F444513

General Info

Members Datasets Scaffolds Average Seq Length
440 232 880 376

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0052779|Ga0501031_0052779_1384_2607
Length 407
Sequence MAPTPEAPQEGAQAASAHARAVAPQEEALERLIGFGRELRRRGLPVGTGRIVTFCRAAGALGALDRTDLYWAGRSSLISRPEDAEAFDAAFDAWFREGSQDIGLPVAVPEDRGGPQGSTEGIEGLVLDEDRVVAKEWHALDGEDETEGEAAVRIVASAVEVLREKSFAELSEQERARVAHLIRRLAVRVPTRRTRRYRPASAGARFDVKRTIRRSLRTQGEPFHRAWRSRGTRSRPLVLILDISGSMAPFARALLQFAFAAMAAGRRVEVFCFGTRLTRXXXXLRTKDPDRAMHEVGRLVADWEGGTRIGESLKSLLDEWSQRAALRGAVAVICSDGLERGEPELMRDQMARLRRLVHRIVWVNPLKGSPRYEPLARGMAAALPSIDVFLPGHNLESLEELSRALGD

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
107 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
108 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
109 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
111 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
112 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
113 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
114 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
115 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
116 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
117 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
129 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
130 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
131 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
132 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
133 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
134 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
147 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
148 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
149 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
158 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
204 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
227 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
232 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.23
Rhizosphere 94.32
Stem 0
Stem Tuber 0
Unclassified 2.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0052779 3300049568 Bacteria 2649
2 JGI24751J29686_10011420 3300002459 Bacteria 1831
3 JGI25406J46586_10008826 3300003203 Bacteria 4540
4 Ga0070690_100015733 3300005330 Bacteria 4519
5 Ga0068869_100042535 3300005334 Bacteria 3257
6 Ga0070680_100046562 3300005336 Bacteria 3529
7 Ga0068868_100003426 3300005338 Bacteria 11038
8 Ga0068868_100033715 3300005338 Bacteria 3949
9 Ga0070661_100003993 3300005344 Bacteria 10144
10 Ga0070675_100090430 3300005354 Bacteria 2564
11 Ga0070703_10000001 3300005406 Bacteria 202194
12 Ga0070711_100016960 3300005439 Bacteria 4631
13 Ga0070700_100009549 3300005441 Bacteria 5333
14 Ga0070700_100062754 3300005441 Bacteria 2349
15 Ga0070694_100007426 3300005444 Bacteria 6687
16 Ga0070694_100024936 3300005444 Bacteria 3864
17 Ga0070708_100020817 3300005445 Bacteria 5537
18 Ga0070708_100050016 3300005445 Bacteria 3699
19 Ga0070708_100139279 3300005445 Bacteria 2249
20 Ga0070678_100021207 3300005456 Bacteria 4280
21 Ga0070678_100061719 3300005456 Unclassified 2764
22 Ga0070681_10172150 3300005458 Bacteria 2087
23 Ga0068867_100005574 3300005459 Bacteria 8918
24 Ga0070706_100003986 3300005467 Bacteria 14371
25 Ga0070706_100263758 3300005467 Bacteria 1608
26 Ga0070707_100004254 3300005468 Bacteria 13405
27 Ga0070707_100105687 3300005468 Bacteria 2729
28 Ga0070698_100014464 3300005471 Bacteria 8336
29 Ga0070698_100017333 3300005471 Bacteria 7589
30 Ga0070698_100017459 3300005471 Bacteria 7563
31 Ga0070698_100079492 3300005471 Bacteria 3276
32 Ga0070684_100008381 3300005535 Bacteria 8075
33 Ga0070697_100050261 3300005536 Bacteria 3384
34 Ga0070695_100102262 3300005545 Unclassified 1932
35 Ga0070696_100006769 3300005546 Bacteria 7652
36 Ga0070696_100029701 3300005546 Bacteria 3739
37 Ga0070696_100179752 3300005546 Bacteria 1569
38 Ga0070704_100020609 3300005549 Bacteria 4255
39 Ga0070704_100146620 3300005549 Bacteria 1850
40 Ga0070664_100007616 3300005564 Bacteria 8744
41 Ga0068857_100121415 3300005577 Bacteria 2353
42 Ga0068854_100166009 3300005578 Unclassified 1714
43 Ga0070702_100032764 3300005615 Bacteria 2854
44 Ga0070702_100057080 3300005615 Unclassified 2257
45 Ga0068861_100080070 3300005719 Bacteria 2555
46 Ga0068861_100096721 3300005719 Bacteria 2341
47 Ga0068863_100090335 3300005841 Bacteria 2904
48 Ga0068858_100087370 3300005842 Bacteria 2900
49 Ga0068860_100288958 3300005843 Bacteria 1604
50 Ga0068862_100029214 3300005844 Bacteria 4645
51 Ga0081455_10001540 3300005937 Bacteria 28386
52 Ga0081455_10001936 3300005937 Bacteria 24886
53 Ga0081455_10006642 3300005937 Bacteria 12367
54 Ga0081455_10022075 3300005937 Bacteria 5957
55 Ga0081538_10000472 3300005981 Bacteria 45179
56 Ga0081538_10005896 3300005981 Bacteria 10918
57 Ga0081538_10011823 3300005981 Bacteria 7046
58 Ga0081538_10014604 3300005981 Bacteria 6140
59 Ga0081539_10002098 3300005985 Bacteria 29700
60 Ga0081539_10012391 3300005985 Bacteria 6579
61 Ga0081539_10015126 3300005985 Bacteria 5642
62 Ga0081539_10043898 3300005985 Bacteria 2586
63 Ga0081539_10051836 3300005985 Bacteria 2309
64 Ga0075432_10001085 3300006058 Bacteria 8660
65 Ga0075428_100015175 3300006844 Bacteria 8545
66 Ga0075428_100023518 3300006844 Bacteria 6821
67 Ga0075428_100032550 3300006844 Bacteria 5760
68 Ga0075428_100167657 3300006844 Bacteria 2382
69 Ga0075430_100001342 3300006846 Bacteria 19895
70 Ga0075430_100022661 3300006846 Bacteria 5344
71 Ga0075431_100000600 3300006847 Bacteria 30378
72 Ga0075431_100015710 3300006847 Bacteria 7677
73 Ga0075433_10000145 3300006852 Bacteria 37425
74 Ga0075433_10043484 3300006852 Bacteria 3899
75 Ga0075433_10055294 3300006852 Bacteria 3464
76 Ga0075434_100000512 3300006871 Bacteria 29409
77 Ga0075434_100020246 3300006871 Bacteria 6449
78 Ga0075434_100029524 3300006871 Bacteria 5395
79 Ga0075434_100030341 3300006871 Bacteria 5323
80 Ga0075434_100077783 3300006871 Bacteria 3312
81 Ga0075434_100206252 3300006871 Bacteria 1986
82 Ga0075429_100017664 3300006880 Bacteria 6169
83 Ga0075429_100170290 3300006880 Bacteria 1907
84 Ga0068865_100047975 3300006881 Bacteria 2938
85 Ga0068865_100080866 3300006881 Bacteria 2332
86 Ga0075435_100000524 3300007076 Bacteria 23430
87 Ga0105251_10036773 3300009011 Bacteria 2406
88 Ga0111539_10005444 3300009094 Bacteria 16467
89 Ga0105245_10023819 3300009098 Bacteria 5374
90 Ga0114129_10000449 3300009147 Bacteria 49109
91 Ga0114129_10009394 3300009147 Bacteria 13938
92 Ga0114129_10016496 3300009147 Bacteria 10517
93 Ga0114129_10018569 3300009147 Bacteria 9900
94 Ga0114129_10025314 3300009147 Bacteria 8408
95 Ga0114129_10135776 3300009147 Bacteria 3375
96 Ga0105243_10007936 3300009148 Bacteria 8151
97 Ga0105243_10012214 3300009148 Bacteria 6493
98 Ga0105243_10041817 3300009148 Bacteria 3585
99 Ga0105243_10060248 3300009148 Bacteria 3032
100 Ga0105242_10003542 3300009176 Bacteria 12139
101 Ga0105242_10007856 3300009176 Bacteria 8210
102 Ga0105242_10035372 3300009176 Bacteria 4007
103 Ga0105248_10002332 3300009177 Bacteria 21050
104 Ga0105249_10016284 3300009553 Bacteria 6594
105 Ga0105246_10104169 3300011119 Bacteria 2072
106 Ga0105246_10194436 3300011119 Bacteria 1572
107 Ga0157378_10003829 3300013297 Bacteria 13307
108 Ga0157378_10100991 3300013297 Bacteria 2634
109 Ga0163162_10086780 3300013306 Bacteria 3207
110 Ga0157372_10195309 3300013307 Bacteria 2344
111 Ga0157375_10101773 3300013308 Bacteria 2957
112 Ga0157379_10005930 3300014968 Bacteria 10522
113 Ga0157376_10112383 3300014969 Bacteria 2400
114 Ga0163161_10220277 3300017792 Bacteria 1469
115 Ga0207653_10000004 3300025885 Bacteria 263142
116 Ga0207653_10011501 3300025885 Bacteria 2761
117 Ga0207710_10065226 3300025900 Bacteria 1659
118 Ga0207688_10013943 3300025901 Bacteria 4369
119 Ga0207645_10012909 3300025907 Bacteria 5653
120 Ga0207645_10169230 3300025907 Bacteria 1432
121 Ga0207643_10000324 3300025908 Bacteria 32791
122 Ga0207643_10040265 3300025908 Bacteria 2630
123 Ga0207684_10000271 3300025910 Bacteria 77032
124 Ga0207693_10006491 3300025915 Bacteria 9685
125 Ga0207663_10025747 3300025916 Bacteria 3406
126 Ga0207646_10026907 3300025922 Bacteria 5244
127 Ga0207694_10076476 3300025924 Bacteria 2622
128 Ga0207650_10006171 3300025925 Bacteria 8168
129 Ga0207706_10114432 3300025933 Bacteria 2373
130 Ga0207686_10002163 3300025934 Bacteria 10822
131 Ga0207686_10018983 3300025934 Bacteria 3901
132 Ga0207709_10005159 3300025935 Bacteria 7448
133 Ga0207709_10009716 3300025935 Bacteria 5301
134 Ga0207709_10043130 3300025935 Bacteria 2718
135 Ga0207709_10053254 3300025935 Bacteria 2489
136 Ga0207670_10126667 3300025936 Bacteria 1864
137 Ga0207669_10042461 3300025937 Bacteria 2655
138 Ga0207704_10007585 3300025938 Bacteria 5136
139 Ga0207704_10024929 3300025938 Bacteria 3255
140 Ga0207691_10097576 3300025940 Bacteria 2626
141 Ga0207711_10013276 3300025941 Bacteria 6845
142 Ga0207661_10273169 3300025944 Bacteria 1509
143 Ga0207712_10035124 3300025961 Bacteria 3402
144 Ga0207640_10029970 3300025981 Bacteria 3347
145 Ga0207677_10002198 3300026023 Bacteria 10246
146 Ga0207703_10065620 3300026035 Bacteria 2984
147 Ga0207678_10168506 3300026067 Bacteria 1870
148 Ga0207708_10001607 3300026075 Bacteria 16831
149 Ga0207708_10025151 3300026075 Bacteria 4502
150 Ga0207708_10065891 3300026075 Bacteria 2769
151 Ga0207641_10122299 3300026088 Bacteria 2324
152 Ga0207648_10003704 3300026089 Bacteria 15997
153 Ga0207648_10028371 3300026089 Bacteria 4963
154 Ga0207676_10002532 3300026095 Bacteria 13036
155 Ga0207676_10292059 3300026095 Bacteria 1485
156 Ga0207674_10246639 3300026116 Bacteria 1733
157 Ga0207675_100013634 3300026118 Bacteria 7586
158 Ga0207675_100014602 3300026118 Bacteria 7320
159 Ga0207675_100046614 3300026118 Bacteria 4050
160 Ga0207675_100084452 3300026118 Bacteria 2979
161 Ga0207675_100195106 3300026118 Bacteria 1943
162 Ga0207683_10011714 3300026121 Bacteria 7486
163 Ga0207683_10056549 3300026121 Unclassified 3442
164 Ga0207683_10226220 3300026121 Bacteria 1705
165 Ga0209998_10013932 3300027717 Bacteria 1676
166 Ga0207428_10000676 3300027907 Bacteria 39945
167 Ga0207428_10031345 3300027907 Bacteria 4388
168 Ga0207428_10147890 3300027907 Unclassified 1790
169 Ga0207428_10158364 3300027907 Bacteria 1720
170 Ga0265338_10005568 3300028800 Bacteria 16385
171 Ga0307408_100171288 3300031548 Bacteria 1734
172 Ga0307405_10167203 3300031731 Bacteria 1564
173 Ga0307413_10059738 3300031824 Bacteria 2344
174 Ga0307413_10096203 3300031824 Bacteria 1943
175 Ga0307413_10098968 3300031824 Bacteria 1921
176 Ga0307410_10017881 3300031852 Bacteria 4269
177 Ga0307410_10039351 3300031852 Bacteria 3104
178 Ga0307407_10053528 3300031903 Bacteria 2322
179 Ga0307409_100135011 3300031995 Bacteria 2115
180 Ga0307416_100014777 3300032002 Bacteria 5365
181 Ga0307416_100074478 3300032002 Bacteria 2836
182 Ga0307416_100169506 3300032002 Bacteria 2030
183 Ga0307415_100001118 3300032126 Bacteria 12532
184 Ga0307415_100002366 3300032126 Bacteria 9385
185 Ga0307415_100004222 3300032126 Bacteria 7422
186 Ga0307415_100028026 3300032126 Bacteria 3577
187 Ga0307415_100071338 3300032126 Bacteria 2442
188 Ga0373958_0026108 3300034819 Bacteria 1117
189 Ga0373926_0000362 3300035083 Bacteria 11558
190 Ga0373944_0000159 3300035089 Bacteria 13387
191 Ga0373923_0000989 3300035111 Bacteria 7682
192 Ga0373936_0000224 3300035113 Bacteria 18650
193 Ga0373941_0049351 3300035115 Bacteria 1332
194 Ga0373945_0022261 3300035116 Bacteria 2181
195 Ga0373943_0009839 3300035170 Bacteria 4281
196 Ga0373946_0003970 3300035171 Bacteria 5260
197 Ga0373961_0014074 3300035241 Bacteria 2027
198 Ga0373962_0011203 3300035242 Bacteria 2245
199 Ga0373924_0008754 3300035410 Bacteria 3690
200 Ga0373935_0012994 3300035692 Bacteria 5018
201 Ga0373927_0011459 3300035695 Bacteria 5906
202 Ga0373937_0021752 3300036401 Bacteria 5757
203 Ga0373937_0402668 3300036401 Bacteria 1298
204 Ga0316584_0261582 3300036712 Bacteria 1262
205 Ga0373925_0044959 3300037068 Bacteria 3279
206 Ga0395899_0143419 3300037312 Bacteria 1698
207 Ga0395899_0146111 3300037312 Bacteria 1679
208 Ga0395900_0011198 3300037418 Bacteria 9173
209 Ga0395900_0057573 3300037418 Bacteria 4001
210 Ga0395900_0086559 3300037418 Bacteria 3220
211 Ga0395898_0055661 3300037466 Bacteria 3858
212 Ga0436364_0415434 3300037853 Bacteria 2066
213 Ga0395901_0005882 3300038443 Bacteria 12411
214 Ga0395901_0056271 3300038443 Bacteria 4091
215 Ga0395901_0118360 3300038443 Bacteria 2783
216 Ga0395901_0144411 3300038443 Bacteria 2501
217 Ga0395901_0154690 3300038443 Bacteria 2409
218 Ga0395901_0172901 3300038443 Bacteria 2266
219 Ga0395901_0366193 3300038443 Unclassified 1485
220 Ga0439448_0004287 3300042005 Bacteria 4018
221 Ga0439448_0015355 3300042005 Bacteria 2319
222 Ga0439450_000626 3300042008 Bacteria 4693
223 Ga0439455_0020907 3300042012 Bacteria 1555
224 Ga0439463_007376 3300042016 Bacteria 2717
225 Ga0439463_014076 3300042016 Bacteria 1971
226 Ga0439444_0000146 3300042437 Bacteria 6156
227 Ga0439464_0004494 3300042439 Bacteria 3570
228 Ga0439464_0016667 3300042439 Bacteria 1989
229 Ga0450916_000353 3300042530 Bacteria 3797
230 Ga0495603_0015964 3300046455 Bacteria 4539
231 Ga0495603_0022297 3300046455 Bacteria 3835
232 Ga0495603_0047453 3300046455 Bacteria 2557
233 Ga0495603_0050829 3300046455 Bacteria 2464
234 Ga0495629_0012197 3300046459 Bacteria 6226
235 Ga0495641_0008514 3300046461 Bacteria 6238
236 Ga0495641_0020451 3300046461 Bacteria 3356
237 Ga0495653_0033456 3300046463 Bacteria 4073
238 Ga0495580_0030557 3300046472 Bacteria 3900
239 Ga0495582_0003803 3300046473 Bacteria 8495
240 Ga0495662_0000433 3300046476 Bacteria 18758
241 Ga0495585_0031388 3300046492 Bacteria 3016
242 Ga0495594_0089220 3300046499 Bacteria 1726
243 Ga0495608_0002610 3300046511 Bacteria 12956
244 Ga0495630_0011712 3300046517 Bacteria 6354
245 Ga0495630_0068976 3300046517 Bacteria 2660
246 Ga0495631_0019000 3300046518 Bacteria 3229
247 Ga0495666_0011288 3300046526 Bacteria 4455
248 Ga0495642_0021602 3300046528 Bacteria 2532
249 Ga0495665_0006947 3300046531 Bacteria 6106
250 Ga0495640_0016137 3300046533 Bacteria 5593
251 Ga0495586_0005917 3300046535 Bacteria 6545
252 Ga0495633_0093220 3300046558 Bacteria 1400
253 Ga0495667_0004912 3300046559 Bacteria 9042
254 Ga0495656_0000145 3300046615 Bacteria 26277
255 Ga0495656_0030815 3300046615 Bacteria 2170
256 Ga0495634_0010560 3300046642 Bacteria 6761
257 Ga0495634_0011291 3300046642 Bacteria 6503
258 Ga0495635_0009115 3300046663 Bacteria 6929
259 Ga0495661_0122922 3300046665 Unclassified 1431
260 Ga0495588_0002122 3300046674 Bacteria 8510
261 Ga0495657_0005648 3300046675 Bacteria 9867
262 Ga0495647_0000137 3300046681 Bacteria 18476
263 Ga0495658_0001007 3300046683 Bacteria 14879
264 Ga0495669_0013122 3300046684 Bacteria 3529
265 Ga0495613_0002460 3300046689 Bacteria 13955
266 Ga0495613_0006954 3300046689 Bacteria 8438
267 Ga0495624_0016101 3300046690 Bacteria 5034
268 Ga0495600_0068569 3300046809 Bacteria 2318
269 Ga0495581_0000570 3300047315 Bacteria 19210
270 Ga0495581_0001117 3300047315 Bacteria 14677
271 Ga0495674_0001381 3300047319 Bacteria 23693
272 Ga0495676_0019786 3300047321 Bacteria 5917
273 Ga0495676_0063561 3300047321 Bacteria 2876
274 Ga0495676_0100080 3300047321 Unclassified 2147
275 Ga0495680_0001399 3300047322 Bacteria 26017
276 Ga0495680_0010207 3300047322 Bacteria 8386
277 Ga0495675_0110400 3300047444 Bacteria 1717
278 Ga0495684_0087445 3300047471 Bacteria 2362
279 Ga0495593_0016586 3300047673 Bacteria 4153
280 Ga0495602_0224219 3300048088 Bacteria 1417
281 Ga0495614_0001077 3300048089 Bacteria 11676
282 Ga0496100_0010744 3300048903 Bacteria 5191
283 Ga0496101_0091114 3300048904 Bacteria 2268
284 Ga0496102_0002160 3300048905 Bacteria 16882
285 Ga0496102_0021326 3300048905 Bacteria 5729
286 Ga0496103_0007954 3300048906 Bacteria 6300
287 Ga0496103_0027464 3300048906 Bacteria 3449
288 Ga0496104_0103120 3300048907 Bacteria 2733
289 Ga0496106_0005243 3300048909 Bacteria 9605
290 Ga0496106_0184645 3300048909 Bacteria 1656
291 Ga0496107_0002037 3300048910 Bacteria 12906
292 Ga0496108_0004402 3300048911 Bacteria 11338
293 Ga0496108_0007735 3300048911 Bacteria 8705
294 Ga0496108_0046095 3300048911 Bacteria 3642
295 Ga0496109_0003248 3300048912 Bacteria 13546
296 Ga0496109_0021339 3300048912 Bacteria 5726
297 Ga0496109_0025268 3300048912 Bacteria 5291
298 Ga0496110_0010496 3300048913 Bacteria 7537
299 Ga0496112_0001100 3300048915 Bacteria 20025
300 Ga0496112_0039420 3300048915 Bacteria 4617
301 Ga0496113_0047266 3300048916 Bacteria 3198
302 Ga0496113_0062973 3300048916 Bacteria 2802
303 Ga0496114_0005670 3300048917 Bacteria 9791
304 Ga0496115_0127475 3300048918 Bacteria 2097
305 Ga0501031_0005249 3300049568 Bacteria 8443
306 Ga0501031_0025843 3300049568 Bacteria 3830
307 Ga0501032_0018530 3300049569 Bacteria 4875
308 Ga0501032_0068840 3300049569 Bacteria 2362
309 Ga0501033_0006216 3300049570 Bacteria 9361
310 Ga0501033_0016727 3300049570 Bacteria 5548
311 Ga0501033_0145151 3300049570 Bacteria 1714
312 Ga0501034_0056010 3300049571 Bacteria 3968
313 Ga0501036_0005214 3300049572 Bacteria 10509
314 Ga0501036_0005291 3300049572 Bacteria 10442
315 Ga0501036_0015928 3300049572 Bacteria 6279
316 Ga0501036_0080545 3300049572 Unclassified 2752
317 Ga0501037_0033645 3300049573 Bacteria 3785
318 Ga0501037_0068098 3300049573 Bacteria 2591
319 Ga0501037_0089459 3300049573 Bacteria 2228
320 Ga0501038_0008944 3300049574 Bacteria 9187
321 Ga0501038_0011069 3300049574 Bacteria 8239
322 Ga0501038_0019877 3300049574 Bacteria 6044
323 Ga0501038_0188574 3300049574 Bacteria 1660
324 Ga0501039_0001006 3300049575 Bacteria 20539
325 Ga0501039_0030436 3300049575 Bacteria 4162
326 Ga0501039_0122506 3300049575 Unclassified 2038
327 Ga0501040_0008011 3300049576 Bacteria 6861
328 Ga0501040_0011009 3300049576 Bacteria 5915
329 Ga0501040_0040318 3300049576 Bacteria 3177
330 Ga0501040_0043942 3300049576 Bacteria 3045
331 Ga0501040_0059122 3300049576 Bacteria 2633
332 Ga0501041_0005945 3300049577 Bacteria 7137
333 Ga0501041_0010055 3300049577 Bacteria 5574
334 Ga0501041_0017825 3300049577 Bacteria 4225
335 Ga0501041_0021136 3300049577 Bacteria 3899
336 Ga0501041_0083375 3300049577 Bacteria 1970
337 Ga0501042_0002263 3300049578 Bacteria 11747
338 Ga0501042_0002863 3300049578 Bacteria 10694
339 Ga0501042_0008391 3300049578 Bacteria 6813
340 Ga0501042_0064092 3300049578 Bacteria 2626
341 Ga0501042_0140138 3300049578 Bacteria 1743
342 Ga0501042_0142297 3300049578 Bacteria 1729
343 Ga0501043_0009830 3300049579 Bacteria 7499
344 Ga0501043_0026246 3300049579 Bacteria 4570
345 Ga0501043_0102071 3300049579 Bacteria 2255
346 Ga0501046_0029708 3300049580 Bacteria 4442
347 Ga0501046_0036283 3300049580 Bacteria 3968
348 Ga0501046_0037611 3300049580 Bacteria 3888
349 Ga0501047_0071195 3300049581 Bacteria 3347
350 Ga0501048_0019511 3300049582 Bacteria 4974
351 Ga0501048_0022704 3300049582 Bacteria 4586
352 Ga0501048_0058914 3300049582 Bacteria 2721
353 Ga0501048_0061119 3300049582 Bacteria 2668
354 Ga0501068_0006670 3300049584 Bacteria 6375
355 Ga0501069_0003864 3300049585 Bacteria 7716
356 Ga0501070_0018950 3300049586 Bacteria 5772
357 Ga0501070_0021963 3300049586 Bacteria 5346
358 Ga0501071_0009168 3300049587 Bacteria 6576
359 Ga0501071_0023939 3300049587 Bacteria 4268
360 Ga0501071_0110375 3300049587 Bacteria 2032
361 Ga0501071_0220738 3300049587 Bacteria 1426
362 Ga0501072_0011621 3300049588 Bacteria 6726
363 Ga0501072_0020464 3300049588 Bacteria 5127
364 Ga0501072_0159070 3300049588 Bacteria 1802
365 Ga0501073_0102150 3300049589 Bacteria 1991
366 Ga0501074_0004456 3300049590 Bacteria 10021
367 Ga0501074_0006882 3300049590 Bacteria 8211
368 Ga0501074_0008677 3300049590 Bacteria 7362
369 Ga0501074_0009619 3300049590 Bacteria 7017
370 Ga0501075_0012001 3300049591 Bacteria 6150
371 Ga0501075_0042110 3300049591 Bacteria 3423
372 Ga0501075_0119761 3300049591 Bacteria 2003
373 Ga0501076_0001420 3300049592 Bacteria 16057
374 Ga0501076_0002186 3300049592 Bacteria 13393
375 Ga0501076_0021341 3300049592 Bacteria 4967
376 Ga0501076_0062805 3300049592 Bacteria 2959
377 Ga0501076_0272389 3300049592 Bacteria 1386
378 Ga0501077_0023474 3300049593 Bacteria 3911
379 Ga0501077_0165708 3300049593 Bacteria 1404
380 Ga0501079_0000175 3300049741 Bacteria 36185
381 Ga0501079_0002292 3300049741 Bacteria 13836
382 Ga0501079_0011878 3300049741 Bacteria 6645
383 Ga0501079_0020126 3300049741 Bacteria 5099
384 Ga0501079_0066851 3300049741 Bacteria 2774
385 Ga0501079_0073927 3300049741 Bacteria 2635
386 Ga0501080_0020244 3300049742 Bacteria 6158
387 Ga0501080_0021636 3300049742 Bacteria 5954
388 Ga0501080_0071765 3300049742 Bacteria 3221
389 Ga0501080_0296436 3300049742 Bacteria 1467
390 Ga0501081_0008877 3300049743 Bacteria 6533
391 Ga0501081_0086894 3300049743 Bacteria 2196
392 Ga0501035_0021808 3300049822 Bacteria 5886
393 Ga0501035_0023354 3300049822 Bacteria 5672
394 Ga0501044_0142597 3300049823 Bacteria 2384
395 Ga0501045_0000623 3300049824 Bacteria 22393
396 Ga0501045_0000704 3300049824 Bacteria 21248
397 Ga0501045_0037257 3300049824 Bacteria 3534
398 Ga0501045_0043312 3300049824 Bacteria 3277
399 nmdc:mga05p37_146934_c1 3300050507 Bacteria 2885
400 nmdc:mga05p37_20427_c1 3300050507 Bacteria 8011
401 nmdc:mga05p37_4280_c1 3300050507 Bacteria 16671
402 nmdc:mga05p37_53100_c1 3300050507 Bacteria 4985
403 nmdc:mga05p37_61054_c1 3300050507 Bacteria 4641
404 nmdc:mga05p37_7535_c1 3300050507 Bacteria 12833
405 nmdc:mga05p37_95571_c1 3300050507 Bacteria 3661
406 nmdc:mga09592_10338_c1 3300050508 Bacteria 7593
407 nmdc:mga09592_17519_c1 3300050508 Bacteria 5870
408 nmdc:mga0qj67_77488_c1 3300050509 Bacteria 2660
409 nmdc:mga06r32_23057_c1 3300050510 Bacteria 5758
410 nmdc:mga06r32_316313_c1 3300050510 Bacteria 1547
411 nmdc:mga06r32_77250_c1 3300050510 Bacteria 3234
412 nmdc:mga08y16_13526_c1 3300050511 Bacteria 8588
413 nmdc:mga08y16_7107_c1 3300050511 Bacteria 11752
414 nmdc:mga0n895_12317_c1 3300050512 Bacteria 7668
415 nmdc:mga0n895_257095_c1 3300050512 Bacteria 1772
416 nmdc:mga0n895_367403_c1 3300050512 Bacteria 1457
417 nmdc:mga0n895_83029_c1 3300050512 Bacteria 3195
418 nmdc:mga0a205_23760_c1 3300050515 Bacteria 5817
419 nmdc:mga0a205_249778_c1 3300050515 Bacteria 1654
420 nmdc:mga0a205_4710_c1 3300050515 Bacteria 8876
421 Ga0495595_0029266 3300053084 Bacteria 2464
422 Ga0495619_0006864 3300053085 Bacteria 7199
423 Ga0495619_0072664 3300053085 Bacteria 2304
424 Ga0501084_0000697 3300054114 Bacteria 25775
425 Ga0501084_0000891 3300054114 Bacteria 23094
426 Ga0501084_0024211 3300054114 Bacteria 5064
427 Ga0501084_0032564 3300054114 Bacteria 4360
428 Ga0501084_0139811 3300054114 Bacteria 2039
429 Ga0501084_0297057 3300054114 Bacteria 1364
430 Ga0590077_022538 3300059426 Bacteria 1344
431 Ga0501082_0003231 3300060353 Bacteria 14208
432 Ga0501082_0003388 3300060353 Bacteria 13911
433 Ga0501082_0022080 3300060353 Bacteria 5487
434 Ga0501082_0046711 3300060353 Bacteria 3731
435 Ga0501082_0058471 3300060353 Bacteria 3321
436 Ga0501082_0072945 3300060353 Bacteria 2956
437 Ga0530510_0006060 3300061734 Bacteria 8396
438 Ga0530510_0009319 3300061734 Bacteria 6887
439 Ga0530510_0104287 3300061734 Bacteria 2074
440 8047713798 8047710418 Bacteria 11023148
441 Ga0501031_0052779
442 JGI24751J29686_10011420
443 JGI25406J46586_10008826
444 Ga0070690_100015733
445 Ga0068869_100042535
446 Ga0070680_100046562
447 Ga0068868_100003426
448 Ga0068868_100033715
449 Ga0070661_100003993
450 Ga0070675_100090430
451 Ga0070703_10000001
452 Ga0070711_100016960
453 Ga0070700_100009549
454 Ga0070700_100062754
455 Ga0070694_100007426
456 Ga0070694_100024936
457 Ga0070708_100020817
458 Ga0070708_100050016
459 Ga0070708_100139279
460 Ga0070678_100021207
461 Ga0070678_100061719
462 Ga0070681_10172150
463 Ga0068867_100005574
464 Ga0070706_100003986
465 Ga0070706_100263758
466 Ga0070707_100004254
467 Ga0070707_100105687
468 Ga0070698_100014464
469 Ga0070698_100017333
470 Ga0070698_100017459
471 Ga0070698_100079492
472 Ga0070684_100008381
473 Ga0070697_100050261
474 Ga0070695_100102262
475 Ga0070696_100006769
476 Ga0070696_100029701
477 Ga0070696_100179752
478 Ga0070704_100020609
479 Ga0070704_100146620
480 Ga0070664_100007616
481 Ga0068857_100121415
482 Ga0068854_100166009
483 Ga0070702_100032764
484 Ga0070702_100057080
485 Ga0068861_100080070
486 Ga0068861_100096721
487 Ga0068863_100090335
488 Ga0068858_100087370
489 Ga0068860_100288958
490 Ga0068862_100029214
491 Ga0081455_10001540
492 Ga0081455_10001936
493 Ga0081455_10006642
494 Ga0081455_10022075
495 Ga0081538_10000472
496 Ga0081538_10005896
497 Ga0081538_10011823
498 Ga0081538_10014604
499 Ga0081539_10002098
500 Ga0081539_10012391
501 Ga0081539_10015126
502 Ga0081539_10043898
503 Ga0081539_10051836
504 Ga0075432_10001085
505 Ga0075428_100015175
506 Ga0075428_100023518
507 Ga0075428_100032550
508 Ga0075428_100167657
509 Ga0075430_100001342
510 Ga0075430_100022661
511 Ga0075431_100000600
512 Ga0075431_100015710
513 Ga0075433_10000145
514 Ga0075433_10043484
515 Ga0075433_10055294
516 Ga0075434_100000512
517 Ga0075434_100020246
518 Ga0075434_100029524
519 Ga0075434_100030341
520 Ga0075434_100077783
521 Ga0075434_100206252
522 Ga0075429_100017664
523 Ga0075429_100170290
524 Ga0068865_100047975
525 Ga0068865_100080866
526 Ga0075435_100000524
527 Ga0105251_10036773
528 Ga0111539_10005444
529 Ga0105245_10023819
530 Ga0114129_10000449
531 Ga0114129_10009394
532 Ga0114129_10016496
533 Ga0114129_10018569
534 Ga0114129_10025314
535 Ga0114129_10135776
536 Ga0105243_10007936
537 Ga0105243_10012214
538 Ga0105243_10041817
539 Ga0105243_10060248
540 Ga0105242_10003542
541 Ga0105242_10007856
542 Ga0105242_10035372
543 Ga0105248_10002332
544 Ga0105249_10016284
545 Ga0105246_10104169
546 Ga0105246_10194436
547 Ga0157378_10003829
548 Ga0157378_10100991
549 Ga0163162_10086780
550 Ga0157372_10195309
551 Ga0157375_10101773
552 Ga0157379_10005930
553 Ga0157376_10112383
554 Ga0163161_10220277
555 Ga0207653_10000004
556 Ga0207653_10011501
557 Ga0207710_10065226
558 Ga0207688_10013943
559 Ga0207645_10012909
560 Ga0207645_10169230
561 Ga0207643_10000324
562 Ga0207643_10040265
563 Ga0207684_10000271
564 Ga0207693_10006491
565 Ga0207663_10025747
566 Ga0207646_10026907
567 Ga0207694_10076476
568 Ga0207650_10006171
569 Ga0207706_10114432
570 Ga0207686_10002163
571 Ga0207686_10018983
572 Ga0207709_10005159
573 Ga0207709_10009716
574 Ga0207709_10043130
575 Ga0207709_10053254
576 Ga0207670_10126667
577 Ga0207669_10042461
578 Ga0207704_10007585
579 Ga0207704_10024929
580 Ga0207691_10097576
581 Ga0207711_10013276
582 Ga0207661_10273169
583 Ga0207712_10035124
584 Ga0207640_10029970
585 Ga0207677_10002198
586 Ga0207703_10065620
587 Ga0207678_10168506
588 Ga0207708_10001607
589 Ga0207708_10025151
590 Ga0207708_10065891
591 Ga0207641_10122299
592 Ga0207648_10003704
593 Ga0207648_10028371
594 Ga0207676_10002532
595 Ga0207676_10292059
596 Ga0207674_10246639
597 Ga0207675_100013634
598 Ga0207675_100014602
599 Ga0207675_100046614
600 Ga0207675_100084452
601 Ga0207675_100195106
602 Ga0207683_10011714
603 Ga0207683_10056549
604 Ga0207683_10226220
605 Ga0209998_10013932
606 Ga0207428_10000676
607 Ga0207428_10031345
608 Ga0207428_10147890
609 Ga0207428_10158364
610 Ga0265338_10005568
611 Ga0307408_100171288
612 Ga0307405_10167203
613 Ga0307413_10059738
614 Ga0307413_10096203
615 Ga0307413_10098968
616 Ga0307410_10017881
617 Ga0307410_10039351
618 Ga0307407_10053528
619 Ga0307409_100135011
620 Ga0307416_100014777
621 Ga0307416_100074478
622 Ga0307416_100169506
623 Ga0307415_100001118
624 Ga0307415_100002366
625 Ga0307415_100004222
626 Ga0307415_100028026
627 Ga0307415_100071338
628 Ga0373958_0026108
629 Ga0373926_0000362
630 Ga0373944_0000159
631 Ga0373923_0000989
632 Ga0373936_0000224
633 Ga0373941_0049351
634 Ga0373945_0022261
635 Ga0373943_0009839
636 Ga0373946_0003970
637 Ga0373961_0014074
638 Ga0373962_0011203
639 Ga0373924_0008754
640 Ga0373935_0012994
641 Ga0373927_0011459
642 Ga0373937_0021752
643 Ga0373937_0402668
644 Ga0316584_0261582
645 Ga0373925_0044959
646 Ga0395899_0143419
647 Ga0395899_0146111
648 Ga0395900_0011198
649 Ga0395900_0057573
650 Ga0395900_0086559
651 Ga0395898_0055661
652 Ga0436364_0415434
653 Ga0395901_0005882
654 Ga0395901_0056271
655 Ga0395901_0118360
656 Ga0395901_0144411
657 Ga0395901_0154690
658 Ga0395901_0172901
659 Ga0395901_0366193
660 Ga0439448_0004287
661 Ga0439448_0015355
662 Ga0439450_000626
663 Ga0439455_0020907
664 Ga0439463_007376
665 Ga0439463_014076
666 Ga0439444_0000146
667 Ga0439464_0004494
668 Ga0439464_0016667
669 Ga0450916_000353
670 Ga0495603_0015964
671 Ga0495603_0022297
672 Ga0495603_0047453
673 Ga0495603_0050829
674 Ga0495629_0012197
675 Ga0495641_0008514
676 Ga0495641_0020451
677 Ga0495653_0033456
678 Ga0495580_0030557
679 Ga0495582_0003803
680 Ga0495662_0000433
681 Ga0495585_0031388
682 Ga0495594_0089220
683 Ga0495608_0002610
684 Ga0495630_0011712
685 Ga0495630_0068976
686 Ga0495631_0019000
687 Ga0495666_0011288
688 Ga0495642_0021602
689 Ga0495665_0006947
690 Ga0495640_0016137
691 Ga0495586_0005917
692 Ga0495633_0093220
693 Ga0495667_0004912
694 Ga0495656_0000145
695 Ga0495656_0030815
696 Ga0495634_0010560
697 Ga0495634_0011291
698 Ga0495635_0009115
699 Ga0495661_0122922
700 Ga0495588_0002122
701 Ga0495657_0005648
702 Ga0495647_0000137
703 Ga0495658_0001007
704 Ga0495669_0013122
705 Ga0495613_0002460
706 Ga0495613_0006954
707 Ga0495624_0016101
708 Ga0495600_0068569
709 Ga0495581_0000570
710 Ga0495581_0001117
711 Ga0495674_0001381
712 Ga0495676_0019786
713 Ga0495676_0063561
714 Ga0495676_0100080
715 Ga0495680_0001399
716 Ga0495680_0010207
717 Ga0495675_0110400
718 Ga0495684_0087445
719 Ga0495593_0016586
720 Ga0495602_0224219
721 Ga0495614_0001077
722 Ga0496100_0010744
723 Ga0496101_0091114
724 Ga0496102_0002160
725 Ga0496102_0021326
726 Ga0496103_0007954
727 Ga0496103_0027464
728 Ga0496104_0103120
729 Ga0496106_0005243
730 Ga0496106_0184645
731 Ga0496107_0002037
732 Ga0496108_0004402
733 Ga0496108_0007735
734 Ga0496108_0046095
735 Ga0496109_0003248
736 Ga0496109_0021339
737 Ga0496109_0025268
738 Ga0496110_0010496
739 Ga0496112_0001100
740 Ga0496112_0039420
741 Ga0496113_0047266
742 Ga0496113_0062973
743 Ga0496114_0005670
744 Ga0496115_0127475
745 Ga0501031_0005249
746 Ga0501031_0025843
747 Ga0501032_0018530
748 Ga0501032_0068840
749 Ga0501033_0006216
750 Ga0501033_0016727
751 Ga0501033_0145151
752 Ga0501034_0056010
753 Ga0501036_0005214
754 Ga0501036_0005291
755 Ga0501036_0015928
756 Ga0501036_0080545
757 Ga0501037_0033645
758 Ga0501037_0068098
759 Ga0501037_0089459
760 Ga0501038_0008944
761 Ga0501038_0011069
762 Ga0501038_0019877
763 Ga0501038_0188574
764 Ga0501039_0001006
765 Ga0501039_0030436
766 Ga0501039_0122506
767 Ga0501040_0008011
768 Ga0501040_0011009
769 Ga0501040_0040318
770 Ga0501040_0043942
771 Ga0501040_0059122
772 Ga0501041_0005945
773 Ga0501041_0010055
774 Ga0501041_0017825
775 Ga0501041_0021136
776 Ga0501041_0083375
777 Ga0501042_0002263
778 Ga0501042_0002863
779 Ga0501042_0008391
780 Ga0501042_0064092
781 Ga0501042_0140138
782 Ga0501042_0142297
783 Ga0501043_0009830
784 Ga0501043_0026246
785 Ga0501043_0102071
786 Ga0501046_0029708
787 Ga0501046_0036283
788 Ga0501046_0037611
789 Ga0501047_0071195
790 Ga0501048_0019511
791 Ga0501048_0022704
792 Ga0501048_0058914
793 Ga0501048_0061119
794 Ga0501068_0006670
795 Ga0501069_0003864
796 Ga0501070_0018950
797 Ga0501070_0021963
798 Ga0501071_0009168
799 Ga0501071_0023939
800 Ga0501071_0110375
801 Ga0501071_0220738
802 Ga0501072_0011621
803 Ga0501072_0020464
804 Ga0501072_0159070
805 Ga0501073_0102150
806 Ga0501074_0004456
807 Ga0501074_0006882
808 Ga0501074_0008677
809 Ga0501074_0009619
810 Ga0501075_0012001
811 Ga0501075_0042110
812 Ga0501075_0119761
813 Ga0501076_0001420
814 Ga0501076_0002186
815 Ga0501076_0021341
816 Ga0501076_0062805
817 Ga0501076_0272389
818 Ga0501077_0023474
819 Ga0501077_0165708
820 Ga0501079_0000175
821 Ga0501079_0002292
822 Ga0501079_0011878
823 Ga0501079_0020126
824 Ga0501079_0066851
825 Ga0501079_0073927
826 Ga0501080_0020244
827 Ga0501080_0021636
828 Ga0501080_0071765
829 Ga0501080_0296436
830 Ga0501081_0008877
831 Ga0501081_0086894
832 Ga0501035_0021808
833 Ga0501035_0023354
834 Ga0501044_0142597
835 Ga0501045_0000623
836 Ga0501045_0000704
837 Ga0501045_0037257
838 Ga0501045_0043312
839 nmdc:mga05p37_146934_c1
840 nmdc:mga05p37_20427_c1
841 nmdc:mga05p37_4280_c1
842 nmdc:mga05p37_53100_c1
843 nmdc:mga05p37_61054_c1
844 nmdc:mga05p37_7535_c1
845 nmdc:mga05p37_95571_c1
846 nmdc:mga09592_10338_c1
847 nmdc:mga09592_17519_c1
848 nmdc:mga0qj67_77488_c1
849 nmdc:mga06r32_23057_c1
850 nmdc:mga06r32_316313_c1
851 nmdc:mga06r32_77250_c1
852 nmdc:mga08y16_13526_c1
853 nmdc:mga08y16_7107_c1
854 nmdc:mga0n895_12317_c1
855 nmdc:mga0n895_257095_c1
856 nmdc:mga0n895_367403_c1
857 nmdc:mga0n895_83029_c1
858 nmdc:mga0a205_23760_c1
859 nmdc:mga0a205_249778_c1
860 nmdc:mga0a205_4710_c1
861 Ga0495595_0029266
862 Ga0495619_0006864
863 Ga0495619_0072664
864 Ga0501084_0000697
865 Ga0501084_0000891
866 Ga0501084_0024211
867 Ga0501084_0032564
868 Ga0501084_0139811
869 Ga0501084_0297057
870 Ga0590077_022538
871 Ga0501082_0003231
872 Ga0501082_0003388
873 Ga0501082_0022080
874 Ga0501082_0046711
875 Ga0501082_0058471
876 Ga0501082_0072945
877 Ga0530510_0006060
878 Ga0530510_0009319
879 Ga0530510_0104287
880 8047713798

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05762

VWA_CoxE

VWA domain containing CoxE-like protein

178

398

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lsy-assembly1.cif.gz_B nhej short-range synaptic complex 0.6357 216 374
5xn8-assembly1.cif.gz_A structure of glycerol dehydrogenase crystallised as a contaminant 0.6253 216 338
8jtl-assembly1.cif.gz_B structure of oy phytoplasma sap05 binding with atrpn10 0.6216 215 374
6tyz-assembly1.cif.gz_A structure of ku80 von willebrand domain complexed with aplf ku binding motif 0.6215 217 375
6m48-assembly2.cif.gz_B crystal structure of pilus adhesin, spac from lactobacillus rhamnosus gg - p21212 form 0.6215 215 379
ID Description Score Start End Superfamily
af_O53703_171_392_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8258 159 370 3.40.50.410
af_O53703_171_392_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7887 159 370 3.40.50.410
af_P33352_208_374_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7304 216 380 3.40.50.410
af_P33352_208_374_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.6966 216 380 3.40.50.410
af_A0A1D6GEW7_553_745_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.6572 218 374 3.40.50.410
ID Description Score Start End GO Terms
AF-A0A353LV46-F1-model_v4 VWA domain-containing protein 0.9725 10 77
AF-A0A6V8KXQ5-F1-model_v4 VWA domain-containing protein 0.9653 305 380
AF-A0A534PZX0-F1-model_v4 VWA domain-containing protein 0.957 300 378
AF-A0A7C7ZRM7-F1-model_v4 VWA domain-containing protein 0.957 302 379
AF-B5I754-F1-model_v4 VWA containing CoxE family protein 0.9555 305 377

Map