859_100444300 3300005617 Unclassified 1393
131 Ga0068864_100020080 3300005618 Bacteria 5587
132 Ga0068864_100020434 3300005618 Bacteria 5540
133 Ga0068864_100032745 3300005618 Bacteria 4418
134 Ga0068864_100669754 3300005618 Unclassified 1011
135 Ga0068864_100972842 3300005618 Bacteria 841
136 Ga0068861_100030219 3300005719 Bacteria 3969
137 Ga0068851_10005693 3300005834 Bacteria 5664
138 Ga0068863_100016179 3300005841 Bacteria 7155
139 Ga0068858_100005623 3300005842 Bacteria 12258
140 Ga0068858_100013367 3300005842 Bacteria 7745
141 Ga0068858_100243638 3300005842 Unclassified 1706
142 Ga0068858_100287904 3300005842 Unclassified 1565
143 Ga0068860_100035395 3300005843 Bacteria 4789
144 Ga0068860_100052989 3300005843 Bacteria 3858
145 Ga0068862_100288393 3300005844 Bacteria 1506
146 Ga0068862_101326706 3300005844 Unclassified 721
147 Ga0097621_100004661 3300006237 Bacteria 9575
148 Ga0097621_100245334 3300006237 Bacteria 1567
149 Ga0097621_100372649 3300006237 Bacteria 1274
150 Ga0068871_100321381 3300006358 Unclassified 1363
151 Ga0097620_100046625 3300006931 Bacteria 4352
152 Ga0097620_100444322 3300006931 Unclassified 1393
153 Ga0105240_10100882 3300009093 Bacteria 3512
154 Ga0105240_10171686 3300009093 Bacteria 2568
155 Ga0105240_10581720 3300009093 Bacteria 1235
156 Ga0105245_10565248 3300009098 Bacteria 1160
157 Ga0105243_10235068 3300009148 Bacteria 1628
158 Ga0105241_10050772 3300009174 Bacteria 3161
159 Ga0105241_10150120 3300009174 Bacteria 1906
160 Ga0105242_10156470 3300009176 Bacteria 1991
161 Ga0105242_10324992 3300009176 Unclassified 1412
162 Ga0105248_10094013 3300009177 Bacteria 3376
163 Ga0105248_10195641 3300009177 Bacteria 2278
164 Ga0105248_10253942 3300009177 Bacteria 1979
165 Ga0105237_10252886 3300009545 Bacteria 1764
166 Ga0105238_10025695 3300009551 Bacteria 6004
167 Ga0105238_10371809 3300009551 Bacteria 1420
168 Ga0105249_10098239 3300009553 Bacteria 2749
169 Ga0105239_10020378 3300010375 Bacteria 7315
170 Ga0105246_10166097 3300011119 Bacteria 1686
171 Ga0157373_10025448 3300013100 Bacteria 4280
172 Ga0157373_10036470 3300013100 Bacteria 3529
173 Ga0157373_10113018 3300013100 Unclassified 1908
174 Ga0157373_10178804 3300013100 Bacteria 1493
175 Ga0157371_10103687 3300013102 Bacteria 2018
176 Ga0157371_10129303 3300013102 Bacteria 1796
177 Ga0157371_10169176 3300013102 Bacteria 1561
178 Ga0157371_10215838 3300013102 Unclassified 1377
179 Ga0157371_10385997 3300013102 Unclassified 1023
180 Ga0157370_10244740 3300013104 Bacteria 1659
181 Ga0157370_10257470 3300013104 Unclassified 1613
182 Ga0157369_10024730 3300013105 Bacteria 6675
183 Ga0157369_10164324 3300013105 Bacteria 2342
184 Ga0157369_10283050 3300013105 Bacteria 1727
185 Ga0157374_10007336 3300013296 Bacteria 9403
186 Ga0157378_10108897 3300013297 Bacteria 2537
187 Ga0157378_10455007 3300013297 Unclassified 1271
188 Ga0163162_10013120 3300013306 Bacteria 8090
189 Ga0163162_10106141 3300013306 Bacteria 2904
190 Ga0163162_10396613 3300013306 Unclassified 1512
191 Ga0157372_10103845 3300013307 Bacteria 3248
192 Ga0157372_10735120 3300013307 Bacteria 1147
193 Ga0157375_10218285 3300013308 Bacteria 2065
194 Ga0157375_10722190 3300013308 Bacteria 1149
195 Ga0163163_10009210 3300014325 Bacteria 8803
196 Ga0163161_10194994 3300017792 Bacteria 1558
197 Ga0206354_10657800 3300020081 Bacteria 1162
198 Ga0206353_10167362 3300020082 Unclassified 1059
199 Ga0213876_10053976 3300021384 Bacteria 2122
200 Ga0207697_10127215 3300025315 Bacteria 1099
201 Ga0207680_10023610 3300025903 Bacteria 3361
202 Ga0207647_10004840 3300025904 Bacteria 9958
203 Ga0207647_10018720 3300025904 Bacteria 4675
204 Ga0207647_10106501 3300025904 Bacteria 1660
205 Ga0207647_10222429 3300025904 Unclassified 1088
206 Ga0207645_10026351 3300025907 Bacteria 3758
207 Ga0207705_10009108 3300025909 Bacteria 7235
208 Ga0207705_10021414 3300025909 Bacteria 4613
209 Ga0207705_10093512 3300025909 Bacteria 2204
210 Ga0207707_10072301 3300025912 Bacteria 3006
211 Ga0207671_10046239 3300025914 Bacteria 3220
212 Ga0207693_10143871 3300025915 Bacteria 1875
213 Ga0207660_10003350 3300025917 Bacteria 10452
214 Ga0207660_10024694 3300025917 Bacteria 4072
215 Ga0207660_10037264 3300025917 Bacteria 3387
216 Ga0207660_10083757 3300025917 Bacteria 2349
217 Ga0207660_10202010 3300025917 Bacteria 1553
218 Ga0207660_10406997 3300025917 Bacteria 1096
219 Ga0207660_10448214 3300025917 Unclassified 1043
220 Ga0207662_10090131 3300025918 Unclassified 1885
221 Ga0207657_10003819 3300025919 Bacteria 16001
222 Ga0207657_10044861 3300025919 Bacteria 3884
223 Ga0207657_10050324 3300025919 Bacteria 3626
224 Ga0207657_10051468 3300025919 Bacteria 3580
225 Ga0207657_10060628 3300025919 Bacteria 3246
226 Ga0207657_10085176 3300025919 Bacteria 2648
227 Ga0207657_10252310 3300025919 Bacteria 1406
228 Ga0207649_10007331 3300025920 Bacteria 6002
229 Ga0207649_10117555 3300025920 Bacteria 1787
230 Ga0207649_10216277 3300025920 Bacteria 1362
231 Ga0207652_10029434 3300025921 Bacteria 4592
232 Ga0207652_10107135 3300025921 Bacteria 2475
233 Ga0207652_10805144 3300025921 Bacteria 834
234 Ga0207694_10012194 3300025924 Bacteria 6483
235 Ga0207650_10014138 3300025925 Bacteria 5544
236 Ga0207650_10024751 3300025925 Bacteria 4272
237 Ga0207687_10105882 3300025927 Bacteria 2078
238 Ga0207700_10344004 3300025928 Bacteria 1297
239 Ga0207664_10029890 3300025929 Bacteria 4155
240 Ga0207664_10680390 3300025929 Bacteria 925
241 Ga0207644_10005433 3300025931 Bacteria 8308
242 Ga0207644_10153325 3300025931 Unclassified 1785
243 Ga0207644_10167050 3300025931 Bacteria 1715
244 Ga0207690_10007952 3300025932 Bacteria 6296
245 Ga0207690_10031576 3300025932 Bacteria 3391
246 Ga0207690_10048435 3300025932 Bacteria 2826
247 Ga0207690_10088786 3300025932 Bacteria 2178
248 Ga0207706_10002847 3300025933 Bacteria 16784
249 Ga0207706_10007131 3300025933 Bacteria 10345
250 Ga0207706_10039491 3300025933 Bacteria 4185
251 Ga0207706_10051504 3300025933 Bacteria 3635
252 Ga0207706_10057375 3300025933 Bacteria 3430
253 Ga0207706_10133761 3300025933 Bacteria 2181
254 Ga0207669_10299362 3300025937 Bacteria 1222
255 Ga0207704_10322991 3300025938 Bacteria 1191
256 Ga0207665_10198534 3300025939 Bacteria 1461
257 Ga0207691_10006011 3300025940 Bacteria 11720
258 Ga0207691_10009611 3300025940 Bacteria 9279
259 Ga0207691_10034669 3300025940 Bacteria 4692
260 Ga0207711_10093091 3300025941 Bacteria 2654
261 Ga0207689_10031800 3300025942 Bacteria 4389
262 Ga0207689_10033359 3300025942 Bacteria 4279
263 Ga0207661_10036271 3300025944 Bacteria 3847
264 Ga0207661_10375614 3300025944 Unclassified 1286
265 Ga0207661_10878125 3300025944 Unclassified 826
266 Ga0207679_10012681 3300025945 Bacteria 5501
267 Ga0207679_10063958 3300025945 Unclassified 2748
268 Ga0207679_10084073 3300025945 Bacteria 2441
269 Ga0207679_10111490 3300025945 Bacteria 2160
270 Ga0207667_10010963 3300025949 Bacteria 10564
271 Ga0207667_10017517 3300025949 Bacteria 8060
272 Ga0207667_10053377 3300025949 Bacteria 4253
273 Ga0207667_10085771 3300025949 Plasmid 3259
274 Ga0207667_10121790 3300025949 Bacteria 2688
275 Ga0207667_10133574 3300025949 Bacteria 2556
276 Ga0207651_10018140 3300025960 Bacteria 4180
277 Ga0207651_10042787 3300025960 Bacteria 3017
278 Ga0207712_10003201 3300025961 Bacteria 10410
279 Ga0207668_10028459 3300025972 Bacteria 3654
280 Ga0207640_10002017 3300025981 Bacteria 10966
281 Ga0207640_10008538 3300025981 Bacteria 5690
282 Ga0207640_10013162 3300025981 Bacteria 4733
283 Ga0207640_10071714 3300025981 Bacteria 2334
284 Ga0207640_10142856 3300025981 Unclassified 1747
285 Ga0207640_10830087 3300025981 Bacteria 803
286 Ga0207658_10104113 3300025986 Bacteria 2229
287 Ga0207658_10182968 3300025986 Bacteria 1736
288 Ga0207658_10627669 3300025986 Bacteria 967
289 Ga0207658_10739952 3300025986 Bacteria 890
290 Ga0207703_10004789 3300026035 Bacteria 11027
291 Ga0207703_10019621 3300026035 Bacteria 5283
292 Ga0207703_10367455 3300026035 Unclassified 1328
293 Ga0207703_10582493 3300026035 Bacteria 1057
294 Ga0207639_10100781 3300026041 Bacteria 2333
295 Ga0207639_10117830 3300026041 Bacteria 2176
296 Ga0207639_10149478 3300026041 Bacteria 1955
297 Ga0207678_10011359 3300026067 Bacteria 7817
298 Ga0207678_10027487 3300026067 Bacteria 4964
299 Ga0207678_10066583 3300026067 Bacteria 3093
300 Ga0207678_10243901 3300026067 Bacteria 1539
301 Ga0207708_10088694 3300026075 Bacteria 2383
302 Ga0207702_10078539 3300026078 Bacteria 2858
303 Ga0207702_10091247 3300026078 Bacteria 2667
304 Ga0207702_10373422 3300026078 Bacteria 1370
305 Ga0207702_10437585 3300026078 Bacteria 1267
306 Ga0207641_10129390 3300026088 Bacteria 2265
307 Ga0207648_10126522 3300026089 Bacteria 2248
308 Ga0207648_10652313 3300026089 Bacteria 973
309 Ga0207676_10008383 3300026095 Bacteria 7346
310 Ga0207676_10024312 3300026095 Bacteria 4481
311 Ga0207676_10086825 3300026095 Bacteria 2557
312 Ga0207676_10763807 3300026095 Bacteria 941
313 Ga0207674_10001920 3300026116 Bacteria 26379
314 Ga0207674_10020252 3300026116 Bacteria 7191
315 Ga0207674_10034980 3300026116 Bacteria 5246
316 Ga0207674_10110020 3300026116 Bacteria 2731
317 Ga0207674_10133395 3300026116 Bacteria 2446
318 Ga0207674_10624683 3300026116 Unclassified 1040
319 Ga0207675_100104308 3300026118 Bacteria 2672
320 Ga0207675_101049905 3300026118 Bacteria 834
321 Ga0207683_10030520 3300026121 Bacteria 4670
322 Ga0207683_10081213 3300026121 Bacteria 2877
323 Ga0207683_10174497 3300026121 Bacteria 1948
324 Ga0207698_10000912 3300026142 Bacteria 17183
325 Ga0207698_10005178 3300026142 Bacteria 8016
326 Ga0207698_10116884 3300026142 Unclassified 2249
327 Ga0207698_10724049 3300026142 Bacteria 992
328 Ga0268265_10026768 3300028380 Bacteria 4105
329 Ga0268265_10123133 3300028380 Bacteria 2140
330 Ga0268264_10001602 3300028381 Bacteria 20938
331 Ga0268264_10345869 3300028381 Unclassified 1414
332 Ga0307410_10048347 3300031852 Bacteria 2848
333 Ga0307407_10052807 3300031903 Bacteria 2336
334 Ga0307409_100078503 3300031995 Bacteria 2656
335 Ga0307414_10307420 3300032004 Bacteria 1344
336 Ga0307415_100354214 3300032126 Bacteria 1237
337 Ga0373935_0017341 3300035692 Bacteria 4367
338 Ga0373935_0477127 3300035692 Bacteria 903
339 Ga0373927_0338739 3300035695 Bacteria 991
340 Ga0395899_0000372 3300037312 Bacteria 53863
341 Ga0395899_0001367 3300037312 Bacteria 20909
342 Ga0395899_0008520 3300037312 Bacteria 7897
343 Ga0395899_0025286 3300037312 Bacteria 4482
344 Ga0395899_0032108 3300037312 Bacteria 3944
345 Ga0395899_0059754 3300037312 Plasmid 2810
346 Ga0395899_0088519 3300037312 Bacteria 2246
347 Ga0395899_0133732 3300037312 Bacteria 1769
348 Ga0395899_0165478 3300037312 Bacteria 1560
349 Ga0395899_0212803 3300037312 Bacteria 1342
350 Ga0395899_0397863 3300037312 Bacteria 912
351 Ga0395900_0000240 3300037418 Bacteria 86222
352 Ga0395900_0004328 3300037418 Bacteria 15058
353 Ga0395900_0011113 3300037418 Bacteria 9203
354 Ga0395900_0058765 3300037418 Bacteria 3958
355 Ga0395900_0075158 3300037418 Bacteria 3473
356 Ga0395900_0180680 3300037418 Bacteria 2144
357 Ga0395900_0280420 3300037418 Bacteria 1658
358 Ga0395900_0289849 3300037418 Bacteria 1626
359 Ga0395900_0936173 3300037418 Unclassified 788
360 Ga0395898_0000619 3300037466 Bacteria 65174
361 Ga0395898_0044126 3300037466 Bacteria 4391
362 Ga0395898_0050181 3300037466 Bacteria 4084
363 Ga0395898_0068188 3300037466 Bacteria 3442
364 Ga0395898_0156324 3300037466 Bacteria 2181
365 Ga0395898_0244778 3300037466 Bacteria 1710
366 Ga0395898_0388167 3300037466 Bacteria 1331
367 Ga0395898_0803781 3300037466 Bacteria 881
368 Ga0395905_0000219 3300037471 Bacteria 87705
369 Ga0395905_0001380 3300037471 Bacteria 29411
370 Ga0395905_0011196 3300037471 Bacteria 8673
371 Ga0395905_0013673 3300037471 Bacteria 7774
372 Ga0395905_0019340 3300037471 Bacteria 6457
373 Ga0395905_0022124 3300037471 Bacteria 6015
374 Ga0395905_0045123 3300037471 Bacteria 4134
375 Ga0395905_0080184 3300037471 Bacteria 3059
376 Ga0395905_0082801 3300037471 Bacteria 3006
377 Ga0395905_0131729 3300037471 Bacteria 2351
378 Ga0395905_0155073 3300037471 Bacteria 2154
379 Ga0395905_0169616 3300037471 Unclassified 2050
380 Ga0395905_0451398 3300037471 Bacteria 1183
381 Ga0395905_0936143 3300037471 Unclassified 769
382 Ga0395901_0001287 3300038443 Bacteria 26539
383 Ga0395901_0047023 3300038443 Bacteria 4482
384 Ga0395901_0051129 3300038443 Bacteria 4295
385 Ga0395901_0083435 3300038443 Bacteria 3340
386 Ga0395901_0085477 3300038443 Bacteria 3298
387 Ga0395901_0093771 3300038443 Bacteria 3144
388 Ga0395901_0152773 3300038443 Bacteria 2425
389 Ga0395901_0158501 3300038443 Bacteria 2377
390 Ga0395901_0246499 3300038443 Unclassified 1862
391 Ga0395901_0294504 3300038443 Bacteria 1683
392 Ga0395901_0721983 3300038443 Bacteria 992
393 Ga0395901_0733900 3300038443 Unclassified 982
394 Ga0395901_0785936 3300038443 Unclassified 942
395 Ga0436365_1850486 3300039437 Bacteria 4159
396 Ga0439448_0011869 3300042005 Bacteria 2599
397 Ga0466969_0188711 3300044656 Bacteria 942
398 Ga0466972_0055091 3300044658 Bacteria 1913
399 Ga0466972_0083933 3300044658 Bacteria 1515
400 Ga0466966_0113252 3300044684 Bacteria 1671
401 Ga0466966_0209864 3300044684 Bacteria 1177
402 Ga0466966_0225014 3300044684 Bacteria 1132
403 Ga0466961_0119461 3300044693 Bacteria 1655
404 Ga0466961_0211286 3300044693 Bacteria 1198
405 Ga0466963_0013286 3300044694 Bacteria 5054
406 Ga0466963_0030934 3300044694 Bacteria 3457
407 Ga0466963_0094384 3300044694 Bacteria 2040
408 Ga0466963_0510761 3300044694 Bacteria 848
409 Ga0466964_0243644 3300044706 Bacteria 883
410 Ga0466971_0046605 3300044719 Bacteria 1948
411 Ga0466970_0046923 3300044765 Unclassified 2301
412 Ga0466957_0005123 3300044842 Bacteria 7323
413 Ga0466957_0141434 3300044842 Bacteria 1550
414 Ga0466959_0056272 3300045049 Bacteria 2870
415 Ga0466959_0058443 3300045049 Bacteria 2809
416 Ga0466959_0257559 3300045049 Bacteria 1202
417 Ga0466959_0482197 3300045049 Bacteria 839
418 Ga0466958_0012333 3300045836 Bacteria 4840
419 Ga0466958_0091060 3300045836 Bacteria 1887
420 Ga0466958_0205072 3300045836 Bacteria 1255
421 Ga0466967_0007070 3300045976 Bacteria 8041
422 Ga0466967_0314378 3300045976 Bacteria 1509
423 Ga0466967_0491469 3300045976 Bacteria 1203
424 Ga0495663_0112115 3300046525 Bacteria 907
425 Ga0495669_0007614 3300046684 Bacteria 4544
426 Ga0495687_102783 3300047443 Bacteria 1068
427 Ga0495677_0032408 3300047445 Bacteria 1903
428 Ga0496100_0221699 3300048903 Unclassified 1388
429 Ga0496108_0016159 3300048911 Bacteria 6085
430 Ga0496109_0004784 3300048912 Bacteria 11303
431 Ga0496109_0264640 3300048912 Bacteria 1620
432 Ga0496111_0008331 3300048914 Bacteria 6853
433 Ga0496112_0030996 3300048915 Bacteria 5181
434 Ga0496112_0219905 3300048915 Bacteria 1855
435 Ga0496113_0021042 3300048916 Bacteria 4597
436 Ga0496113_0035306 3300048916 Bacteria 3655
437 Ga0496115_0002782 3300048918 Bacteria 12576
438 Ga0466962_0042719 3300061719 Bacteria 2170
439 Ga0466962_0074876 3300061719 Unclassified 1618
440 Ga0466962_0151793 3300061719 Bacteria 1124
441 Ga0466962_0248587 3300061719 Unclassified 874
442 Ga0070660_100249510
443 JGI24740J21852_10026805
444 JGI24737J22298_10004502
445 JGI24737J22298_10007107
446 JGI24737J22298_10013985
447 JGI24735J21928_10008304
448 Ga0070658_10091270
449 Ga0070658_10155077
450 Ga0070658_10394560
451 Ga0070658_10695855
452 Ga0070676_10169768
453 Ga0070683_100013808
454 Ga0070683_100100679
455 Ga0070683_100167796
456 Ga0070683_100238460
457 Ga0070670_100024976
458 Ga0070670_100049678
459 Ga0070670_100085075
460 Ga0070670_100168177
461 Ga0068869_100102159
462 Ga0070666_10004062
463 Ga0070666_10073626
464 Ga0070680_100013994
465 Ga0070680_100022046
466 Ga0070680_100036089
467 Ga0070680_100093467
468 Ga0070680_100094239
469 Ga0070680_100109095
470 Ga0070680_100167225
471 Ga0070680_100475735
472 Ga0070682_100023631
473 Ga0070682_100584012
474 Ga0068868_100243584
475 Ga0070660_100013931
476 Ga0070660_100058561
477 Ga0070660_100112482
478 Ga0070660_100182941
479 Ga0070660_100214086
480 Ga0070660_100264574
481 Ga0070660_100675426
482 Ga0070691_10028519
483 Ga0070661_100020670
484 Ga0070661_100039315
485 Ga0070661_100125096
486 Ga0070661_100324756
487 Ga0070661_100377418
488 Ga0070692_10114868
489 Ga0070675_100240375
490 Ga0070671_100066796
491 Ga0070671_100201212
492 Ga0070671_100425942
493 Ga0070673_100005129
494 Ga0070673_100198004
495 Ga0070659_100006892
496 Ga0070659_100011798
497 Ga0070659_100031334
498 Ga0070659_100069326
499 Ga0070659_100403958
500 Ga0070659_100438483
501 Ga0070659_100796735
502 Ga0070659_100856438
503 Ga0070667_100022261
504 Ga0070667_100194895
505 Ga0070667_100754063
506 Ga0070714_100025467
507 Ga0070714_100175103
508 Ga0070713_100039654
509 Ga0070713_100514255
510 Ga0070694_100039101
511 Ga0070663_100007911
512 Ga0070663_100078999
513 Ga0070663_100080255
514 Ga0070662_100021453
515 Ga0070662_100063135
516 Ga0070662_100064693
517 Ga0070662_100105579
518 Ga0070662_100114121
519 Ga0070662_100176556
520 Ga0070662_100244261
521 Ga0070681_10064906
522 Ga0070681_10420932
523 Ga0068867_100092779
524 Ga0068867_100287028
525 Ga0070679_100027952
526 Ga0070679_100098642
527 Ga0070679_100146890
528 Ga0070679_100252517
529 Ga0070684_100100556
530 Ga0070684_100425903
531 Ga0068853_100113195
532 Ga0068853_100295213
533 Ga0070672_100025209
534 Ga0070672_100079261
535 Ga0070686_100676278
536 Ga0070696_100007522
537 Ga0070665_100042613
538 Ga0070665_100635099
539 Ga0070704_100168490
540 Ga0068855_100034983
541 Ga0068855_100050178
542 Ga0068855_100097808
543 Ga0068855_100113619
544 Ga0068855_100942667
545 Ga0068855_100988946
546 Ga0070664_100016939
547 Ga0070664_100021471
548 Ga0070664_100027286
549 Ga0070664_100275887
550 Ga0070664_100558476
551 Ga0068857_100034561
552 Ga0068857_100064967
553 Ga0068857_100568770
554 Ga0068854_100005066
555 Ga0068854_100009788
556 Ga0068854_100102370
557 Ga0068854_100150235
558 Ga0068856_100010945
559 Ga0068856_100029881
560 Ga0068856_100155899
561 Ga0068856_100159946
562 Ga0068856_100314206
563 Ga0068852_100006338
564 Ga0068852_100030646
565 Ga0068852_100066434
566 Ga0068852_100118712
567 Ga0068852_100132562
568 Ga0068852_100287983
569 Ga0068852_100980773
570 Ga0068859_100046625
571 Ga0068859_100444300
572 Ga0068864_100020080
573 Ga0068864_100020434
574 Ga0068864_100032745
575 Ga0068864_100669754
576 Ga0068864_100972842
577 Ga0068861_100030219
578 Ga0068851_10005693
579 Ga0068863_100016179
580 Ga0068858_100005623
581 Ga0068858_100013367
582 Ga0068858_100243638
583 Ga0068858_100287904
584 Ga0068860_100035395
585 Ga0068860_100052989
586 Ga0068862_100288393
587 Ga0068862_101326706
588 Ga0097621_100004661
589 Ga0097621_100245334
590 Ga0097621_100372649
591 Ga0068871_100321381
592 Ga0097620_100046625
593 Ga0097620_100444322
594 Ga0105240_10100882
595 Ga0105240_10171686
596 Ga0105240_10581720
597 Ga0105245_10565248
598 Ga0105243_10235068
599 Ga0105241_10050772
600 Ga0105241_10150120
601 Ga0105242_10156470
602 Ga0105242_10324992
603 Ga0105248_10094013
604 Ga0105248_10195641
605 Ga0105248_10253942
606 Ga0105237_10252886
607 Ga0105238_10025695
608 Ga0105238_10371809
609 Ga0105249_10098239
610 Ga0105239_10020378
611 Ga0105246_10166097
612 Ga0157373_10025448
613 Ga0157373_10036470
614 Ga0157373_10113018
615 Ga0157373_10178804
616 Ga0157371_10103687
617 Ga0157371_10129303
618 Ga0157371_10169176
619 Ga0157371_10215838
620 Ga0157371_10385997
621 Ga0157370_10244740
622 Ga0157370_10257470
623 Ga0157369_10024730
624 Ga0157369_10164324
625 Ga0157369_10283050
626 Ga0157374_10007336
627 Ga0157378_10108897
628 Ga0157378_10455007
629 Ga0163162_10013120
630 Ga0163162_10106141
631 Ga0163162_10396613
632 Ga0157372_10103845
633 Ga0157372_10735120
634 Ga0157375_10218285
635 Ga0157375_10722190
636 Ga0163163_10009210
637 Ga0163161_10194994
638 Ga0206354_10657800
639 Ga0206353_10167362
640 Ga0213876_10053976
641 Ga0207697_10127215
642 Ga0207680_10023610
643 Ga0207647_10004840
644 Ga0207647_10018720
645 Ga0207647_10106501
646 Ga0207647_10222429
647 Ga0207645_10026351
648 Ga0207705_10009108
649 Ga0207705_10021414
650 Ga0207705_10093512
651 Ga0207707_10072301
652 Ga0207671_10046239
653 Ga0207693_10143871
654 Ga0207660_10003350
655 Ga0207660_10024694
656 Ga0207660_10037264
657 Ga0207660_10083757
658 Ga0207660_10202010
659 Ga0207660_10406997
660 Ga0207660_10448214
661 Ga0207662_10090131
662 Ga0207657_10003819
663 Ga0207657_10044861
664 Ga0207657_10050324
665 Ga0207657_10051468
666 Ga0207657_10060628
667 Ga0207657_10085176
668 Ga0207657_10252310
669 Ga0207649_10007331
670 Ga0207649_10117555
671 Ga0207649_10216277
672 Ga0207652_10029434
673 Ga0207652_10107135
674 Ga0207652_10805144
675 Ga0207694_10012194
676 Ga0207650_10014138
677 Ga0207650_10024751
678 Ga0207687_10105882
679 Ga0207700_10344004
680 Ga0207664_10029890
681 Ga0207664_10680390
682 Ga0207644_10005433
683 Ga0207644_10153325
684 Ga0207644_10167050
685 Ga0207690_10007952
686 Ga0207690_10031576
687 Ga0207690_10048435
688 Ga0207690_10088786
689 Ga0207706_10002847
690 Ga0207706_10007131
691 Ga0207706_10039491
692 Ga0207706_10051504
693 Ga0207706_10057375
694 Ga0207706_10133761
695 Ga0207669_10299362
696 Ga0207704_10322991
697 Ga0207665_10198534
698 Ga0207691_10006011
699 Ga0207691_10009611
700 Ga0207691_10034669
701 Ga0207711_10093091
702 Ga0207689_10031800
703 Ga0207689_10033359
704 Ga0207661_10036271
705 Ga0207661_10375614
706 Ga0207661_10878125
707 Ga0207679_10012681
708 Ga0207679_10063958
709 Ga0207679_10084073
710 Ga0207679_10111490
711 Ga0207667_10010963
712 Ga0207667_10017517
713 Ga0207667_10053377
714 Ga0207667_10085771
715 Ga0207667_10121790
716 Ga0207667_10133574
717 Ga0207651_10018140
718 Ga0207651_10042787
719 Ga0207712_10003201
720 Ga0207668_10028459
721 Ga0207640_10002017
722 Ga0207640_10008538
723 Ga0207640_10013162
724 Ga0207640_10071714
725 Ga0207640_10142856
726 Ga0207640_10830087
727 Ga0207658_10104113
728 Ga0207658_10182968
729 Ga0207658_10627669
730 Ga0207658_10739952
731 Ga0207703_10004789
732 Ga0207703_10019621
733 Ga0207703_10367455
734 Ga0207703_10582493
735 Ga0207639_10100781
736 Ga0207639_10117830
737 Ga0207639_10149478
738 Ga0207678_10011359
739 Ga0207678_10027487
740 Ga0207678_10066583
741 Ga0207678_10243901
742 Ga0207708_10088694
743 Ga0207702_10078539
744 Ga0207702_10091247
745 Ga0207702_10373422
746 Ga0207702_10437585
747 Ga0207641_10129390
748 Ga0207648_10126522
749 Ga0207648_10652313
750 Ga0207676_10008383
751 Ga0207676_10024312
752 Ga0207676_10086825
753 Ga0207676_10763807
754 Ga0207674_10001920
755 Ga0207674_10020252
756 Ga0207674_10034980
757 Ga0207674_10110020
758 Ga0207674_10133395
759 Ga0207674_10624683
760 Ga0207675_100104308
761 Ga0207675_101049905
762 Ga0207683_10030520
763 Ga0207683_10081213
764 Ga0207683_10174497
765 Ga0207698_10000912
766 Ga0207698_10005178
767 Ga0207698_10116884
768 Ga0207698_10724049
769 Ga0268265_10026768
770 Ga0268265_10123133
771 Ga0268264_10001602
772 Ga0268264_10345869
773 Ga0307410_10048347
774 Ga0307407_10052807
775 Ga0307409_100078503
776 Ga0307414_10307420
777 Ga0307415_100354214
778 Ga0373935_0017341
779 Ga0373935_0477127
780 Ga0373927_0338739
781 Ga0395899_0000372
782 Ga0395899_0001367
783 Ga0395899_0008520
784 Ga0395899_0025286
785 Ga0395899_0032108
786 Ga0395899_0059754
787 Ga0395899_0088519
788 Ga0395899_0133732
789 Ga0395899_0165478
790 Ga0395899_0212803
791 Ga0395899_0397863
792 Ga0395900_0000240
793 Ga0395900_0004328
794 Ga0395900_0011113
795 Ga0395900_0058765
796 Ga0395900_0075158
797 Ga0395900_0180680
798 Ga0395900_0280420
799 Ga0395900_0289849
800 Ga0395900_0936173
801 Ga0395898_0000619
802 Ga0395898_0044126
803 Ga0395898_0050181
804 Ga0395898_0068188
805 Ga0395898_0156324
806 Ga0395898_0244778
807 Ga0395898_0388167
808 Ga0395898_0803781
809 Ga0395905_0000219
810 Ga0395905_0001380
811 Ga0395905_0011196
812 Ga0395905_0013673
813 Ga0395905_0019340
814 Ga0395905_0022124
815 Ga0395905_0045123
816 Ga0395905_0080184
817 Ga0395905_0082801
818 Ga0395905_0131729
819 Ga0395905_0155073
820 Ga0395905_0169616
821 Ga0395905_0451398
822 Ga0395905_0936143
823 Ga0395901_0001287
824 Ga0395901_0047023
825 Ga0395901_0051129
826 Ga0395901_0083435
827 Ga0395901_0085477
828 Ga0395901_0093771
829 Ga0395901_0152773
830 Ga0395901_0158501
831 Ga0395901_0246499
832 Ga0395901_0294504
833 Ga0395901_0721983
834 Ga0395901_0733900
835 Ga0395901_0785936
836 Ga0436365_1850486
837 Ga0439448_0011869
838 Ga0466969_0188711
839 Ga0466972_0055091
840 Ga0466972_0083933
841 Ga0466966_0113252
842 Ga0466966_0209864
843 Ga0466966_0225014
844 Ga0466961_0119461
845 Ga0466961_0211286
846 Ga0466963_0013286
847 Ga0466963_0030934
848 Ga0466963_0094384
849 Ga0466963_0510761
850 Ga0466964_0243644
851 Ga0466971_0046605
852 Ga0466970_0046923
853 Ga0466957_0005123
854 Ga0466957_0141434
855 Ga0466959_0056272
856 Ga0466959_0058443
857 Ga0466959_0257559
858 Ga0466959_0482197
859 Ga0466958_0012333
860 Ga0466958_0091060
861 Ga0466958_0205072
862 Ga0466967_0007070
863 Ga0466967_0314378
864 Ga0466967_0491469
865 Ga0495663_0112115
866 Ga0495669_0007614
867 Ga0495687_102783
868 Ga0495677_0032408
869 Ga0496100_0221699
870 Ga0496108_0016159
871 Ga0496109_0004784
872 Ga0496109_0264640
873 Ga0496111_0008331
874 Ga0496112_0030996
875 Ga0496112_0219905
876 Ga0496113_0021042
877 Ga0496113_0035306
878 Ga0496115_0002782
879 Ga0466962_0042719
880 Ga0466962_0074876
881 Ga0466962_0151793
882 Ga0466962_0248587

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vbq-assembly1.cif.gz_A structure of aac(6')-iy in complex with bisubstrate analog coa-s- monomethyl-acetylneamine. 0.74 72 93
5wi2-assembly2.cif.gz_B crystal structure of the ka1 domain from human chk1 0.7396 25 111
3mxq-assembly1.cif.gz_D crystal structure of sensory box sensor histidine kinase from vibrio cholerae 0.7342 87 111
4fdt-assembly2.cif.gz_B crystal structure of a multiple inositol polyphosphate phosphatase 0.7311 59 85
4fdt-assembly1.cif.gz_A crystal structure of a multiple inositol polyphosphate phosphatase 0.7301 59 85
ID Description Score Start End Superfamily
af_P39368_4_174_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8902 74 93 3.40.630.30
4evyB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8199 73 94 3.40.630.30
4h0oA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7637 65 111 3.30.420.40
af_Q9VAG9_1_175_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.7346 74 111 3.30.540.10
3mxqD00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.7342 87 111 3.30.450.20
ID Description Score Start End GO Terms
AF-Q6QAZ8-F1-model_v4 PrnD 0.7716 62 108
AF-A0A516N3G5-F1-model_v4 deleted 0.7451 50 94
AF-A0A1Y3QCU2-F1-model_v4 Flagellar hook protein FlgE 0.7253 50 94 GO:0005829
GO:0009424
GO:0009425
GO:0071978
AF-A0A370G850-F1-model_v4 Flagellar hook protein FlgE 0.7172 46 94 GO:0005829
GO:0009424
GO:0009425
GO:0071978
AF-A0A259IC06-F1-model_v4 deleted 0.7063 26 110

Map