F444517

General Info

Members Datasets Scaffolds Average Seq Length
440 273 880 124

Family's Representative Sequence

Representative Sequence 3300049573|Ga0501037_0870527|Ga0501037_0870527_47_445
Length 132
Sequence MGDRRQHPGLDLILRRFERPDETREMVKGRFELVRIGGITIGRAAYEPGWKWSEHVGPAVGAERCSVEHVGLVLAGTATVAFADRVIEMRAGDLFYVPPEPHDSWVVGDTPYVSLHFLGADHYATAGGPSPR

Samples

Sample ID Description Type Environment
1 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
127 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
203 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
204 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
205 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
206 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
207 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
208 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
210 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
211 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
217 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
218 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
219 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
220 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
221 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
222 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
223 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
224 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
227 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
228 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
229 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
230 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
231 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
253 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
254 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
255 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
258 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
261 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
262 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
269 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
273 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 2.95
Rhizosphere 94.77
Stem 0
Stem Tuber 0
Unclassified 14.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501037_0870527 3300049573 Bacteria 592
2 MBSR1b_contig_8896741 2162886012 Bacteria 1236
3 JGI24747J21853_1029073 3300001978 Unclassified 627
4 JGI24737J22298_10173423 3300001990 Unclassified 636
5 JGI24743J22301_10022092 3300001991 Bacteria 1218
6 JGI24748J21848_1013433 3300002074 Bacteria 968
7 JGI24749J21850_1024678 3300002076 Bacteria 856
8 JGI24034J26672_10062389 3300002239 Unclassified 657
9 JGI24751J29686_10004470 3300002459 Bacteria 2842
10 JGI25165J46597_1023406 3300003214 Bacteria 803
11 rootL2_10229461 3300003322 Bacteria 1277
12 Ga0065712_10171955 3300005290 Unclassified 1239
13 Ga0065712_10176307 3300005290 Bacteria 1145
14 Ga0070658_10010344 3300005327 Bacteria 7483
15 Ga0070658_11565107 3300005327 Bacteria 571
16 Ga0070676_10001878 3300005328 Bacteria 10675
17 Ga0070683_100027756 3300005329 Bacteria 5108
18 Ga0070683_100053699 3300005329 Bacteria 3734
19 Ga0070690_100002145 3300005330 Bacteria 10531
20 Ga0070690_100164700 3300005330 Bacteria 1522
21 Ga0070670_100031526 3300005331 Bacteria 4566
22 Ga0070677_10001016 3300005333 Bacteria 9061
23 Ga0068869_100038121 3300005334 Bacteria 3422
24 Ga0068869_100358708 3300005334 Unclassified 1190
25 Ga0068869_100448786 3300005334 Bacteria 1069
26 Ga0068869_100838337 3300005334 Unclassified 792
27 Ga0070666_10001413 3300005335 Bacteria 14525
28 Ga0070666_10053027 3300005335 Bacteria 2734
29 Ga0070682_100158630 3300005337 Bacteria 1560
30 Ga0068868_100021228 3300005338 Bacteria 4890
31 Ga0068868_100161902 3300005338 Bacteria 1848
32 Ga0070660_100000446 3300005339 Bacteria 27489
33 Ga0070689_100026056 3300005340 Bacteria 4398
34 Ga0070689_100249244 3300005340 Bacteria 1465
35 Ga0070691_10041504 3300005341 Bacteria 2175
36 Ga0070687_100000065 3300005343 Bacteria 34403
37 Ga0070687_100996344 3300005343 Bacteria 607
38 Ga0070661_100000398 3300005344 Bacteria 33684
39 Ga0070692_10034908 3300005345 Bacteria 2543
40 Ga0070692_10123448 3300005345 Unclassified 1447
41 Ga0070668_100000515 3300005347 Bacteria 25626
42 Ga0070669_100001665 3300005353 Bacteria 16082
43 Ga0070669_100604164 3300005353 Unclassified 919
44 Ga0070675_100171638 3300005354 Bacteria 1870
45 Ga0070675_100468816 3300005354 Unclassified 1131
46 Ga0070675_100841430 3300005354 Bacteria 839
47 Ga0070671_100003853 3300005355 Bacteria 11790
48 Ga0070671_100119687 3300005355 Bacteria 2215
49 Ga0070674_100002251 3300005356 Bacteria 10638
50 Ga0070673_101807540 3300005364 Bacteria 579
51 Ga0070688_100007745 3300005365 Bacteria 5799
52 Ga0070659_100001135 3300005366 Bacteria 19415
53 Ga0070667_100005215 3300005367 Bacteria 10861
54 Ga0070667_100051788 3300005367 Bacteria 3462
55 Ga0070703_10028229 3300005406 Bacteria 1676
56 Ga0070714_100000827 3300005435 Bacteria 21893
57 Ga0070714_100001989 3300005435 Bacteria 14930
58 Ga0070714_100488345 3300005435 Unclassified 1173
59 Ga0070713_100225334 3300005436 Bacteria 1702
60 Ga0070713_101636915 3300005436 Unclassified 625
61 Ga0070701_10004832 3300005438 Bacteria 5508
62 Ga0070711_100020346 3300005439 Bacteria 4276
63 Ga0070705_100003520 3300005440 Bacteria 7664
64 Ga0070705_100015204 3300005440 Bacteria 3973
65 Ga0070700_100052544 3300005441 Bacteria 2541
66 Ga0070694_100101634 3300005444 Bacteria 2034
67 Ga0070708_100171191 3300005445 Bacteria 2027
68 Ga0070708_100461848 3300005445 Bacteria 1198
69 Ga0070708_100664550 3300005445 Bacteria 981
70 Ga0070663_100000459 3300005455 Bacteria 21594
71 Ga0070663_100654588 3300005455 Bacteria 889
72 Ga0070678_100007124 3300005456 Bacteria 6611
73 Ga0070678_100277387 3300005456 Bacteria 1416
74 Ga0070678_100318839 3300005456 Bacteria 1327
75 Ga0070662_100001745 3300005457 Bacteria 13376
76 Ga0070681_10515514 3300005458 Unclassified 1109
77 Ga0070681_10518331 3300005458 Unclassified 1105
78 Ga0070685_10000852 3300005466 Bacteria 16605
79 Ga0070706_100063032 3300005467 Unclassified 3425
80 Ga0070706_100105519 3300005467 Bacteria 2621
81 Ga0070707_100114993 3300005468 Bacteria 2611
82 Ga0070707_100178595 3300005468 Unclassified 2069
83 Ga0070698_100008164 3300005471 Bacteria 11319
84 Ga0070698_100106076 3300005471 Unclassified 2779
85 Ga0070698_100287263 3300005471 Bacteria 1576
86 Ga0070679_100341408 3300005530 Unclassified 1446
87 Ga0070684_100004761 3300005535 Bacteria 10370
88 Ga0070684_100553633 3300005535 Bacteria 1067
89 Ga0070697_100032863 3300005536 Bacteria 4177
90 Ga0070697_100053091 3300005536 Bacteria 3294
91 Ga0070697_100100480 3300005536 Bacteria 2402
92 Ga0070697_100585983 3300005536 Bacteria 979
93 Ga0068853_100000254 3300005539 Bacteria 37416
94 Ga0068853_101749058 3300005539 Bacteria 603
95 Ga0070672_100017468 3300005543 Bacteria 5165
96 Ga0070672_101555013 3300005543 Bacteria 593
97 Ga0070686_100013239 3300005544 Bacteria 4717
98 Ga0070695_100282253 3300005545 Bacteria 1221
99 Ga0070695_100814642 3300005545 Unclassified 749
100 Ga0070696_100004255 3300005546 Bacteria 9548
101 Ga0070696_101082787 3300005546 Bacteria 673
102 Ga0070693_100088515 3300005547 Bacteria 1862
103 Ga0070693_101099132 3300005547 Unclassified 606
104 Ga0070665_100031443 3300005548 Bacteria 5343
105 Ga0070704_100030294 3300005549 Bacteria 3624
106 Ga0068855_100001561 3300005563 Bacteria 28787
107 Ga0070664_100000108 3300005564 Bacteria 53982
108 Ga0070664_100009997 3300005564 Bacteria 7690
109 Ga0068857_100006613 3300005577 Bacteria 9955
110 Ga0068857_100006654 3300005577 Bacteria 9931
111 Ga0068854_100003994 3300005578 Bacteria 9256
112 Ga0070702_100048996 3300005615 Bacteria 2407
113 Ga0068859_100066599 3300005617 Bacteria 3637
114 Ga0068859_100788171 3300005617 Bacteria 1038
115 Ga0068859_101761310 3300005617 Bacteria 684
116 Ga0068859_102608625 3300005617 Unclassified 556
117 Ga0068864_100000877 3300005618 Bacteria 25308
118 Ga0068864_100054278 3300005618 Bacteria 3458
119 Ga0068864_100258635 3300005618 Bacteria 1619
120 Ga0068864_100796416 3300005618 Bacteria 928
121 Ga0068866_10000784 3300005718 Bacteria 14226
122 Ga0068866_10905053 3300005718 Bacteria 621
123 Ga0068861_100003250 3300005719 Bacteria 10757
124 Ga0068851_10000329 3300005834 Bacteria 21551
125 Ga0068870_10066844 3300005840 Bacteria 1949
126 Ga0068863_100004462 3300005841 Bacteria 13798
127 Ga0068863_100098597 3300005841 Bacteria 2775
128 Ga0068858_100081776 3300005842 Bacteria 3002
129 Ga0068858_100708089 3300005842 Bacteria 980
130 Ga0068858_100803205 3300005842 Unclassified 918
131 Ga0068860_100003535 3300005843 Bacteria 16077
132 Ga0068860_100149349 3300005843 Bacteria 2250
133 Ga0068862_100165808 3300005844 Bacteria 1975
134 Ga0068862_100324583 3300005844 Bacteria 1422
135 Ga0081540_1000069 3300005983 Bacteria 111562
136 Ga0081540_1000351 3300005983 Bacteria 46620
137 Ga0081540_1000908 3300005983 Bacteria 26739
138 Ga0070717_10075826 3300006028 Bacteria 2813
139 Ga0070715_10222664 3300006163 Unclassified 971
140 Ga0070716_100095523 3300006173 Bacteria 1809
141 Ga0070716_100560975 3300006173 Bacteria 853
142 Ga0070712_100577697 3300006175 Bacteria 949
143 Ga0097621_100142411 3300006237 Bacteria 2049
144 Ga0097621_100403993 3300006237 Unclassified 1223
145 Ga0097621_101561094 3300006237 Bacteria 627
146 Ga0068871_100005856 3300006358 Bacteria 8642
147 Ga0075428_100078846 3300006844 Bacteria 3595
148 Ga0075430_100108827 3300006846 Bacteria 2312
149 Ga0075430_100112294 3300006846 Bacteria 2272
150 Ga0075430_100454008 3300006846 Unclassified 1058
151 Ga0075431_100067561 3300006847 Bacteria 3690
152 Ga0075431_100068840 3300006847 Bacteria 3652
153 Ga0075431_100106757 3300006847 Bacteria 2889
154 Ga0075431_100773047 3300006847 Unclassified 935
155 Ga0075431_101705831 3300006847 Unclassified 587
156 Ga0075433_10133962 3300006852 Unclassified 2202
157 Ga0075433_11750611 3300006852 Unclassified 535
158 Ga0075434_100270328 3300006871 Bacteria 1719
159 Ga0075429_100065688 3300006880 Bacteria 3159
160 Ga0068865_100000473 3300006881 Bacteria 22470
161 Ga0068865_101281852 3300006881 Unclassified 651
162 Ga0097620_100066599 3300006931 Bacteria 3637
163 Ga0097620_100788176 3300006931 Bacteria 1038
164 Ga0097620_101761718 3300006931 Bacteria 684
165 Ga0097620_102608492 3300006931 Unclassified 556
166 Ga0075435_100873173 3300007076 Unclassified 784
167 Ga0105250_10006035 3300009092 Bacteria 5339
168 Ga0105240_10001833 3300009093 Bacteria 35581
169 Ga0111539_10148236 3300009094 Unclassified 2747
170 Ga0111539_10836121 3300009094 Unclassified 1071
171 Ga0105245_10000280 3300009098 Bacteria 48458
172 Ga0105247_10004247 3300009101 Bacteria 9182
173 Ga0114129_10161816 3300009147 Unclassified 3057
174 Ga0114129_10291382 3300009147 Bacteria 2178
175 Ga0114129_11788832 3300009147 Unclassified 747
176 Ga0105243_10003914 3300009148 Bacteria 11880
177 Ga0105241_10005517 3300009174 Bacteria 9347
178 Ga0105241_10054222 3300009174 Bacteria 3068
179 Ga0105242_10002486 3300009176 Bacteria 14444
180 Ga0105242_10213582 3300009176 Bacteria 1721
181 Ga0105248_10001972 3300009177 Bacteria 22812
182 Ga0105248_10077218 3300009177 Bacteria 3744
183 Ga0105248_10628098 3300009177 Unclassified 1212
184 Ga0105248_11109561 3300009177 Unclassified 894
185 Ga0105237_10000240 3300009545 Bacteria 77901
186 Ga0105238_10012454 3300009551 Bacteria 8578
187 Ga0105249_10000800 3300009553 Bacteria 28288
188 Ga0105249_11091725 3300009553 Bacteria 868
189 Ga0105249_12765492 3300009553 Unclassified 562
190 Ga0105239_10011098 3300010375 Bacteria 10054
191 Ga0105246_10019689 3300011119 Bacteria 4318
192 Ga0105246_10082264 3300011119 Bacteria 2297
193 Ga0157373_10001623 3300013100 Bacteria 17156
194 Ga0157373_10002100 3300013100 Bacteria 15087
195 Ga0157371_10000524 3300013102 Bacteria 45827
196 Ga0157369_10000929 3300013105 Bacteria 37254
197 Ga0157369_10463004 3300013105 Bacteria 1313
198 Ga0157374_10002830 3300013296 Bacteria 14551
199 Ga0157374_10256465 3300013296 Bacteria 1721
200 Ga0157378_10000561 3300013297 Bacteria 35280
201 Ga0157378_10001713 3300013297 Bacteria 19722
202 Ga0157378_10574186 3300013297 Bacteria 1136
203 Ga0157378_10956952 3300013297 Bacteria 889
204 Ga0163162_10047795 3300013306 Bacteria 4287
205 Ga0163162_10074354 3300013306 Bacteria 3457
206 Ga0157372_10009352 3300013307 Bacteria 10432
207 Ga0157375_10047235 3300013308 Bacteria 4203
208 Ga0157375_11854433 3300013308 Bacteria 715
209 Ga0163163_10002780 3300014325 Bacteria 14778
210 Ga0163163_10280333 3300014325 Bacteria 1718
211 Ga0157380_10073165 3300014326 Bacteria 2778
212 Ga0157380_10923600 3300014326 Unclassified 900
213 Ga0157380_11113597 3300014326 Bacteria 829
214 Ga0157377_10000250 3300014745 Bacteria 26631
215 Ga0157377_10062023 3300014745 Bacteria 2138
216 Ga0157379_10000550 3300014968 Bacteria 30219
217 Ga0157379_10178303 3300014968 Bacteria 1919
218 Ga0157376_10006402 3300014969 Bacteria 8319
219 Ga0157376_10127805 3300014969 Bacteria 2263
220 Ga0157376_10716179 3300014969 Bacteria 1007
221 Ga0163161_10013772 3300017792 Bacteria 5634
222 Ga0213872_10068210 3300021361 Bacteria 1605
223 Ga0213874_10013658 3300021377 Bacteria 2109
224 Ga0213874_10014689 3300021377 Bacteria 2052
225 Ga0207697_10001133 3300025315 Bacteria 14684
226 Ga0207656_10001117 3300025321 Bacteria 8811
227 Ga0207653_10094241 3300025885 Bacteria 1052
228 Ga0207653_10101129 3300025885 Bacteria 1020
229 Ga0207682_10000080 3300025893 Bacteria 42569
230 Ga0207642_10000482 3300025899 Bacteria 12241
231 Ga0207710_10003374 3300025900 Bacteria 7138
232 Ga0207688_10000125 3300025901 Bacteria 31897
233 Ga0207680_10133324 3300025903 Bacteria 1639
234 Ga0207647_10000872 3300025904 Bacteria 23363
235 Ga0207699_11054359 3300025906 Unclassified 601
236 Ga0207645_10000201 3300025907 Bacteria 48793
237 Ga0207643_10000288 3300025908 Bacteria 35045
238 Ga0207643_10002691 3300025908 Bacteria 9602
239 Ga0207705_10005646 3300025909 Bacteria 9341
240 Ga0207684_10017342 3300025910 Bacteria 6177
241 Ga0207684_10034603 3300025910 Unclassified 4292
242 Ga0207654_10010212 3300025911 Bacteria 4778
243 Ga0207707_10330013 3300025912 Bacteria 1316
244 Ga0207695_10026878 3300025913 Bacteria 6416
245 Ga0207671_10004945 3300025914 Bacteria 12499
246 Ga0207663_10043358 3300025916 Bacteria 2754
247 Ga0207662_10000010 3300025918 Bacteria 91647
248 Ga0207657_10000355 3300025919 Bacteria 48874
249 Ga0207649_10009702 3300025920 Bacteria 5272
250 Ga0207649_10067055 3300025920 Bacteria 2277
251 Ga0207652_10306993 3300025921 Unclassified 1432
252 Ga0207646_10020688 3300025922 Bacteria 6094
253 Ga0207646_10302342 3300025922 Bacteria 1445
254 Ga0207681_10000442 3300025923 Bacteria 28975
255 Ga0207694_10888964 3300025924 Unclassified 753
256 Ga0207650_10000488 3300025925 Bacteria 33011
257 Ga0207650_10008495 3300025925 Bacteria 7011
258 Ga0207659_10000546 3300025926 Bacteria 22479
259 Ga0207659_10030545 3300025926 Bacteria 3683
260 Ga0207687_10001978 3300025927 Bacteria 14083
261 Ga0207700_10280784 3300025928 Bacteria 1432
262 Ga0207664_10001586 3300025929 Bacteria 14949
263 Ga0207664_10008277 3300025929 Bacteria 7245
264 Ga0207644_10000338 3300025931 Bacteria 30378
265 Ga0207644_10151091 3300025931 Bacteria 1797
266 Ga0207644_10438934 3300025931 Bacteria 1071
267 Ga0207690_10001586 3300025932 Bacteria 14202
268 Ga0207690_10843061 3300025932 Bacteria 759
269 Ga0207706_10000077 3300025933 Bacteria 102336
270 Ga0207686_10012626 3300025934 Bacteria 4647
271 Ga0207709_10002081 3300025935 Bacteria 12906
272 Ga0207670_10014426 3300025936 Bacteria 4690
273 Ga0207670_10453257 3300025936 Bacteria 1035
274 Ga0207669_10001938 3300025937 Bacteria 8775
275 Ga0207704_10001771 3300025938 Bacteria 9668
276 Ga0207704_10284905 3300025938 Bacteria 1258
277 Ga0207665_10023985 3300025939 Bacteria 4020
278 Ga0207691_10000033 3300025940 Bacteria 115126
279 Ga0207691_10540095 3300025940 Bacteria 989
280 Ga0207711_10000361 3300025941 Bacteria 48220
281 Ga0207711_10111359 3300025941 Unclassified 2435
282 Ga0207711_10161687 3300025941 Bacteria 2027
283 Ga0207711_10436122 3300025941 Bacteria 1219
284 Ga0207689_10000232 3300025942 Bacteria 49618
285 Ga0207689_10135553 3300025942 Bacteria 2027
286 Ga0207661_10001691 3300025944 Bacteria 15054
287 Ga0207661_10046826 3300025944 Bacteria 3430
288 Ga0207679_10000113 3300025945 Bacteria 65633
289 Ga0207679_10013720 3300025945 Bacteria 5313
290 Ga0207667_10019545 3300025949 Bacteria 7559
291 Ga0207651_10000848 3300025960 Bacteria 13311
292 Ga0207712_10001542 3300025961 Bacteria 15583
293 Ga0207712_10898816 3300025961 Bacteria 782
294 Ga0207712_11482540 3300025961 Unclassified 607
295 Ga0207668_10084871 3300025972 Bacteria 2308
296 Ga0207640_10023407 3300025981 Bacteria 3711
297 Ga0207658_10004325 3300025986 Bacteria 9886
298 Ga0207677_10000346 3300026023 Bacteria 32732
299 Ga0207677_10156326 3300026023 Bacteria 1766
300 Ga0207703_10000293 3300026035 Bacteria 54982
301 Ga0207703_10175164 3300026035 Bacteria 1889
302 Ga0207703_10830728 3300026035 Unclassified 883
303 Ga0207639_10000799 3300026041 Bacteria 21367
304 Ga0207678_10000135 3300026067 Bacteria 61373
305 Ga0207678_10029873 3300026067 Bacteria 4759
306 Ga0207708_10060165 3300026075 Bacteria 2899
307 Ga0207702_10011434 3300026078 Bacteria 7398
308 Ga0207641_10001355 3300026088 Bacteria 24285
309 Ga0207641_10026746 3300026088 Bacteria 4762
310 Ga0207648_10000387 3300026089 Bacteria 48794
311 Ga0207676_10001108 3300026095 Bacteria 20366
312 Ga0207676_10127824 3300026095 Bacteria 2155
313 Ga0207676_10138099 3300026095 Bacteria 2083
314 Ga0207676_10679306 3300026095 Bacteria 996
315 Ga0207674_10000224 3300026116 Bacteria 70660
316 Ga0207674_10042479 3300026116 Bacteria 4696
317 Ga0207675_100000043 3300026118 Bacteria 89667
318 Ga0207675_100119582 3300026118 Bacteria 2492
319 Ga0207683_10000232 3300026121 Bacteria 49365
320 Ga0207683_10006158 3300026121 Bacteria 10283
321 Ga0207683_10109256 3300026121 Bacteria 2475
322 Ga0207698_10006893 3300026142 Bacteria 7108
323 Ga0268266_10001211 3300028379 Bacteria 31826
324 Ga0268266_10064111 3300028379 Bacteria 3173
325 Ga0268265_10000746 3300028380 Bacteria 31751
326 Ga0268265_10158914 3300028380 Bacteria 1917
327 Ga0268264_10000771 3300028381 Bacteria 35394
328 Ga0268264_10311179 3300028381 Bacteria 1486
329 Ga0265338_10001847 3300028800 Bacteria 33253
330 Ga0307405_10214784 3300031731 Bacteria 1407
331 Ga0307405_10373112 3300031731 Bacteria 1108
332 Ga0307413_10543279 3300031824 Bacteria 941
333 Ga0307410_10080265 3300031852 Bacteria 2288
334 Ga0307406_10597980 3300031901 Bacteria 909
335 Ga0307409_100186186 3300031995 Bacteria 1843
336 Ga0307416_100179430 3300032002 Unclassified 1983
337 Ga0307416_100375629 3300032002 Bacteria 1449
338 Ga0307411_10208764 3300032005 Bacteria 1506
339 Ga0307411_11002925 3300032005 Bacteria 748
340 Ga0307415_100462348 3300032126 Bacteria 1100
341 Ga0373959_0140214 3300034820 Bacteria 605
342 Ga0373938_0023777 3300034957 Unclassified 1262
343 Ga0373926_0070979 3300035083 Bacteria 1280
344 Ga0373939_0394368 3300035114 Bacteria 572
345 Ga0373935_0197998 3300035692 Bacteria 1387
346 Ga0373933_0047967 3300035724 Bacteria 2542
347 Ga0373947_0449330 3300035725 Bacteria 873
348 Ga0373937_0290861 3300036401 Bacteria 1544
349 Ga0373925_0787453 3300037068 Bacteria 784
350 Ga0395905_0034871 3300037471 Bacteria 4724
351 Ga0395905_1336262 3300037471 Bacteria 621
352 Ga0395901_0437981 3300038443 Bacteria 1338
353 Ga0436365_1844273 3300039437 Bacteria 1631
354 Ga0436360_0251032 3300039438 Bacteria 1428
355 Ga0436360_0629082 3300039438 Bacteria 1631
356 Ga0436360_1101180 3300039438 Unclassified 926
357 Ga0436361_0526570 3300039447 Bacteria 8269
358 Ga0436361_1189375 3300039447 Unclassified 582
359 Ga0436363_0096207 3300039450 Bacteria 13251
360 Ga0436363_0869252 3300039450 Bacteria 1347
361 Ga0436363_1602129 3300039450 Bacteria 16779
362 Ga0436363_1628994 3300039450 Bacteria 2566
363 Ga0436362_0544676 3300039453 Bacteria 2630
364 Ga0451851_0515393 3300041507 Bacteria 534
365 Ga0439448_0041485 3300042005 Bacteria 1489
366 Ga0439435_0096213 3300042436 Bacteria 905
367 Ga0451577_0110730 3300042876 Bacteria 2456
368 Ga0466963_0902647 3300044694 Bacteria 623
369 Ga0451576_0097744 3300045051 Bacteria 3053
370 Ga0495580_0930191 3300046472 Bacteria 557
371 Ga0495639_0295719 3300046475 Bacteria 807
372 Ga0495662_0678235 3300046476 Bacteria 503
373 Ga0495628_0500401 3300046516 Bacteria 878
374 Ga0495630_0659664 3300046517 Bacteria 801
375 Ga0495598_0273690 3300046537 Unclassified 632
376 Ga0495658_0135934 3300046683 Bacteria 1500
377 Ga0495658_0200915 3300046683 Bacteria 1242
378 Ga0495676_0126262 3300047321 Bacteria 1854
379 Ga0496100_0108790 3300048903 Bacteria 1923
380 Ga0496102_0008372 3300048905 Bacteria 8857
381 Ga0496102_1292634 3300048905 Bacteria 649
382 Ga0496103_0026912 3300048906 Bacteria 3482
383 Ga0496106_0009616 3300048909 Bacteria 7140
384 Ga0496107_0159158 3300048910 Unclassified 1673
385 Ga0496108_0109373 3300048911 Bacteria 2362
386 Ga0496109_0008472 3300048912 Bacteria 8742
387 Ga0496109_1299000 3300048912 Bacteria 664
388 Ga0496112_0005154 3300048915 Bacteria 11239
389 Ga0496112_0125228 3300048915 Bacteria 2541
390 Ga0496113_0066086 3300048916 Bacteria 2738
391 Ga0496114_1287930 3300048917 Unclassified 618
392 Ga0501031_0551789 3300049568 Bacteria 742
393 Ga0501033_0313818 3300049570 Bacteria 1102
394 Ga0501036_0342788 3300049572 Bacteria 1248
395 Ga0501040_0055397 3300049576 Bacteria 2719
396 Ga0501040_0420731 3300049576 Unclassified 960
397 Ga0501041_0280539 3300049577 Unclassified 1048
398 Ga0501042_0352432 3300049578 Bacteria 1065
399 Ga0501048_0038591 3300049582 Unclassified 3427
400 Ga0501048_0185132 3300049582 Bacteria 1476
401 Ga0501070_0459725 3300049586 Bacteria 1026
402 Ga0501072_0794902 3300049588 Bacteria 741
403 Ga0501073_0098738 3300049589 Bacteria 2028
404 Ga0501074_0120538 3300049590 Bacteria 1876
405 Ga0501074_0199778 3300049590 Bacteria 1425
406 Ga0501075_0064951 3300049591 Bacteria 2753
407 Ga0501075_0286024 3300049591 Bacteria 1256
408 Ga0501076_0093581 3300049592 Bacteria 2419
409 Ga0501076_0224037 3300049592 Bacteria 1537
410 Ga0501076_0503135 3300049592 Bacteria 999
411 Ga0501076_0799069 3300049592 Bacteria 778
412 Ga0501077_0003564 3300049593 Bacteria 9357
413 Ga0501079_0253882 3300049741 Bacteria 1374
414 Ga0501080_0152861 3300049742 Bacteria 2133
415 Ga0501081_0068653 3300049743 Bacteria 2468
416 Ga0501283_082707 3300049779 Bacteria 606
417 Ga0501045_0126875 3300049824 Bacteria 1896
418 Ga0501045_1144921 3300049824 Bacteria 568
419 nmdc:mga05p37_1247831_c1 3300050507 Unclassified 763
420 nmdc:mga05p37_409495_c1 3300050507 Unclassified 1581
421 nmdc:mga09592_618288_c1 3300050508 Bacteria 927
422 nmdc:mga09592_8979_c1 3300050508 Bacteria 8128
423 nmdc:mga0qj67_25877_c1 3300050509 Bacteria 4538
424 nmdc:mga0qj67_420714_c1 3300050509 Unclassified 1077
425 nmdc:mga06r32_1022840_c1 3300050510 Unclassified 778
426 nmdc:mga06r32_1404892_c1 3300050510 Unclassified 640
427 nmdc:mga06r32_1538483_c1 3300050510 Unclassified 605
428 nmdc:mga06r32_53263_c1 3300050510 Bacteria 3877
429 nmdc:mga0n895_217921_c1 3300050512 Unclassified 1938
430 nmdc:mga0n895_294771_c1 3300050512 Bacteria 1644
431 nmdc:mga0rr50_903597_c1 3300050513 Unclassified 753
432 nmdc:mga0a205_1467076_c1 3300050515 Unclassified 530
433 nmdc:mga0a205_21850_c1 3300050515 Bacteria 6051
434 Ga0495619_0269510 3300053085 Bacteria 1180
435 Ga0495619_0484967 3300053085 Bacteria 851
436 Ga0501084_0006340 3300054114 Bacteria 9719
437 Ga0590077_004265 3300059426 Bacteria 2944
438 Ga0501082_0025649 3300060353 Bacteria 5079
439 Ga0501082_0056453 3300060353 Bacteria 3383
440 Ga0501082_0244874 3300060353 Bacteria 1560
441 Ga0501037_0870527
442 MBSR1b_contig_8896741
443 JGI24747J21853_1029073
444 JGI24737J22298_10173423
445 JGI24743J22301_10022092
446 JGI24748J21848_1013433
447 JGI24749J21850_1024678
448 JGI24034J26672_10062389
449 JGI24751J29686_10004470
450 JGI25165J46597_1023406
451 rootL2_10229461
452 Ga0065712_10171955
453 Ga0065712_10176307
454 Ga0070658_10010344
455 Ga0070658_11565107
456 Ga0070676_10001878
457 Ga0070683_100027756
458 Ga0070683_100053699
459 Ga0070690_100002145
460 Ga0070690_100164700
461 Ga0070670_100031526
462 Ga0070677_10001016
463 Ga0068869_100038121
464 Ga0068869_100358708
465 Ga0068869_100448786
466 Ga0068869_100838337
467 Ga0070666_10001413
468 Ga0070666_10053027
469 Ga0070682_100158630
470 Ga0068868_100021228
471 Ga0068868_100161902
472 Ga0070660_100000446
473 Ga0070689_100026056
474 Ga0070689_100249244
475 Ga0070691_10041504
476 Ga0070687_100000065
477 Ga0070687_100996344
478 Ga0070661_100000398
479 Ga0070692_10034908
480 Ga0070692_10123448
481 Ga0070668_100000515
482 Ga0070669_100001665
483 Ga0070669_100604164
484 Ga0070675_100171638
485 Ga0070675_100468816
486 Ga0070675_100841430
487 Ga0070671_100003853
488 Ga0070671_100119687
489 Ga0070674_100002251
490 Ga0070673_101807540
491 Ga0070688_100007745
492 Ga0070659_100001135
493 Ga0070667_100005215
494 Ga0070667_100051788
495 Ga0070703_10028229
496 Ga0070714_100000827
497 Ga0070714_100001989
498 Ga0070714_100488345
499 Ga0070713_100225334
500 Ga0070713_101636915
501 Ga0070701_10004832
502 Ga0070711_100020346
503 Ga0070705_100003520
504 Ga0070705_100015204
505 Ga0070700_100052544
506 Ga0070694_100101634
507 Ga0070708_100171191
508 Ga0070708_100461848
509 Ga0070708_100664550
510 Ga0070663_100000459
511 Ga0070663_100654588
512 Ga0070678_100007124
513 Ga0070678_100277387
514 Ga0070678_100318839
515 Ga0070662_100001745
516 Ga0070681_10515514
517 Ga0070681_10518331
518 Ga0070685_10000852
519 Ga0070706_100063032
520 Ga0070706_100105519
521 Ga0070707_100114993
522 Ga0070707_100178595
523 Ga0070698_100008164
524 Ga0070698_100106076
525 Ga0070698_100287263
526 Ga0070679_100341408
527 Ga0070684_100004761
528 Ga0070684_100553633
529 Ga0070697_100032863
530 Ga0070697_100053091
531 Ga0070697_100100480
532 Ga0070697_100585983
533 Ga0068853_100000254
534 Ga0068853_101749058
535 Ga0070672_100017468
536 Ga0070672_101555013
537 Ga0070686_100013239
538 Ga0070695_100282253
539 Ga0070695_100814642
540 Ga0070696_100004255
541 Ga0070696_101082787
542 Ga0070693_100088515
543 Ga0070693_101099132
544 Ga0070665_100031443
545 Ga0070704_100030294
546 Ga0068855_100001561
547 Ga0070664_100000108
548 Ga0070664_100009997
549 Ga0068857_100006613
550 Ga0068857_100006654
551 Ga0068854_100003994
552 Ga0070702_100048996
553 Ga0068859_100066599
554 Ga0068859_100788171
555 Ga0068859_101761310
556 Ga0068859_102608625
557 Ga0068864_100000877
558 Ga0068864_100054278
559 Ga0068864_100258635
560 Ga0068864_100796416
561 Ga0068866_10000784
562 Ga0068866_10905053
563 Ga0068861_100003250
564 Ga0068851_10000329
565 Ga0068870_10066844
566 Ga0068863_100004462
567 Ga0068863_100098597
568 Ga0068858_100081776
569 Ga0068858_100708089
570 Ga0068858_100803205
571 Ga0068860_100003535
572 Ga0068860_100149349
573 Ga0068862_100165808
574 Ga0068862_100324583
575 Ga0081540_1000069
576 Ga0081540_1000351
577 Ga0081540_1000908
578 Ga0070717_10075826
579 Ga0070715_10222664
580 Ga0070716_100095523
581 Ga0070716_100560975
582 Ga0070712_100577697
583 Ga0097621_100142411
584 Ga0097621_100403993
585 Ga0097621_101561094
586 Ga0068871_100005856
587 Ga0075428_100078846
588 Ga0075430_100108827
589 Ga0075430_100112294
590 Ga0075430_100454008
591 Ga0075431_100067561
592 Ga0075431_100068840
593 Ga0075431_100106757
594 Ga0075431_100773047
595 Ga0075431_101705831
596 Ga0075433_10133962
597 Ga0075433_11750611
598 Ga0075434_100270328
599 Ga0075429_100065688
600 Ga0068865_100000473
601 Ga0068865_101281852
602 Ga0097620_100066599
603 Ga0097620_100788176
604 Ga0097620_101761718
605 Ga0097620_102608492
606 Ga0075435_100873173
607 Ga0105250_10006035
608 Ga0105240_10001833
609 Ga0111539_10148236
610 Ga0111539_10836121
611 Ga0105245_10000280
612 Ga0105247_10004247
613 Ga0114129_10161816
614 Ga0114129_10291382
615 Ga0114129_11788832
616 Ga0105243_10003914
617 Ga0105241_10005517
618 Ga0105241_10054222
619 Ga0105242_10002486
620 Ga0105242_10213582
621 Ga0105248_10001972
622 Ga0105248_10077218
623 Ga0105248_10628098
624 Ga0105248_11109561
625 Ga0105237_10000240
626 Ga0105238_10012454
627 Ga0105249_10000800
628 Ga0105249_11091725
629 Ga0105249_12765492
630 Ga0105239_10011098
631 Ga0105246_10019689
632 Ga0105246_10082264
633 Ga0157373_10001623
634 Ga0157373_10002100
635 Ga0157371_10000524
636 Ga0157369_10000929
637 Ga0157369_10463004
638 Ga0157374_10002830
639 Ga0157374_10256465
640 Ga0157378_10000561
641 Ga0157378_10001713
642 Ga0157378_10574186
643 Ga0157378_10956952
644 Ga0163162_10047795
645 Ga0163162_10074354
646 Ga0157372_10009352
647 Ga0157375_10047235
648 Ga0157375_11854433
649 Ga0163163_10002780
650 Ga0163163_10280333
651 Ga0157380_10073165
652 Ga0157380_10923600
653 Ga0157380_11113597
654 Ga0157377_10000250
655 Ga0157377_10062023
656 Ga0157379_10000550
657 Ga0157379_10178303
658 Ga0157376_10006402
659 Ga0157376_10127805
660 Ga0157376_10716179
661 Ga0163161_10013772
662 Ga0213872_10068210
663 Ga0213874_10013658
664 Ga0213874_10014689
665 Ga0207697_10001133
666 Ga0207656_10001117
667 Ga0207653_10094241
668 Ga0207653_10101129
669 Ga0207682_10000080
670 Ga0207642_10000482
671 Ga0207710_10003374
672 Ga0207688_10000125
673 Ga0207680_10133324
674 Ga0207647_10000872
675 Ga0207699_11054359
676 Ga0207645_10000201
677 Ga0207643_10000288
678 Ga0207643_10002691
679 Ga0207705_10005646
680 Ga0207684_10017342
681 Ga0207684_10034603
682 Ga0207654_10010212
683 Ga0207707_10330013
684 Ga0207695_10026878
685 Ga0207671_10004945
686 Ga0207663_10043358
687 Ga0207662_10000010
688 Ga0207657_10000355
689 Ga0207649_10009702
690 Ga0207649_10067055
691 Ga0207652_10306993
692 Ga0207646_10020688
693 Ga0207646_10302342
694 Ga0207681_10000442
695 Ga0207694_10888964
696 Ga0207650_10000488
697 Ga0207650_10008495
698 Ga0207659_10000546
699 Ga0207659_10030545
700 Ga0207687_10001978
701 Ga0207700_10280784
702 Ga0207664_10001586
703 Ga0207664_10008277
704 Ga0207644_10000338
705 Ga0207644_10151091
706 Ga0207644_10438934
707 Ga0207690_10001586
708 Ga0207690_10843061
709 Ga0207706_10000077
710 Ga0207686_10012626
711 Ga0207709_10002081
712 Ga0207670_10014426
713 Ga0207670_10453257
714 Ga0207669_10001938
715 Ga0207704_10001771
716 Ga0207704_10284905
717 Ga0207665_10023985
718 Ga0207691_10000033
719 Ga0207691_10540095
720 Ga0207711_10000361
721 Ga0207711_10111359
722 Ga0207711_10161687
723 Ga0207711_10436122
724 Ga0207689_10000232
725 Ga0207689_10135553
726 Ga0207661_10001691
727 Ga0207661_10046826
728 Ga0207679_10000113
729 Ga0207679_10013720
730 Ga0207667_10019545
731 Ga0207651_10000848
732 Ga0207712_10001542
733 Ga0207712_10898816
734 Ga0207712_11482540
735 Ga0207668_10084871
736 Ga0207640_10023407
737 Ga0207658_10004325
738 Ga0207677_10000346
739 Ga0207677_10156326
740 Ga0207703_10000293
741 Ga0207703_10175164
742 Ga0207703_10830728
743 Ga0207639_10000799
744 Ga0207678_10000135
745 Ga0207678_10029873
746 Ga0207708_10060165
747 Ga0207702_10011434
748 Ga0207641_10001355
749 Ga0207641_10026746
750 Ga0207648_10000387
751 Ga0207676_10001108
752 Ga0207676_10127824
753 Ga0207676_10138099
754 Ga0207676_10679306
755 Ga0207674_10000224
756 Ga0207674_10042479
757 Ga0207675_100000043
758 Ga0207675_100119582
759 Ga0207683_10000232
760 Ga0207683_10006158
761 Ga0207683_10109256
762 Ga0207698_10006893
763 Ga0268266_10001211
764 Ga0268266_10064111
765 Ga0268265_10000746
766 Ga0268265_10158914
767 Ga0268264_10000771
768 Ga0268264_10311179
769 Ga0265338_10001847
770 Ga0307405_10214784
771 Ga0307405_10373112
772 Ga0307413_10543279
773 Ga0307410_10080265
774 Ga0307406_10597980
775 Ga0307409_100186186
776 Ga0307416_100179430
777 Ga0307416_100375629
778 Ga0307411_10208764
779 Ga0307411_11002925
780 Ga0307415_100462348
781 Ga0373959_0140214
782 Ga0373938_0023777
783 Ga0373926_0070979
784 Ga0373939_0394368
785 Ga0373935_0197998
786 Ga0373933_0047967
787 Ga0373947_0449330
788 Ga0373937_0290861
789 Ga0373925_0787453
790 Ga0395905_0034871
791 Ga0395905_1336262
792 Ga0395901_0437981
793 Ga0436365_1844273
794 Ga0436360_0251032
795 Ga0436360_0629082
796 Ga0436360_1101180
797 Ga0436361_0526570
798 Ga0436361_1189375
799 Ga0436363_0096207
800 Ga0436363_0869252
801 Ga0436363_1602129
802 Ga0436363_1628994
803 Ga0436362_0544676
804 Ga0451851_0515393
805 Ga0439448_0041485
806 Ga0439435_0096213
807 Ga0451577_0110730
808 Ga0466963_0902647
809 Ga0451576_0097744
810 Ga0495580_0930191
811 Ga0495639_0295719
812 Ga0495662_0678235
813 Ga0495628_0500401
814 Ga0495630_0659664
815 Ga0495598_0273690
816 Ga0495658_0135934
817 Ga0495658_0200915
818 Ga0495676_0126262
819 Ga0496100_0108790
820 Ga0496102_0008372
821 Ga0496102_1292634
822 Ga0496103_0026912
823 Ga0496106_0009616
824 Ga0496107_0159158
825 Ga0496108_0109373
826 Ga0496109_0008472
827 Ga0496109_1299000
828 Ga0496112_0005154
829 Ga0496112_0125228
830 Ga0496113_0066086
831 Ga0496114_1287930
832 Ga0501031_0551789
833 Ga0501033_0313818
834 Ga0501036_0342788
835 Ga0501040_0055397
836 Ga0501040_0420731
837 Ga0501041_0280539
838 Ga0501042_0352432
839 Ga0501048_0038591
840 Ga0501048_0185132
841 Ga0501070_0459725
842 Ga0501072_0794902
843 Ga0501073_0098738
844 Ga0501074_0120538
845 Ga0501074_0199778
846 Ga0501075_0064951
847 Ga0501075_0286024
848 Ga0501076_0093581
849 Ga0501076_0224037
850 Ga0501076_0503135
851 Ga0501076_0799069
852 Ga0501077_0003564
853 Ga0501079_0253882
854 Ga0501080_0152861
855 Ga0501081_0068653
856 Ga0501283_082707
857 Ga0501045_0126875
858 Ga0501045_1144921
859 nmdc:mga05p37_1247831_c1
860 nmdc:mga05p37_409495_c1
861 nmdc:mga09592_618288_c1
862 nmdc:mga09592_8979_c1
863 nmdc:mga0qj67_25877_c1
864 nmdc:mga0qj67_420714_c1
865 nmdc:mga06r32_1022840_c1
866 nmdc:mga06r32_1404892_c1
867 nmdc:mga06r32_1538483_c1
868 nmdc:mga06r32_53263_c1
869 nmdc:mga0n895_217921_c1
870 nmdc:mga0n895_294771_c1
871 nmdc:mga0rr50_903597_c1
872 nmdc:mga0a205_1467076_c1
873 nmdc:mga0a205_21850_c1
874 Ga0495619_0269510
875 Ga0495619_0484967
876 Ga0501084_0006340
877 Ga0590077_004265
878 Ga0501082_0025649
879 Ga0501082_0056453
880 Ga0501082_0244874

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02311

AraC_binding

AraC-like ligand binding domain

64

123

0.88

PF07883

Cupin_2

Cupin domain

46

117

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o5u-assembly2.cif.gz_B crystal structure of a duf861 family protein (tm1112) from thermotoga maritima at 1.83 a resolution 0.8124 40 116
3lwc-assembly1.cif.gz_A-2 crystal structure of structural genomics, unknown function (yp_766765.1) from rhizobium leguminosarum bv. viciae 3841 at 1.40 a resolution 0.8103 25 114
4zua-assembly2.cif.gz_B-2 crystal structure of the exsa regulatory domain 0.8066 38 116
2i45-assembly1.cif.gz_B crystal structure of protein nmb1881 from neisseria meningitidis 0.7977 28 114
7eym-assembly1.cif.gz_B crystal structure of vibrio cholerae ppnp 0.7871 25 116
ID Description Score Start End Superfamily
af_F1RAQ6_211_524_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8776 18 43 2.130.10.10
1o5uB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8124 40 116 2.60.120.10
5zbfA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7927 19 114 2.60.120.10
af_Q59WJ5_1_178_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7863 61 117 2.60.120.10
af_O48852_32_133_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7851 40 114 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1Q7DU16-F1-model_v4 Cupin 1 21 123
AF-A0A1Q7Y7E0-F1-model_v4 Cupin 0.9945 7 123
AF-A0A382FK91-F1-model_v4 Cupin type-2 domain-containing protein 0.9938 36 123
AF-A0A2V7M3S0-F1-model_v4 Cupin 0.9927 9 123
AF-A0A2V6L6K4-F1-model_v4 Cupin 0.9887 8 123

Map