F444587

General Info

Members Datasets Scaffolds Average Seq Length
441 240 882 153

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_101230217|Ga0070690_1012302171
Length 166
Sequence VSARKSYSPGKAHSRRAEPKVEKFPASNATDLADQIHSAAIHLLRRLRKEDDASGISAPRLSALSVVVFGGPVTLGQLARAEQVRPPTMTRIVTGLENDGLVTRVGDELDGRLTKIEATAKGQRVLLAGRARRVNLFAKAVERLSKGELAELAQGVQLLRKLLNEL

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
178 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
180 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
181 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
182 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
188 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
189 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
190 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
191 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
192 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
193 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
194 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
195 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
204 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
205 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
206 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
207 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
208 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
215 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
240 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 7.26
Rhizosphere 91.84
Stem 0
Stem Tuber 0
Unclassified 31.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_101230217 3300005330 Bacteria 598
2 MBSR1b_contig_12854587 2162886012 Bacteria 2263
3 MBSR1b_contig_7306188 2162886012 Eukaryota 1176
4 JGI24743J22301_10021476 3300001991 Eukaryota 1234
5 JGI24034J26672_10006798 3300002239 Bacteria 1654
6 JGI24751J29686_10000754 3300002459 Bacteria 7715
7 Ga0065712_10148412 3300005290 Bacteria 1365
8 Ga0065715_10001150 3300005293 Bacteria 7257
9 Ga0065715_10119474 3300005293 Bacteria 2285
10 Ga0070676_10066574 3300005328 Bacteria 2152
11 Ga0070676_10517467 3300005328 Unclassified 849
12 Ga0070683_100000242 3300005329 Bacteria 37383
13 Ga0070690_100006515 3300005330 Bacteria 6624
14 Ga0070690_100136708 3300005330 Bacteria 1660
15 Ga0070690_101010749 3300005330 Unclassified 655
16 Ga0070670_100026180 3300005331 Bacteria 5021
17 Ga0068869_101070354 3300005334 Unclassified 704
18 Ga0070666_10214485 3300005335 Bacteria 1356
19 Ga0070666_10646433 3300005335 Unclassified 773
20 Ga0070666_10706416 3300005335 Unclassified 739
21 Ga0070680_100022024 3300005336 Bacteria 5069
22 Ga0070682_100001217 3300005337 Bacteria 14649
23 Ga0070682_100008804 3300005337 Bacteria 5697
24 Ga0070682_100311212 3300005337 Unclassified 1159
25 Ga0068868_100022154 3300005338 Unclassified 4792
26 Ga0070660_100010443 3300005339 Bacteria 6562
27 Ga0070660_100015584 3300005339 Bacteria 5492
28 Ga0070689_100001786 3300005340 Bacteria 13813
29 Ga0070689_100396937 3300005340 Unclassified 1165
30 Ga0070687_100003469 3300005343 Bacteria 6130
31 Ga0070687_100610414 3300005343 Unclassified 751
32 Ga0070661_100013761 3300005344 Bacteria 5682
33 Ga0070661_100020403 3300005344 Bacteria 4725
34 Ga0070692_10484773 3300005345 Unclassified 798
35 Ga0070692_10746997 3300005345 Unclassified 663
36 Ga0070668_100012680 3300005347 Bacteria 6274
37 Ga0070669_100393585 3300005353 Bacteria 1132
38 Ga0070675_100018915 3300005354 Bacteria 5487
39 Ga0070675_100638437 3300005354 Unclassified 967
40 Ga0070671_100060706 3300005355 Bacteria 3148
41 Ga0070671_101442074 3300005355 Unclassified 608
42 Ga0070674_100223904 3300005356 Bacteria 1465
43 Ga0070674_100257822 3300005356 Bacteria 1372
44 Ga0070673_100007875 3300005364 Bacteria 7060
45 Ga0070673_100020359 3300005364 Unclassified 4785
46 Ga0070688_100000768 3300005365 Bacteria 15844
47 Ga0070659_100011195 3300005366 Bacteria 6628
48 Ga0070659_100033045 3300005366 Bacteria 4017
49 Ga0070667_100010376 3300005367 Bacteria 7692
50 Ga0070667_100213585 3300005367 Bacteria 1715
51 Ga0070667_100416340 3300005367 Bacteria 1224
52 Ga0070703_10067979 3300005406 Bacteria 1183
53 Ga0070714_100039034 3300005435 Bacteria 3996
54 Ga0070714_100159323 3300005435 Bacteria 2041
55 Ga0070714_100159552 3300005435 Bacteria 2039
56 Ga0070713_100839508 3300005436 Bacteria 882
57 Ga0070710_10023436 3300005437 Bacteria 3245
58 Ga0070710_10562521 3300005437 Bacteria 789
59 Ga0070701_10128372 3300005438 Unclassified 1438
60 Ga0070711_100816705 3300005439 Unclassified 792
61 Ga0070700_100017519 3300005441 Bacteria 4099
62 Ga0070700_100524991 3300005441 Bacteria 915
63 Ga0070694_100110692 3300005444 Unclassified 1956
64 Ga0070708_100000398 3300005445 Bacteria 32920
65 Ga0070708_100008837 3300005445 Bacteria 8106
66 Ga0070708_100042149 3300005445 Unclassified 4005
67 Ga0070708_100405924 3300005445 Unclassified 1285
68 Ga0070708_101290446 3300005445 Unclassified 682
69 Ga0070663_100002172 3300005455 Bacteria 10969
70 Ga0070678_100071289 3300005456 Bacteria 2601
71 Ga0070662_100035478 3300005457 Bacteria 3522
72 Ga0070681_10014152 3300005458 Unclassified 7940
73 Ga0070681_10014985 3300005458 Bacteria 7708
74 Ga0070681_10228035 3300005458 Unclassified 1777
75 Ga0070681_10713719 3300005458 Bacteria 919
76 Ga0068867_100038369 3300005459 Bacteria 3487
77 Ga0068867_100049758 3300005459 Unclassified 3085
78 Ga0070685_10000904 3300005466 Bacteria 15937
79 Ga0070706_100024440 3300005467 Bacteria 5562
80 Ga0070707_100001656 3300005468 Bacteria 21561
81 Ga0070707_100274985 3300005468 Bacteria 1637
82 Ga0070707_100308552 3300005468 Bacteria 1538
83 Ga0070707_100381952 3300005468 Unclassified 1368
84 Ga0070699_100799001 3300005518 Bacteria 863
85 Ga0070679_100055598 3300005530 Unclassified 3941
86 Ga0070679_100133179 3300005530 Bacteria 2466
87 Ga0070679_100213165 3300005530 Bacteria 1894
88 Ga0070679_100241207 3300005530 Bacteria 1765
89 Ga0070679_100311379 3300005530 Unclassified 1524
90 Ga0070684_100002766 3300005535 Bacteria 12983
91 Ga0070684_100097926 3300005535 Bacteria 2616
92 Ga0070684_100296467 3300005535 Bacteria 1483
93 Ga0070697_100002199 3300005536 Bacteria 14971
94 Ga0070697_100495853 3300005536 Unclassified 1067
95 Ga0068853_100004588 3300005539 Bacteria 10716
96 Ga0068853_100004876 3300005539 Bacteria 10436
97 Ga0068853_100427064 3300005539 Bacteria 1243
98 Ga0070672_100187084 3300005543 Bacteria 1727
99 Ga0070672_101265605 3300005543 Unclassified 658
100 Ga0070686_100036365 3300005544 Unclassified 3048
101 Ga0070686_100301507 3300005544 Bacteria 1188
102 Ga0070695_100018466 3300005545 Bacteria 4235
103 Ga0070695_100046775 3300005545 Unclassified 2761
104 Ga0070695_100072072 3300005545 Unclassified 2264
105 Ga0070695_100090039 3300005545 Unclassified 2047
106 Ga0070696_100019515 3300005546 Unclassified 4591
107 Ga0070665_100021084 3300005548 Bacteria 6551
108 Ga0070665_101813679 3300005548 Unclassified 616
109 Ga0070704_100357327 3300005549 Bacteria 1235
110 Ga0070704_100584436 3300005549 Unclassified 980
111 Ga0068855_100005410 3300005563 Bacteria 15574
112 Ga0068855_100067240 3300005563 Unclassified 4176
113 Ga0068855_100713941 3300005563 Bacteria 1072
114 Ga0070664_100210750 3300005564 Bacteria 1736
115 Ga0070664_100223759 3300005564 Unclassified 1684
116 Ga0068857_100000434 3300005577 Bacteria 29562
117 Ga0068857_100457007 3300005577 Unclassified 1194
118 Ga0068854_100069057 3300005578 Unclassified 2578
119 Ga0068856_100005987 3300005614 Bacteria 11971
120 Ga0068856_100032113 3300005614 Bacteria 5139
121 Ga0070702_100007134 3300005615 Bacteria 5337
122 Ga0070702_100551834 3300005615 Bacteria 855
123 Ga0068852_100000034 3300005616 Bacteria 101076
124 Ga0068852_100019600 3300005616 Bacteria 5358
125 Ga0068852_100253625 3300005616 Bacteria 1686
126 Ga0068859_100033577 3300005617 Bacteria 5153
127 Ga0068859_100250575 3300005617 Bacteria 1861
128 Ga0068864_100007470 3300005618 Bacteria 9002
129 Ga0068864_100012096 3300005618 Bacteria 7129
130 Ga0068864_100114273 3300005618 Bacteria 2407
131 Ga0068866_10002773 3300005718 Bacteria 7227
132 Ga0068866_10042460 3300005718 Unclassified 2263
133 Ga0068861_100033916 3300005719 Bacteria 3770
134 Ga0068861_100146823 3300005719 Unclassified 1931
135 Ga0068851_10005910 3300005834 Bacteria 5572
136 Ga0068863_100238687 3300005841 Bacteria 1754
137 Ga0068858_101070707 3300005842 Unclassified 791
138 Ga0068860_100072860 3300005843 Unclassified 3265
139 Ga0068860_100080016 3300005843 Bacteria 3107
140 Ga0068862_100064053 3300005844 Unclassified 3164
141 Ga0068862_100166730 3300005844 Bacteria 1969
142 Ga0081455_10339806 3300005937 Unclassified 1063
143 Ga0070717_10001433 3300006028 Bacteria 16433
144 Ga0070717_10059362 3300006028 Unclassified 3165
145 Ga0070717_10625197 3300006028 Bacteria 977
146 Ga0070715_10295744 3300006163 Bacteria 864
147 Ga0070716_100092708 3300006173 Unclassified 1832
148 Ga0070716_100157194 3300006173 Bacteria 1469
149 Ga0070716_100593838 3300006173 Bacteria 832
150 Ga0070712_100108387 3300006175 Unclassified 2068
151 Ga0070712_100166626 3300006175 Bacteria 1706
152 Ga0097621_100103360 3300006237 Unclassified 2400
153 Ga0097621_100408935 3300006237 Bacteria 1216
154 Ga0097621_101033637 3300006237 Unclassified 769
155 Ga0068871_100531201 3300006358 Unclassified 1063
156 Ga0075430_100089413 3300006846 Bacteria 2577
157 Ga0075431_100060888 3300006847 Unclassified 3895
158 Ga0075431_100625538 3300006847 Bacteria 1059
159 Ga0075434_100005298 3300006871 Bacteria 11733
160 Ga0075434_100087387 3300006871 Unclassified 3118
161 Ga0075429_100064937 3300006880 Bacteria 3178
162 Ga0068865_100486562 3300006881 Bacteria 1026
163 Ga0075436_100095038 3300006914 Bacteria 2073
164 Ga0097620_100033578 3300006931 Bacteria 5153
165 Ga0097620_100250569 3300006931 Bacteria 1861
166 Ga0075435_100490818 3300007076 Unclassified 1061
167 Ga0075435_100795901 3300007076 Unclassified 823
168 Ga0105250_10027720 3300009092 Unclassified 2283
169 Ga0105240_10001898 3300009093 Bacteria 34697
170 Ga0105240_10021615 3300009093 Bacteria 8558
171 Ga0105240_10037944 3300009093 Bacteria 6186
172 Ga0111539_10022141 3300009094 Bacteria 7813
173 Ga0105245_10014487 3300009098 Bacteria 6867
174 Ga0105245_10139970 3300009098 Unclassified 2278
175 Ga0105245_10382628 3300009098 Bacteria 1402
176 Ga0105245_10428834 3300009098 Unclassified 1327
177 Ga0105245_11060507 3300009098 Unclassified 856
178 Ga0105245_11622845 3300009098 Bacteria 698
179 Ga0105247_10004648 3300009101 Bacteria 8750
180 Ga0105247_10034548 3300009101 Unclassified 3079
181 Ga0105247_10087019 3300009101 Bacteria 1978
182 Ga0114129_10716711 3300009147 Bacteria 1284
183 Ga0105243_10122911 3300009148 Bacteria 2191
184 Ga0105241_10005867 3300009174 Bacteria 9068
185 Ga0105241_10021225 3300009174 Bacteria 4799
186 Ga0105242_10223350 3300009176 Bacteria 1685
187 Ga0105242_10364483 3300009176 Unclassified 1338
188 Ga0105242_10651161 3300009176 Bacteria 1024
189 Ga0105248_10010666 3300009177 Bacteria 10135
190 Ga0105248_10889460 3300009177 Bacteria 1005
191 Ga0105248_11868213 3300009177 Unclassified 681
192 Ga0105237_10023740 3300009545 Bacteria 6278
193 Ga0105237_10317572 3300009545 Bacteria 1561
194 Ga0105237_10350805 3300009545 Bacteria 1480
195 Ga0105238_10009704 3300009551 Bacteria 9637
196 Ga0105238_10108719 3300009551 Bacteria 2754
197 Ga0105249_10001809 3300009553 Bacteria 18603
198 Ga0105239_10069656 3300010375 Bacteria 3864
199 Ga0105239_10352636 3300010375 Unclassified 1661
200 Ga0105239_10629685 3300010375 Unclassified 1224
201 Ga0105239_11543203 3300010375 Bacteria 768
202 Ga0105246_10000221 3300011119 Bacteria 28982
203 Ga0105246_10025587 3300011119 Bacteria 3848
204 Ga0157373_10039398 3300013100 Bacteria 3383
205 Ga0157373_10097136 3300013100 Unclassified 2074
206 Ga0157371_10007486 3300013102 Bacteria 8835
207 Ga0157370_10000094 3300013104 Bacteria 100869
208 Ga0157369_10000144 3300013105 Bacteria 101137
209 Ga0157369_10023457 3300013105 Bacteria 6872
210 Ga0157369_10077222 3300013105 Bacteria 3569
211 Ga0157369_10103835 3300013105 Bacteria 3028
212 Ga0157369_10645557 3300013105 Bacteria 1092
213 Ga0157374_10005139 3300013296 Bacteria 10974
214 Ga0157374_11508623 3300013296 Unclassified 695
215 Ga0157378_10033213 3300013297 Bacteria 4560
216 Ga0157378_11091130 3300013297 Unclassified 835
217 Ga0157378_11511959 3300013297 Unclassified 716
218 Ga0163162_10057062 3300013306 Unclassified 3932
219 Ga0163162_10578695 3300013306 Bacteria 1250
220 Ga0163162_11472150 3300013306 Unclassified 775
221 Ga0157372_10000475 3300013307 Bacteria 44294
222 Ga0157372_10009104 3300013307 Bacteria 10548
223 Ga0157372_10080165 3300013307 Unclassified 3692
224 Ga0157372_10230969 3300013307 Unclassified 2145
225 Ga0157372_10691186 3300013307 Bacteria 1187
226 Ga0157372_11274189 3300013307 Unclassified 848
227 Ga0157375_10062287 3300013308 Bacteria 3706
228 Ga0157375_10298793 3300013308 Unclassified 1774
229 Ga0163163_10000558 3300014325 Bacteria 32720
230 Ga0163163_10078000 3300014325 Unclassified 3308
231 Ga0157380_12053447 3300014326 Unclassified 634
232 Ga0157377_10001730 3300014745 Bacteria 9527
233 Ga0157377_10356884 3300014745 Unclassified 983
234 Ga0157379_10004106 3300014968 Bacteria 12424
235 Ga0157376_10002705 3300014969 Bacteria 12072
236 Ga0157376_10710773 3300014969 Bacteria 1011
237 Ga0157376_10883506 3300014969 Bacteria 911
238 Ga0163161_10002695 3300017792 Bacteria 12625
239 Ga0207697_10003711 3300025315 Bacteria 7473
240 Ga0207656_10011420 3300025321 Unclassified 3356
241 Ga0207653_10021019 3300025885 Bacteria 2069
242 Ga0207692_10353280 3300025898 Bacteria 907
243 Ga0207710_10161794 3300025900 Unclassified 1091
244 Ga0207680_10058928 3300025903 Unclassified 2330
245 Ga0207680_10113708 3300025903 Unclassified 1760
246 Ga0207680_10680150 3300025903 Unclassified 737
247 Ga0207645_10010651 3300025907 Bacteria 6309
248 Ga0207645_10011831 3300025907 Bacteria 5940
249 Ga0207643_10001092 3300025908 Bacteria 16068
250 Ga0207705_10014101 3300025909 Bacteria 5758
251 Ga0207684_10009288 3300025910 Bacteria 8687
252 Ga0207654_10125802 3300025911 Bacteria 1616
253 Ga0207707_10002345 3300025912 Bacteria 17063
254 Ga0207707_10018449 3300025912 Bacteria 6083
255 Ga0207707_10388196 3300025912 Unclassified 1200
256 Ga0207695_10000192 3300025913 Bacteria 173760
257 Ga0207695_10034231 3300025913 Bacteria 5529
258 Ga0207695_10038484 3300025913 Bacteria 5148
259 Ga0207671_10441648 3300025914 Bacteria 1036
260 Ga0207693_10187792 3300025915 Unclassified 1627
261 Ga0207660_10083811 3300025917 Unclassified 2348
262 Ga0207662_10014476 3300025918 Bacteria 4429
263 Ga0207662_10065443 3300025918 Bacteria 2189
264 Ga0207657_10001258 3300025919 Bacteria 27107
265 Ga0207657_10003823 3300025919 Bacteria 15991
266 Ga0207657_10653998 3300025919 Unclassified 818
267 Ga0207649_10000430 3300025920 Bacteria 30543
268 Ga0207652_10002309 3300025921 Bacteria 16162
269 Ga0207652_10130487 3300025921 Unclassified 2241
270 Ga0207652_10197926 3300025921 Bacteria 1808
271 Ga0207652_10290789 3300025921 Unclassified 1474
272 Ga0207646_10012294 3300025922 Bacteria 8233
273 Ga0207681_10031649 3300025923 Bacteria 3457
274 Ga0207681_10167217 3300025923 Bacteria 1663
275 Ga0207694_11016852 3300025924 Bacteria 701
276 Ga0207650_10000063 3300025925 Bacteria 146432
277 Ga0207659_10296127 3300025926 Bacteria 1327
278 Ga0207687_10005580 3300025927 Bacteria 8314
279 Ga0207687_10259048 3300025927 Bacteria 1386
280 Ga0207687_10465243 3300025927 Bacteria 1051
281 Ga0207687_11057513 3300025927 Unclassified 697
282 Ga0207644_10008649 3300025931 Bacteria 6658
283 Ga0207690_10018979 3300025932 Bacteria 4222
284 Ga0207690_11067111 3300025932 Unclassified 673
285 Ga0207706_10000698 3300025933 Bacteria 35074
286 Ga0207706_10001575 3300025933 Bacteria 22616
287 Ga0207706_10005346 3300025933 Bacteria 11968
288 Ga0207686_10090261 3300025934 Unclassified 2021
289 Ga0207670_10059797 3300025936 Unclassified 2593
290 Ga0207670_10083113 3300025936 Bacteria 2245
291 Ga0207669_10129488 3300025937 Bacteria 1731
292 Ga0207669_10325455 3300025937 Unclassified 1178
293 Ga0207669_10633065 3300025937 Bacteria 873
294 Ga0207665_10102271 3300025939 Bacteria 2002
295 Ga0207665_10541161 3300025939 Bacteria 904
296 Ga0207711_10010872 3300025941 Bacteria 7564
297 Ga0207711_10298616 3300025941 Bacteria 1485
298 Ga0207689_10000199 3300025942 Bacteria 52878
299 Ga0207689_10033987 3300025942 Unclassified 4235
300 Ga0207661_10000571 3300025944 Bacteria 23501
301 Ga0207661_10152108 3300025944 Unclassified 2001
302 Ga0207661_11581386 3300025944 Unclassified 600
303 Ga0207667_10015081 3300025949 Bacteria 8788
304 Ga0207667_10197938 3300025949 Bacteria 2061
305 Ga0207651_10410632 3300025960 Bacteria 1153
306 Ga0207668_10161687 3300025972 Unclassified 1745
307 Ga0207640_10120696 3300025981 Unclassified 1877
308 Ga0207658_10268299 3300025986 Bacteria 1457
309 Ga0207658_10359753 3300025986 Bacteria 1269
310 Ga0207677_10004891 3300026023 Bacteria 7236
311 Ga0207703_10092601 3300026035 Bacteria 2544
312 Ga0207703_10228478 3300026035 Bacteria 1667
313 Ga0207639_10105657 3300026041 Bacteria 2285
314 Ga0207639_10403894 3300026041 Bacteria 1231
315 Ga0207639_10435870 3300026041 Bacteria 1187
316 Ga0207678_10000516 3300026067 Bacteria 34999
317 Ga0207678_10003097 3300026067 Bacteria 15057
318 Ga0207708_10013933 3300026075 Bacteria 6008
319 Ga0207708_10219224 3300026075 Bacteria 1524
320 Ga0207702_10453020 3300026078 Bacteria 1245
321 Ga0207641_10000361 3300026088 Bacteria 54249
322 Ga0207648_10038770 3300026089 Unclassified 4192
323 Ga0207648_10049337 3300026089 Bacteria 3684
324 Ga0207676_10000306 3300026095 Bacteria 41992
325 Ga0207676_10193834 3300026095 Unclassified 1790
326 Ga0207674_10000034 3300026116 Bacteria 137337
327 Ga0207674_10018519 3300026116 Bacteria 7566
328 Ga0207675_100030948 3300026118 Bacteria 4984
329 Ga0207675_100070814 3300026118 Bacteria 3259
330 Ga0207675_100081242 3300026118 Bacteria 3039
331 Ga0207683_10001318 3300026121 Bacteria 22406
332 Ga0207698_10000248 3300026142 Bacteria 33177
333 Ga0207698_10028401 3300026142 Unclassified 3988
334 Ga0207698_11412312 3300026142 Bacteria 711
335 Ga0207428_10360801 3300027907 Unclassified 1068
336 Ga0268266_10006180 3300028379 Bacteria 11004
337 Ga0268266_11222362 3300028379 Unclassified 726
338 Ga0268265_10004061 3300028380 Bacteria 10288
339 Ga0268265_10019865 3300028380 Unclassified 4679
340 Ga0268264_10040208 3300028381 Unclassified 3863
341 Ga0268264_10189410 3300028381 Bacteria 1874
342 Ga0268264_10520269 3300028381 Bacteria 1163
343 Ga0268264_11148373 3300028381 Unclassified 786
344 Ga0265338_10129345 3300028800 Bacteria 1997
345 Ga0265338_10277810 3300028800 Bacteria 1225
346 Ga0265338_10386623 3300028800 Bacteria 1000
347 Ga0265760_10003237 3300031090 Bacteria 4774
348 Ga0265340_10148761 3300031247 Bacteria 1068
349 Ga0265339_10101907 3300031249 Unclassified 1493
350 Ga0265339_10134824 3300031249 Bacteria 1260
351 Ga0265331_10366394 3300031250 Bacteria 646
352 Ga0265316_10429985 3300031344 Bacteria 948
353 Ga0307408_101972664 3300031548 Unclassified 561
354 Ga0307405_11101150 3300031731 Bacteria 683
355 Ga0307406_10188719 3300031901 Bacteria 1507
356 Ga0307416_100183494 3300032002 Unclassified 1964
357 Ga0307416_101252307 3300032002 Unclassified 848
358 Ga0373930_0012139 3300034816 Unclassified 1567
359 Ga0373948_0026444 3300034817 Unclassified 1144
360 Ga0373928_0011990 3300035084 Unclassified 1724
361 Ga0373934_0179664 3300035086 Bacteria 869
362 Ga0373932_0118275 3300035112 Unclassified 881
363 Ga0373960_0022259 3300035121 Unclassified 1695
364 Ga0373955_0016939 3300035172 Bacteria 3595
365 Ga0373955_0164517 3300035172 Unclassified 1311
366 Ga0373961_0115509 3300035241 Unclassified 884
367 Ga0373962_0018136 3300035242 Bacteria 1829
368 Ga0373931_0089190 3300035691 Bacteria 1715
369 Ga0373931_0492389 3300035691 Bacteria 789
370 Ga0373933_0168509 3300035724 Bacteria 1393
371 Ga0373933_1097324 3300035724 Unclassified 524
372 Ga0373947_0373436 3300035725 Bacteria 959
373 Ga0373937_0201245 3300036401 Bacteria 1872
374 Ga0395898_0017016 3300037466 Bacteria 7425
375 Ga0395898_0136073 3300037466 Bacteria 2352
376 Ga0395898_0202308 3300037466 Bacteria 1896
377 Ga0395905_0217235 3300037471 Bacteria 1790
378 Ga0395901_0096716 3300038443 Bacteria 3094
379 Ga0395901_0506175 3300038443 Unclassified 1229
380 Ga0242420_021231 3300038996 Unclassified 1161
381 Ga0436363_0812496 3300039450 Bacteria 631
382 Ga0451853_3833747 3300041512 Unclassified 2438
383 Ga0453683_0269044 3300044673 Unclassified 1087
384 Ga0466963_0190429 3300044694 Bacteria 1433
385 Ga0466963_0409775 3300044694 Bacteria 956
386 Ga0453684_2151095 3300044712 Unclassified 558
387 Ga0466957_0469593 3300044842 Bacteria 869
388 Ga0466960_0199133 3300044901 Bacteria 1093
389 Ga0466967_0247816 3300045976 Bacteria 1701
390 Ga0466967_1386454 3300045976 Bacteria 700
391 Ga0466967_1530626 3300045976 Bacteria 664
392 Ga0495651_0209643 3300046462 Bacteria 1357
393 Ga0495651_0528140 3300046462 Unclassified 752
394 Ga0495580_0063252 3300046472 Bacteria 2596
395 Ga0495580_0381065 3300046472 Unclassified 953
396 Ga0495580_0410578 3300046472 Unclassified 912
397 Ga0495580_0427990 3300046472 Bacteria 890
398 Ga0495657_0348337 3300046675 Bacteria 877
399 Ga0495623_0572724 3300046679 Bacteria 589
400 Ga0496100_0150376 3300048903 Bacteria 1660
401 Ga0496101_0015887 3300048904 Bacteria 5080
402 Ga0496101_0544935 3300048904 Unclassified 917
403 Ga0496102_0084613 3300048905 Unclassified 2927
404 Ga0496102_0122292 3300048905 Unclassified 2431
405 Ga0496102_0549564 3300048905 Bacteria 1078
406 Ga0496103_0328807 3300048906 Unclassified 983
407 Ga0496103_0330217 3300048906 Bacteria 981
408 Ga0496103_0350306 3300048906 Unclassified 949
409 Ga0496104_0094925 3300048907 Unclassified 2853
410 Ga0496105_0093853 3300048908 Bacteria 2478
411 Ga0496105_1353476 3300048908 Unclassified 517
412 Ga0496106_0078228 3300048909 Bacteria 2537
413 Ga0496106_0335323 3300048909 Unclassified 1214
414 Ga0496108_0000038 3300048911 Bacteria 149482
415 Ga0496108_0002184 3300048911 Bacteria 15701
416 Ga0496109_0000082 3300048912 Bacteria 99164
417 Ga0496109_0019767 3300048912 Bacteria 5941
418 Ga0496110_0036102 3300048913 Bacteria 4291
419 Ga0496110_0046177 3300048913 Bacteria 3810
420 Ga0496111_0000438 3300048914 Bacteria 21110
421 Ga0496111_0024433 3300048914 Bacteria 4255
422 Ga0496112_0000220 3300048915 Bacteria 36982
423 Ga0496112_0040149 3300048915 Bacteria 4575
424 Ga0496113_0001335 3300048916 Bacteria 13661
425 Ga0496113_0058138 3300048916 Bacteria 2909
426 Ga0496113_0225356 3300048916 Unclassified 1494
427 Ga0496113_0253130 3300048916 Unclassified 1406
428 Ga0496114_0003888 3300048917 Bacteria 11517
429 Ga0496115_0072687 3300048918 Bacteria 2791
430 Ga0496115_0311200 3300048918 Bacteria 1290
431 Ga0496115_0487635 3300048918 Unclassified 992
432 Ga0501271_054167 3300049768 Bacteria 550
433 nmdc:mga0qj67_85281_c1 3300050509 Bacteria 2533
434 nmdc:mga06r32_124911_c1 3300050510 Bacteria 2540
435 nmdc:mga08y16_17179_c1 3300050511 Bacteria 7614
436 nmdc:mga0n895_110481_c1 3300050512 Unclassified 2765
437 nmdc:mga0rr50_758473_c1 3300050513 Unclassified 828
438 nmdc:mga08x19_84642_c1 3300050514 Unclassified 2086
439 Ga0495601_0432576 3300053077 Bacteria 852
440 Ga0500554_012925 3300053102 Bacteria 2113
441 Ga0500628_000303 3300053129 Bacteria 9441
442 Ga0070690_101230217
443 MBSR1b_contig_12854587
444 MBSR1b_contig_7306188
445 JGI24743J22301_10021476
446 JGI24034J26672_10006798
447 JGI24751J29686_10000754
448 Ga0065712_10148412
449 Ga0065715_10001150
450 Ga0065715_10119474
451 Ga0070676_10066574
452 Ga0070676_10517467
453 Ga0070683_100000242
454 Ga0070690_100006515
455 Ga0070690_100136708
456 Ga0070690_101010749
457 Ga0070670_100026180
458 Ga0068869_101070354
459 Ga0070666_10214485
460 Ga0070666_10646433
461 Ga0070666_10706416
462 Ga0070680_100022024
463 Ga0070682_100001217
464 Ga0070682_100008804
465 Ga0070682_100311212
466 Ga0068868_100022154
467 Ga0070660_100010443
468 Ga0070660_100015584
469 Ga0070689_100001786
470 Ga0070689_100396937
471 Ga0070687_100003469
472 Ga0070687_100610414
473 Ga0070661_100013761
474 Ga0070661_100020403
475 Ga0070692_10484773
476 Ga0070692_10746997
477 Ga0070668_100012680
478 Ga0070669_100393585
479 Ga0070675_100018915
480 Ga0070675_100638437
481 Ga0070671_100060706
482 Ga0070671_101442074
483 Ga0070674_100223904
484 Ga0070674_100257822
485 Ga0070673_100007875
486 Ga0070673_100020359
487 Ga0070688_100000768
488 Ga0070659_100011195
489 Ga0070659_100033045
490 Ga0070667_100010376
491 Ga0070667_100213585
492 Ga0070667_100416340
493 Ga0070703_10067979
494 Ga0070714_100039034
495 Ga0070714_100159323
496 Ga0070714_100159552
497 Ga0070713_100839508
498 Ga0070710_10023436
499 Ga0070710_10562521
500 Ga0070701_10128372
501 Ga0070711_100816705
502 Ga0070700_100017519
503 Ga0070700_100524991
504 Ga0070694_100110692
505 Ga0070708_100000398
506 Ga0070708_100008837
507 Ga0070708_100042149
508 Ga0070708_100405924
509 Ga0070708_101290446
510 Ga0070663_100002172
511 Ga0070678_100071289
512 Ga0070662_100035478
513 Ga0070681_10014152
514 Ga0070681_10014985
515 Ga0070681_10228035
516 Ga0070681_10713719
517 Ga0068867_100038369
518 Ga0068867_100049758
519 Ga0070685_10000904
520 Ga0070706_100024440
521 Ga0070707_100001656
522 Ga0070707_100274985
523 Ga0070707_100308552
524 Ga0070707_100381952
525 Ga0070699_100799001
526 Ga0070679_100055598
527 Ga0070679_100133179
528 Ga0070679_100213165
529 Ga0070679_100241207
530 Ga0070679_100311379
531 Ga0070684_100002766
532 Ga0070684_100097926
533 Ga0070684_100296467
534 Ga0070697_100002199
535 Ga0070697_100495853
536 Ga0068853_100004588
537 Ga0068853_100004876
538 Ga0068853_100427064
539 Ga0070672_100187084
540 Ga0070672_101265605
541 Ga0070686_100036365
542 Ga0070686_100301507
543 Ga0070695_100018466
544 Ga0070695_100046775
545 Ga0070695_100072072
546 Ga0070695_100090039
547 Ga0070696_100019515
548 Ga0070665_100021084
549 Ga0070665_101813679
550 Ga0070704_100357327
551 Ga0070704_100584436
552 Ga0068855_100005410
553 Ga0068855_100067240
554 Ga0068855_100713941
555 Ga0070664_100210750
556 Ga0070664_100223759
557 Ga0068857_100000434
558 Ga0068857_100457007
559 Ga0068854_100069057
560 Ga0068856_100005987
561 Ga0068856_100032113
562 Ga0070702_100007134
563 Ga0070702_100551834
564 Ga0068852_100000034
565 Ga0068852_100019600
566 Ga0068852_100253625
567 Ga0068859_100033577
568 Ga0068859_100250575
569 Ga0068864_100007470
570 Ga0068864_100012096
571 Ga0068864_100114273
572 Ga0068866_10002773
573 Ga0068866_10042460
574 Ga0068861_100033916
575 Ga0068861_100146823
576 Ga0068851_10005910
577 Ga0068863_100238687
578 Ga0068858_101070707
579 Ga0068860_100072860
580 Ga0068860_100080016
581 Ga0068862_100064053
582 Ga0068862_100166730
583 Ga0081455_10339806
584 Ga0070717_10001433
585 Ga0070717_10059362
586 Ga0070717_10625197
587 Ga0070715_10295744
588 Ga0070716_100092708
589 Ga0070716_100157194
590 Ga0070716_100593838
591 Ga0070712_100108387
592 Ga0070712_100166626
593 Ga0097621_100103360
594 Ga0097621_100408935
595 Ga0097621_101033637
596 Ga0068871_100531201
597 Ga0075430_100089413
598 Ga0075431_100060888
599 Ga0075431_100625538
600 Ga0075434_100005298
601 Ga0075434_100087387
602 Ga0075429_100064937
603 Ga0068865_100486562
604 Ga0075436_100095038
605 Ga0097620_100033578
606 Ga0097620_100250569
607 Ga0075435_100490818
608 Ga0075435_100795901
609 Ga0105250_10027720
610 Ga0105240_10001898
611 Ga0105240_10021615
612 Ga0105240_10037944
613 Ga0111539_10022141
614 Ga0105245_10014487
615 Ga0105245_10139970
616 Ga0105245_10382628
617 Ga0105245_10428834
618 Ga0105245_11060507
619 Ga0105245_11622845
620 Ga0105247_10004648
621 Ga0105247_10034548
622 Ga0105247_10087019
623 Ga0114129_10716711
624 Ga0105243_10122911
625 Ga0105241_10005867
626 Ga0105241_10021225
627 Ga0105242_10223350
628 Ga0105242_10364483
629 Ga0105242_10651161
630 Ga0105248_10010666
631 Ga0105248_10889460
632 Ga0105248_11868213
633 Ga0105237_10023740
634 Ga0105237_10317572
635 Ga0105237_10350805
636 Ga0105238_10009704
637 Ga0105238_10108719
638 Ga0105249_10001809
639 Ga0105239_10069656
640 Ga0105239_10352636
641 Ga0105239_10629685
642 Ga0105239_11543203
643 Ga0105246_10000221
644 Ga0105246_10025587
645 Ga0157373_10039398
646 Ga0157373_10097136
647 Ga0157371_10007486
648 Ga0157370_10000094
649 Ga0157369_10000144
650 Ga0157369_10023457
651 Ga0157369_10077222
652 Ga0157369_10103835
653 Ga0157369_10645557
654 Ga0157374_10005139
655 Ga0157374_11508623
656 Ga0157378_10033213
657 Ga0157378_11091130
658 Ga0157378_11511959
659 Ga0163162_10057062
660 Ga0163162_10578695
661 Ga0163162_11472150
662 Ga0157372_10000475
663 Ga0157372_10009104
664 Ga0157372_10080165
665 Ga0157372_10230969
666 Ga0157372_10691186
667 Ga0157372_11274189
668 Ga0157375_10062287
669 Ga0157375_10298793
670 Ga0163163_10000558
671 Ga0163163_10078000
672 Ga0157380_12053447
673 Ga0157377_10001730
674 Ga0157377_10356884
675 Ga0157379_10004106
676 Ga0157376_10002705
677 Ga0157376_10710773
678 Ga0157376_10883506
679 Ga0163161_10002695
680 Ga0207697_10003711
681 Ga0207656_10011420
682 Ga0207653_10021019
683 Ga0207692_10353280
684 Ga0207710_10161794
685 Ga0207680_10058928
686 Ga0207680_10113708
687 Ga0207680_10680150
688 Ga0207645_10010651
689 Ga0207645_10011831
690 Ga0207643_10001092
691 Ga0207705_10014101
692 Ga0207684_10009288
693 Ga0207654_10125802
694 Ga0207707_10002345
695 Ga0207707_10018449
696 Ga0207707_10388196
697 Ga0207695_10000192
698 Ga0207695_10034231
699 Ga0207695_10038484
700 Ga0207671_10441648
701 Ga0207693_10187792
702 Ga0207660_10083811
703 Ga0207662_10014476
704 Ga0207662_10065443
705 Ga0207657_10001258
706 Ga0207657_10003823
707 Ga0207657_10653998
708 Ga0207649_10000430
709 Ga0207652_10002309
710 Ga0207652_10130487
711 Ga0207652_10197926
712 Ga0207652_10290789
713 Ga0207646_10012294
714 Ga0207681_10031649
715 Ga0207681_10167217
716 Ga0207694_11016852
717 Ga0207650_10000063
718 Ga0207659_10296127
719 Ga0207687_10005580
720 Ga0207687_10259048
721 Ga0207687_10465243
722 Ga0207687_11057513
723 Ga0207644_10008649
724 Ga0207690_10018979
725 Ga0207690_11067111
726 Ga0207706_10000698
727 Ga0207706_10001575
728 Ga0207706_10005346
729 Ga0207686_10090261
730 Ga0207670_10059797
731 Ga0207670_10083113
732 Ga0207669_10129488
733 Ga0207669_10325455
734 Ga0207669_10633065
735 Ga0207665_10102271
736 Ga0207665_10541161
737 Ga0207711_10010872
738 Ga0207711_10298616
739 Ga0207689_10000199
740 Ga0207689_10033987
741 Ga0207661_10000571
742 Ga0207661_10152108
743 Ga0207661_11581386
744 Ga0207667_10015081
745 Ga0207667_10197938
746 Ga0207651_10410632
747 Ga0207668_10161687
748 Ga0207640_10120696
749 Ga0207658_10268299
750 Ga0207658_10359753
751 Ga0207677_10004891
752 Ga0207703_10092601
753 Ga0207703_10228478
754 Ga0207639_10105657
755 Ga0207639_10403894
756 Ga0207639_10435870
757 Ga0207678_10000516
758 Ga0207678_10003097
759 Ga0207708_10013933
760 Ga0207708_10219224
761 Ga0207702_10453020
762 Ga0207641_10000361
763 Ga0207648_10038770
764 Ga0207648_10049337
765 Ga0207676_10000306
766 Ga0207676_10193834
767 Ga0207674_10000034
768 Ga0207674_10018519
769 Ga0207675_100030948
770 Ga0207675_100070814
771 Ga0207675_100081242
772 Ga0207683_10001318
773 Ga0207698_10000248
774 Ga0207698_10028401
775 Ga0207698_11412312
776 Ga0207428_10360801
777 Ga0268266_10006180
778 Ga0268266_11222362
779 Ga0268265_10004061
780 Ga0268265_10019865
781 Ga0268264_10040208
782 Ga0268264_10189410
783 Ga0268264_10520269
784 Ga0268264_11148373
785 Ga0265338_10129345
786 Ga0265338_10277810
787 Ga0265338_10386623
788 Ga0265760_10003237
789 Ga0265340_10148761
790 Ga0265339_10101907
791 Ga0265339_10134824
792 Ga0265331_10366394
793 Ga0265316_10429985
794 Ga0307408_101972664
795 Ga0307405_11101150
796 Ga0307406_10188719
797 Ga0307416_100183494
798 Ga0307416_101252307
799 Ga0373930_0012139
800 Ga0373948_0026444
801 Ga0373928_0011990
802 Ga0373934_0179664
803 Ga0373932_0118275
804 Ga0373960_0022259
805 Ga0373955_0016939
806 Ga0373955_0164517
807 Ga0373961_0115509
808 Ga0373962_0018136
809 Ga0373931_0089190
810 Ga0373931_0492389
811 Ga0373933_0168509
812 Ga0373933_1097324
813 Ga0373947_0373436
814 Ga0373937_0201245
815 Ga0395898_0017016
816 Ga0395898_0136073
817 Ga0395898_0202308
818 Ga0395905_0217235
819 Ga0395901_0096716
820 Ga0395901_0506175
821 Ga0242420_021231
822 Ga0436363_0812496
823 Ga0451853_3833747
824 Ga0453683_0269044
825 Ga0466963_0190429
826 Ga0466963_0409775
827 Ga0453684_2151095
828 Ga0466957_0469593
829 Ga0466960_0199133
830 Ga0466967_0247816
831 Ga0466967_1386454
832 Ga0466967_1530626
833 Ga0495651_0209643
834 Ga0495651_0528140
835 Ga0495580_0063252
836 Ga0495580_0381065
837 Ga0495580_0410578
838 Ga0495580_0427990
839 Ga0495657_0348337
840 Ga0495623_0572724
841 Ga0496100_0150376
842 Ga0496101_0015887
843 Ga0496101_0544935
844 Ga0496102_0084613
845 Ga0496102_0122292
846 Ga0496102_0549564
847 Ga0496103_0328807
848 Ga0496103_0330217
849 Ga0496103_0350306
850 Ga0496104_0094925
851 Ga0496105_0093853
852 Ga0496105_1353476
853 Ga0496106_0078228
854 Ga0496106_0335323
855 Ga0496108_0000038
856 Ga0496108_0002184
857 Ga0496109_0000082
858 Ga0496109_0019767
859 Ga0496110_0036102
860 Ga0496110_0046177
861 Ga0496111_0000438
862 Ga0496111_0024433
863 Ga0496112_0000220
864 Ga0496112_0040149
865 Ga0496113_0001335
866 Ga0496113_0058138
867 Ga0496113_0225356
868 Ga0496113_0253130
869 Ga0496114_0003888
870 Ga0496115_0072687
871 Ga0496115_0311200
872 Ga0496115_0487635
873 Ga0501271_054167
874 nmdc:mga0qj67_85281_c1
875 nmdc:mga06r32_124911_c1
876 nmdc:mga08y16_17179_c1
877 nmdc:mga0n895_110481_c1
878 nmdc:mga0rr50_758473_c1
879 nmdc:mga08x19_84642_c1
880 Ga0495601_0432576
881 Ga0500554_012925
882 Ga0500628_000303

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12802

MarR_2

MarR family

54

113

0.97

PF01047

MarR

MarR family

56

114

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.955 42 102
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9325 43 102
5duk-assembly1.cif.gz_A n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 0.9322 43 92
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9308 48 101
1z6r-assembly1.cif.gz_A crystal structure of mlc from escherichia coli 0.9281 42 86
ID Description Score Start End Superfamily
af_P30852_292_361_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9868 56 89 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9674 39 100 1.10.10.10
4kmfA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.955 42 102 1.10.10.10
af_K7LWV0_206_275_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9526 56 86 1.10.10.10
af_B4FTK6_47_112_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9522 43 102 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V9YFT0-F1-model_v4 MarR family transcriptional regulator 0.9832 15 150 GO:0003700
AF-A0A2V9U375-F1-model_v4 MarR family transcriptional regulator 0.9798 15 150 GO:0003700
AF-A0A538CA45-F1-model_v4 MarR family transcriptional regulator 0.9731 15 150 GO:0003700
AF-A0A2V8XV92-F1-model_v4 MarR family transcriptional regulator 0.97 15 150 GO:0003700
AF-A0A6G7Z5J5-F1-model_v4 MarR family transcriptional regulator 0.9675 9 148 GO:0003700

Map